F460989

General Info

Members Datasets Scaffolds Average Seq Length
538 248 1076 321

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100002814|Ga0070699_1000028146
Length 353
Sequence LATLGGAAAAWPLGVRGQQSAMPVIGFLSIRSPGTDAQFLVSFRQGLSDSGFVEGQNIAVEYRYAEGQIDRLPSLVADLVRRQVAIIVTTGSVQGALTAKTATNTIPIVFTTGGDPLREGLVHSLNRPGGNLTGVTTSFSEAASKRLGLLREIAPKSAVIGVLVNPNDPVAANNEADNMRAAARSVGQRIEILQAGTERDIDTVFASMIDMRVDALLVAPHALFATQTNQLVALAARHAIPTLYWRREFAEAGGLMSYGSSLADAFRVVGVYAGRILKGEKPGDLPVQQPTKFELVVNVKAAKTIGLTIPESFLARADEVIELLSVLQGPFHLEVRILVRRCKIITCRIEAHP

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
242 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
243 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
244 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
245 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
246 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
247 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
248 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 0
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0.74
Rhizoplane 12.45
Rhizosphere 82.9
Stem 0
Stem Tuber 0
Unclassified 10.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100002814 3300005518 Bacteria 15528
2 rootL2_10236405 3300003322 Bacteria 3541
3 JGI25405J52794_10005924 3300003911 Unclassified 2222
4 Ga0065712_10000812 3300005290 Bacteria 8440
5 Ga0065707_10194599 3300005295 Unclassified 1334
6 Ga0070658_10088214 3300005327 Bacteria 2554
7 Ga0070683_100024187 3300005329 Bacteria 5438
8 Ga0070690_100210226 3300005330 Bacteria 1358
9 Ga0070670_100006844 3300005331 Bacteria 9659
10 Ga0070670_100027391 3300005331 Unclassified 4903
11 Ga0070670_100191036 3300005331 Bacteria 1779
12 Ga0070677_10060942 3300005333 Unclassified 1556
13 Ga0070680_100086552 3300005336 Bacteria 2590
14 Ga0070680_100181550 3300005336 Bacteria 1772
15 Ga0070661_100124002 3300005344 Unclassified 1937
16 Ga0070668_100229861 3300005347 Bacteria 1533
17 Ga0070668_100336960 3300005347 Bacteria 1273
18 Ga0070669_100030912 3300005353 Unclassified 3865
19 Ga0070673_100011109 3300005364 Bacteria 6138
20 Ga0070688_100331364 3300005365 Bacteria 1109
21 Ga0070659_100178315 3300005366 Bacteria 1743
22 Ga0070667_100108840 3300005367 Unclassified 2401
23 Ga0070709_10041987 3300005434 Unclassified 2821
24 Ga0070709_10136243 3300005434 Bacteria 1682
25 Ga0070709_10159574 3300005434 Bacteria 1567
26 Ga0070714_100025961 3300005435 Bacteria 4838
27 Ga0070714_100142714 3300005435 Bacteria 2151
28 Ga0070714_100150541 3300005435 Bacteria 2097
29 Ga0070713_100005517 3300005436 Bacteria 8661
30 Ga0070713_100025840 3300005436 Bacteria 4599
31 Ga0070713_100082215 3300005436 Bacteria 2749
32 Ga0070713_100114274 3300005436 Bacteria 2358
33 Ga0070710_10014013 3300005437 Bacteria 4027
34 Ga0070708_100079990 3300005445 Bacteria 2957
35 Ga0070708_100137257 3300005445 Bacteria 2266
36 Ga0070708_100427145 3300005445 Unclassified 1250
37 Ga0070678_100248470 3300005456 Bacteria 1491
38 Ga0070662_100214872 3300005457 Unclassified 1532
39 Ga0070681_10025308 3300005458 Bacteria 5969
40 Ga0070681_10083592 3300005458 Bacteria 3146
41 Ga0070681_10187912 3300005458 Bacteria 1986
42 Ga0070681_10419326 3300005458 Bacteria 1250
43 Ga0068867_100376294 3300005459 Unclassified 1192
44 Ga0068867_100423690 3300005459 Bacteria 1128
45 Ga0070685_10088869 3300005466 Bacteria 1867
46 Ga0070706_100006951 3300005467 Bacteria 10673
47 Ga0070706_100007448 3300005467 Bacteria 10261
48 Ga0070706_100053096 3300005467 Bacteria 3740
49 Ga0070706_100063199 3300005467 Bacteria 3421
50 Ga0070706_100100524 3300005467 Bacteria 2687
51 Ga0070706_100147686 3300005467 Bacteria 2195
52 Ga0070706_100153432 3300005467 Bacteria 2150
53 Ga0070706_100171598 3300005467 Bacteria 2025
54 Ga0070706_100206093 3300005467 Bacteria 1836
55 Ga0070706_100266173 3300005467 Bacteria 1600
56 Ga0070707_100023281 3300005468 Bacteria 5860
57 Ga0070707_100031157 3300005468 Bacteria 5079
58 Ga0070707_100141136 3300005468 Bacteria 2345
59 Ga0070707_100266377 3300005468 Unclassified 1666
60 Ga0070707_100318517 3300005468 Bacteria 1511
61 Ga0070707_100355153 3300005468 Bacteria 1423
62 Ga0070707_100355997 3300005468 Bacteria 1422
63 Ga0070698_100051731 3300005471 Bacteria 4182
64 Ga0070698_100111504 3300005471 Bacteria 2700
65 Ga0070698_100291337 3300005471 Bacteria 1563
66 Ga0070698_100326865 3300005471 Bacteria 1464
67 Ga0070698_100352070 3300005471 Bacteria 1404
68 Ga0070698_100459032 3300005471 Unclassified 1210
69 Ga0070699_100009610 3300005518 Bacteria 8377
70 Ga0070699_100018486 3300005518 Bacteria 5986
71 Ga0070699_100030897 3300005518 Bacteria 4624
72 Ga0070699_100044890 3300005518 Bacteria 3826
73 Ga0070699_100337767 3300005518 Bacteria 1355
74 Ga0070679_100014581 3300005530 Bacteria 7551
75 Ga0070679_100265212 3300005530 Bacteria 1672
76 Ga0070684_100325577 3300005535 Unclassified 1412
77 Ga0070697_100003021 3300005536 Bacteria 12919
78 Ga0070697_100022387 3300005536 Bacteria 5016
79 Ga0070697_100061739 3300005536 Bacteria 3057
80 Ga0070697_100114863 3300005536 Bacteria 2247
81 Ga0070697_100243427 3300005536 Bacteria 1536
82 Ga0068853_100032588 3300005539 Bacteria 4415
83 Ga0068853_100174608 3300005539 Bacteria 1946
84 Ga0068853_100223678 3300005539 Bacteria 1720
85 Ga0070672_100018751 3300005543 Bacteria 5011
86 Ga0070672_100211854 3300005543 Unclassified 1623
87 Ga0070672_100218243 3300005543 Bacteria 1599
88 Ga0070696_100013538 3300005546 Bacteria 5474
89 Ga0070696_100020265 3300005546 Bacteria 4508
90 Ga0070696_100096719 3300005546 Bacteria 2110
91 Ga0068855_100022696 3300005563 Bacteria 7520
92 Ga0068855_100452730 3300005563 Bacteria 1400
93 Ga0068857_100047523 3300005577 Bacteria 3810
94 Ga0068857_100128696 3300005577 Bacteria 2283
95 Ga0068854_100089736 3300005578 Unclassified 2285
96 Ga0068856_100000236 3300005614 Bacteria 60041
97 Ga0068856_100041684 3300005614 Bacteria 4513
98 Ga0070702_100071900 3300005615 Bacteria 2046
99 Ga0068852_100192190 3300005616 Bacteria 1927
100 Ga0068864_100008466 3300005618 Bacteria 8489
101 Ga0068861_100190786 3300005719 Bacteria 1713
102 Ga0068858_100182312 3300005842 Unclassified 1983
103 Ga0068860_100236032 3300005843 Bacteria 1778
104 Ga0068862_100166991 3300005844 Bacteria 1968
105 Ga0081455_10010080 3300005937 Bacteria 9641
106 Ga0081455_10035746 3300005937 Bacteria 4434
107 Ga0081455_10036882 3300005937 Bacteria 4347
108 Ga0081455_10038255 3300005937 Bacteria 4249
109 Ga0081455_10047845 3300005937 Bacteria 3700
110 Ga0081455_10049249 3300005937 Bacteria 3633
111 Ga0081455_10074121 3300005937 Bacteria 2812
112 Ga0081455_10094680 3300005937 Unclassified 2412
113 Ga0081455_10101598 3300005937 Bacteria 2308
114 Ga0081455_10276213 3300005937 Bacteria 1216
115 Ga0081538_10038722 3300005981 Bacteria 3071
116 Ga0081540_1021204 3300005983 Bacteria 3880
117 Ga0081540_1030995 3300005983 Bacteria 2950
118 Ga0070717_10033571 3300006028 Bacteria 4140
119 Ga0070717_10035187 3300006028 Bacteria 4052
120 Ga0070717_10073257 3300006028 Bacteria 2862
121 Ga0070717_10107295 3300006028 Bacteria 2378
122 Ga0070717_10248595 3300006028 Bacteria 1570
123 Ga0070717_10283020 3300006028 Bacteria 1471
124 Ga0070717_10407011 3300006028 Bacteria 1223
125 Ga0075365_10016047 3300006038 Bacteria 4544
126 Ga0075365_10071699 3300006038 Bacteria 2332
127 Ga0075365_10075226 3300006038 Bacteria 2279
128 Ga0075365_10077639 3300006038 Bacteria 2244
129 Ga0075365_10096972 3300006038 Bacteria 2015
130 Ga0075365_10189387 3300006038 Bacteria 1439
131 Ga0075364_10164654 3300006051 Bacteria 1498
132 Ga0070715_10013388 3300006163 Bacteria 3011
133 Ga0070715_10048876 3300006163 Bacteria 1810
134 Ga0070715_10068399 3300006163 Bacteria 1579
135 Ga0070716_100011158 3300006173 Bacteria 4522
136 Ga0070716_100125935 3300006173 Bacteria 1611
137 Ga0070716_100134574 3300006173 Bacteria 1567
138 Ga0070712_100038121 3300006175 Bacteria 3282
139 Ga0070712_100059842 3300006175 Bacteria 2684
140 Ga0070712_100109022 3300006175 Bacteria 2062
141 Ga0070712_100255336 3300006175 Bacteria 1403
142 Ga0070712_100272924 3300006175 Unclassified 1359
143 Ga0097621_100136879 3300006237 Bacteria 2090
144 Ga0075370_10052794 3300006353 Bacteria 2307
145 Ga0068871_100255786 3300006358 Bacteria 1526
146 Ga0068871_100559342 3300006358 Bacteria 1037
147 Ga0075428_100104605 3300006844 Bacteria 3087
148 Ga0075428_100195452 3300006844 Bacteria 2188
149 Ga0075428_100411255 3300006844 Bacteria 1449
150 Ga0075428_100420669 3300006844 Bacteria 1432
151 Ga0075428_100428421 3300006844 Bacteria 1417
152 Ga0075428_100471050 3300006844 Bacteria 1345
153 Ga0075428_100752728 3300006844 Unclassified 1037
154 Ga0075430_100007999 3300006846 Bacteria 8936
155 Ga0075430_100143488 3300006846 Bacteria 1988
156 Ga0075431_100097103 3300006847 Bacteria 3042
157 Ga0075431_100190997 3300006847 Bacteria 2098
158 Ga0075431_100492153 3300006847 Unclassified 1218
159 Ga0075433_10302882 3300006852 Bacteria 1415
160 Ga0075434_100107339 3300006871 Bacteria 2802
161 Ga0075434_100151538 3300006871 Bacteria 2339
162 Ga0075434_100295592 3300006871 Bacteria 1639
163 Ga0075434_100352195 3300006871 Bacteria 1493
164 Ga0075429_100013785 3300006880 Bacteria 7010
165 Ga0075429_100491870 3300006880 Bacteria 1075
166 Ga0075436_100114248 3300006914 Bacteria 1885
167 Ga0075435_100105448 3300007076 Bacteria 2340
168 Ga0075435_100132844 3300007076 Bacteria 2083
169 Ga0099794_10012964 3300007265 Bacteria 3616
170 Ga0099795_10042563 3300007788 Bacteria 1622
171 Ga0105240_10081277 3300009093 Bacteria 3982
172 Ga0105240_10083161 3300009093 Bacteria 3929
173 Ga0105240_10142221 3300009093 Bacteria 2867
174 Ga0105240_10576863 3300009093 Bacteria 1241
175 Ga0111539_10025653 3300009094 Bacteria 7223
176 Ga0111539_10030804 3300009094 Bacteria 6521
177 Ga0111539_10279491 3300009094 Bacteria 1943
178 Ga0111539_10484414 3300009094 Unclassified 1441
179 Ga0105245_10235182 3300009098 Bacteria 1774
180 Ga0105245_10317596 3300009098 Bacteria 1533
181 Ga0105245_10417370 3300009098 Bacteria 1344
182 Ga0105247_10268813 3300009101 Bacteria 1172
183 Ga0114129_10398346 3300009147 Unclassified 1814
184 Ga0114129_10447104 3300009147 Bacteria 1695
185 Ga0114129_10746035 3300009147 Bacteria 1254
186 Ga0114129_10860030 3300009147 Bacteria 1152
187 Ga0105241_10373793 3300009174 Bacteria 1243
188 Ga0105242_10498097 3300009176 Bacteria 1158
189 Ga0105248_10031765 3300009177 Bacteria 5900
190 Ga0105248_10038110 3300009177 Bacteria 5379
191 Ga0105248_10059838 3300009177 Bacteria 4279
192 Ga0105248_10277101 3300009177 Unclassified 1888
193 Ga0105237_10059113 3300009545 Bacteria 3835
194 Ga0105237_10098376 3300009545 Bacteria 2916
195 Ga0105237_10267611 3300009545 Bacteria 1712
196 Ga0105238_10331153 3300009551 Bacteria 1510
197 Ga0105249_10198112 3300009553 Unclassified 1964
198 Ga0105249_10441786 3300009553 Unclassified 1338
199 Ga0105239_10198460 3300010375 Bacteria 2248
200 Ga0105246_10008111 3300011119 Bacteria 6445
201 Ga0105246_10362285 3300011119 Unclassified 1192
202 Ga0157373_10243420 3300013100 Bacteria 1271
203 Ga0157370_10033753 3300013104 Bacteria 4987
204 Ga0157370_10044826 3300013104 Bacteria 4247
205 Ga0157370_10091650 3300013104 Bacteria 2853
206 Ga0157369_10010211 3300013105 Bacteria 10714
207 Ga0157369_10068819 3300013105 Bacteria 3803
208 Ga0157374_10571617 3300013296 Bacteria 1139
209 Ga0157378_10120718 3300013297 Bacteria 2415
210 Ga0157378_10196057 3300013297 Bacteria 1907
211 Ga0163162_10317809 3300013306 Bacteria 1690
212 Ga0163162_10404770 3300013306 Bacteria 1497
213 Ga0163162_10505987 3300013306 Bacteria 1338
214 Ga0163162_10607779 3300013306 Bacteria 1219
215 Ga0157372_10006140 3300013307 Bacteria 12763
216 Ga0157372_10015986 3300013307 Bacteria 8050
217 Ga0157375_10223657 3300013308 Bacteria 2041
218 Ga0157375_10276381 3300013308 Bacteria 1842
219 Ga0157375_10302037 3300013308 Bacteria 1764
220 Ga0163163_10033577 3300014325 Bacteria 4965
221 Ga0163163_10326927 3300014325 Bacteria 1587
222 Ga0163163_10340393 3300014325 Bacteria 1555
223 Ga0163163_10401233 3300014325 Bacteria 1429
224 Ga0157380_10271407 3300014326 Unclassified 1547
225 Ga0157377_10164830 3300014745 Bacteria 1381
226 Ga0157379_10336278 3300014968 Bacteria 1380
227 Ga0157376_10008504 3300014969 Bacteria 7411
228 Ga0157376_10062232 3300014969 Bacteria 3140
229 Ga0157376_10373758 3300014969 Bacteria 1371
230 Ga0163161_10183600 3300017792 Bacteria 1605
231 Ga0163161_10279328 3300017792 Bacteria 1309
232 Ga0163161_10317938 3300017792 Bacteria 1230
233 Ga0163161_10439081 3300017792 Bacteria 1053
234 Ga0207682_10115594 3300025893 Unclassified 1185
235 Ga0207692_10011021 3300025898 Bacteria 3827
236 Ga0207642_10039341 3300025899 Bacteria 2054
237 Ga0207710_10135082 3300025900 Bacteria 1187
238 Ga0207688_10179395 3300025901 Unclassified 1263
239 Ga0207685_10082646 3300025905 Bacteria 1333
240 Ga0207699_10058119 3300025906 Bacteria 2312
241 Ga0207699_10181743 3300025906 Unclassified 1414
242 Ga0207684_10003355 3300025910 Bacteria 15680
243 Ga0207684_10012194 3300025910 Bacteria 7479
244 Ga0207684_10013913 3300025910 Bacteria 6950
245 Ga0207684_10022146 3300025910 Bacteria 5427
246 Ga0207684_10030251 3300025910 Bacteria 4610
247 Ga0207684_10132653 3300025910 Bacteria 2138
248 Ga0207684_10161258 3300025910 Bacteria 1931
249 Ga0207707_10022153 3300025912 Bacteria 5554
250 Ga0207707_10048058 3300025912 Bacteria 3717
251 Ga0207707_10071458 3300025912 Bacteria 3024
252 Ga0207695_10014716 3300025913 Bacteria 9252
253 Ga0207695_10206340 3300025913 Bacteria 1878
254 Ga0207695_10318452 3300025913 Bacteria 1445
255 Ga0207671_10245783 3300025914 Bacteria 1406
256 Ga0207671_10258189 3300025914 Bacteria 1371
257 Ga0207693_10041447 3300025915 Bacteria 3625
258 Ga0207693_10043387 3300025915 Bacteria 3539
259 Ga0207693_10080776 3300025915 Bacteria 2545
260 Ga0207693_10108011 3300025915 Bacteria 2183
261 Ga0207693_10191799 3300025915 Bacteria 1608
262 Ga0207693_10353087 3300025915 Unclassified 1150
263 Ga0207693_10411158 3300025915 Bacteria 1058
264 Ga0207663_10030970 3300025916 Bacteria 3161
265 Ga0207663_10084157 3300025916 Bacteria 2091
266 Ga0207660_10010073 3300025917 Bacteria 6123
267 Ga0207660_10090462 3300025917 Bacteria 2268
268 Ga0207660_10310006 3300025917 Bacteria 1258
269 Ga0207662_10226411 3300025918 Bacteria 1219
270 Ga0207649_10315092 3300025920 Bacteria 1148
271 Ga0207652_10055769 3300025921 Bacteria 3400
272 Ga0207652_10074591 3300025921 Bacteria 2954
273 Ga0207646_10004816 3300025922 Bacteria 14472
274 Ga0207646_10011485 3300025922 Bacteria 8575
275 Ga0207646_10037762 3300025922 Bacteria 4353
276 Ga0207646_10096014 3300025922 Bacteria 2655
277 Ga0207646_10112566 3300025922 Bacteria 2443
278 Ga0207646_10154151 3300025922 Unclassified 2072
279 Ga0207646_10269486 3300025922 Bacteria 1539
280 Ga0207646_10345658 3300025922 Bacteria 1344
281 Ga0207646_10399534 3300025922 Bacteria 1241
282 Ga0207681_10034032 3300025923 Unclassified 3347
283 Ga0207659_10285311 3300025926 Bacteria 1351
284 Ga0207687_10260452 3300025927 Bacteria 1382
285 Ga0207700_10019219 3300025928 Bacteria 4611
286 Ga0207700_10222022 3300025928 Bacteria 1602
287 Ga0207700_10408016 3300025928 Bacteria 1191
288 Ga0207664_10132876 3300025929 Bacteria 2097
289 Ga0207664_10139890 3300025929 Bacteria 2046
290 Ga0207664_10279916 3300025929 Unclassified 1464
291 Ga0207664_10287323 3300025929 Bacteria 1444
292 Ga0207706_10147034 3300025933 Bacteria 2073
293 Ga0207706_10159894 3300025933 Bacteria 1980
294 Ga0207706_10363465 3300025933 Bacteria 1257
295 Ga0207669_10367612 3300025937 Unclassified 1117
296 Ga0207665_10000576 3300025939 Bacteria 24692
297 Ga0207665_10115712 3300025939 Bacteria 1889
298 Ga0207665_10234785 3300025939 Bacteria 1349
299 Ga0207691_10030754 3300025940 Bacteria 5015
300 Ga0207691_10111451 3300025940 Unclassified 2433
301 Ga0207711_10024476 3300025941 Bacteria 5060
302 Ga0207711_10036000 3300025941 Bacteria 4198
303 Ga0207661_10033144 3300025944 Unclassified 4008
304 Ga0207667_10121298 3300025949 Bacteria 2693
305 Ga0207667_10436396 3300025949 Bacteria 1332
306 Ga0207712_10181662 3300025961 Bacteria 1653
307 Ga0207712_10357267 3300025961 Bacteria 1216
308 Ga0207658_10143497 3300025986 Unclassified 1936
309 Ga0207658_10548813 3300025986 Unclassified 1034
310 Ga0207639_10050911 3300026041 Bacteria 3147
311 Ga0207639_10344264 3300026041 Bacteria 1330
312 Ga0207678_10119096 3300026067 Bacteria 2253
313 Ga0207708_10172833 3300026075 Bacteria 1712
314 Ga0207702_10000081 3300026078 Bacteria 108009
315 Ga0207702_10403927 3300026078 Bacteria 1318
316 Ga0207702_10599452 3300026078 Unclassified 1081
317 Ga0207675_100184101 3300026118 Bacteria 2001
318 Ga0207675_100243188 3300026118 Unclassified 1739
319 Ga0207683_10052430 3300026121 Bacteria 3574
320 Ga0207683_10102880 3300026121 Bacteria 2551
321 Ga0207683_10422577 3300026121 Bacteria 1228
322 Ga0207698_10311538 3300026142 Bacteria 1470
323 Ga0207698_10338848 3300026142 Bacteria 1415
324 Ga0209588_1017696 3300027671 Bacteria 2211
325 Ga0207428_10006400 3300027907 Bacteria 10881
326 Ga0207428_10175006 3300027907 Bacteria 1624
327 Ga0268266_10425024 3300028379 Bacteria 1260
328 Ga0268265_10203904 3300028380 Bacteria 1718
329 Ga0268265_10226458 3300028380 Bacteria 1640
330 Ga0268264_10427965 3300028381 Bacteria 1278
331 Ga0265332_10097143 3300031238 Unclassified 1244
332 Ga0307510_10137984 3300033180 Bacteria 2091
333 Ga0373944_0017232 3300035089 Bacteria 2048
334 Ga0373936_0068619 3300035113 Bacteria 1458
335 Ga0373939_0017546 3300035114 Bacteria 1902
336 Ga0373945_0021302 3300035116 Unclassified 2227
337 Ga0373953_0008108 3300035117 Bacteria 3555
338 Ga0373956_0010521 3300035119 Bacteria 3793
339 Ga0373957_0006759 3300035120 Bacteria 3632
340 Ga0373943_0002805 3300035170 Bacteria 7921
341 Ga0373943_0013984 3300035170 Bacteria 3628
342 Ga0373946_0023708 3300035171 Bacteria 2400
343 Ga0373946_0062153 3300035171 Bacteria 1592
344 Ga0373955_0033311 3300035172 Bacteria 2712
345 Ga0373935_0026366 3300035692 Bacteria 3586
346 Ga0373935_0042093 3300035692 Bacteria 2871
347 Ga0373927_0004182 3300035695 Bacteria 10144
348 Ga0373927_0034912 3300035695 Bacteria 3271
349 Ga0373927_0067321 3300035695 Bacteria 2317
350 Ga0373933_0053861 3300035724 Bacteria 2410
351 Ga0373947_0000377 3300035725 Bacteria 25225
352 Ga0373947_0249247 3300035725 Unclassified 1174
353 Ga0373947_0267132 3300035725 Bacteria 1135
354 Ga0373937_0570744 3300036401 Bacteria 1074
355 Ga0373925_0027310 3300037068 Bacteria 4179
356 Ga0373925_0046659 3300037068 Bacteria 3222
357 Ga0395900_0009765 3300037418 Bacteria 9833
358 Ga0395898_0019500 3300037466 Bacteria 6900
359 Ga0395901_0070048 3300038443 Bacteria 3653
360 Ga0395901_0146682 3300038443 Bacteria 2480
361 Ga0395901_0316020 3300038443 Bacteria 1617
362 Ga0395901_0453130 3300038443 Bacteria 1312
363 Ga0395901_0560328 3300038443 Bacteria 1157
364 Ga0436363_0836995 3300039450 Unclassified 1060
365 Ga0451853_2433772 3300041512 Bacteria 1499
366 Ga0451577_0045699 3300042876 Bacteria 3919
367 Ga0453683_0045160 3300044673 Bacteria 2763
368 Ga0453683_0108264 3300044673 Bacteria 1747
369 Ga0453684_0026940 3300044712 Bacteria 8278
370 Ga0466967_0128061 3300045976 Bacteria 2354
371 Ga0495592_0037403 3300046454 Bacteria 3654
372 Ga0495603_0060583 3300046455 Bacteria 2236
373 Ga0495603_0207289 3300046455 Unclassified 1132
374 Ga0495641_0040252 3300046461 Bacteria 2174
375 Ga0495641_0147650 3300046461 Bacteria 1050
376 Ga0495651_0011643 3300046462 Bacteria 6762
377 Ga0495651_0099072 3300046462 Bacteria 2174
378 Ga0495653_0103625 3300046463 Unclassified 2057
379 Ga0495580_0069286 3300046472 Bacteria 2465
380 Ga0495582_0014962 3300046473 Bacteria 4266
381 Ga0495582_0150582 3300046473 Bacteria 1321
382 Ga0495639_0091435 3300046475 Unclassified 1428
383 Ga0495662_0007012 3300046476 Bacteria 5596
384 Ga0495662_0036168 3300046476 Bacteria 2384
385 Ga0495585_0119005 3300046492 Bacteria 1398
386 Ga0495594_0146858 3300046499 Bacteria 1338
387 Ga0495608_0019862 3300046511 Bacteria 4620
388 Ga0495620_0093241 3300046515 Bacteria 1206
389 Ga0495628_0007577 3300046516 Bacteria 9385
390 Ga0495630_0095412 3300046517 Bacteria 2249
391 Ga0495630_0235505 3300046517 Bacteria 1399
392 Ga0495630_0361557 3300046517 Bacteria 1111
393 Ga0495637_0040980 3300046520 Bacteria 1990
394 Ga0495652_0029885 3300046529 Bacteria 4782
395 Ga0495652_0264927 3300046529 Bacteria 1266
396 Ga0495652_0348705 3300046529 Bacteria 1061
397 Ga0495640_0071432 3300046533 Bacteria 2329
398 Ga0495587_0047195 3300046536 Bacteria 2554
399 Ga0495587_0138082 3300046536 Bacteria 1392
400 Ga0495645_0025884 3300046543 Bacteria 4259
401 Ga0495667_0052270 3300046559 Bacteria 2692
402 Ga0495656_0070977 3300046615 Bacteria 1547
403 Ga0495668_0068361 3300046616 Unclassified 1954
404 Ga0495668_0201764 3300046616 Bacteria 1089
405 Ga0495634_0012669 3300046642 Bacteria 6104
406 Ga0495634_0240024 3300046642 Bacteria 1112
407 Ga0495635_0007501 3300046663 Bacteria 7612
408 Ga0495635_0040299 3300046663 Bacteria 3228
409 Ga0495661_0224745 3300046665 Bacteria 971
410 Ga0495588_0021885 3300046674 Bacteria 3155
411 Ga0495657_0024177 3300046675 Bacteria 4331
412 Ga0495599_0026015 3300046678 Bacteria 3666
413 Ga0495623_0053477 3300046679 Bacteria 2549
414 Ga0495623_0054270 3300046679 Bacteria 2528
415 Ga0495646_0079359 3300046680 Bacteria 1916
416 Ga0495613_0125370 3300046689 Bacteria 1842
417 Ga0495624_0021615 3300046690 Bacteria 4264
418 Ga0495624_0072130 3300046690 Bacteria 2148
419 Ga0495624_0081072 3300046690 Bacteria 2010
420 Ga0495600_0023891 3300046809 Bacteria 3933
421 Ga0495581_0072438 3300047315 Bacteria 1993
422 Ga0495674_0051903 3300047319 Bacteria 3612
423 Ga0495674_0376462 3300047319 Bacteria 1149
424 Ga0495676_0070165 3300047321 Bacteria 2700
425 Ga0495676_0078302 3300047321 Bacteria 2517
426 Ga0495676_0084850 3300047321 Bacteria 2388
427 Ga0495675_0201396 3300047444 Bacteria 1211
428 Ga0495684_0002474 3300047471 Bacteria 14722
429 Ga0495684_0037176 3300047471 Bacteria 3733
430 Ga0495602_0018414 3300048088 Bacteria 6974
431 Ga0495602_0200076 3300048088 Bacteria 1525
432 Ga0496100_0241213 3300048903 Bacteria 1334
433 Ga0496101_0333129 3300048904 Bacteria 1191
434 Ga0496101_0386452 3300048904 Bacteria 1101
435 Ga0496102_0077606 3300048905 Bacteria 3057
436 Ga0496102_0093261 3300048905 Bacteria 2789
437 Ga0496102_0158532 3300048905 Bacteria 2128
438 Ga0496102_0539106 3300048905 Bacteria 1089
439 Ga0496103_0063516 3300048906 Bacteria 2300
440 Ga0496103_0099501 3300048906 Bacteria 1839
441 Ga0496104_0001667 3300048907 Bacteria 19175
442 Ga0496104_0002519 3300048907 Bacteria 15779
443 Ga0496104_0003564 3300048907 Bacteria 13432
444 Ga0496104_0017271 3300048907 Bacteria 6566
445 Ga0496104_0022578 3300048907 Bacteria 5779
446 Ga0496104_0030199 3300048907 Bacteria 5035
447 Ga0496104_0030424 3300048907 Bacteria 5017
448 Ga0496104_0125800 3300048907 Bacteria 2461
449 Ga0496104_0169653 3300048907 Bacteria 2092
450 Ga0496104_0189399 3300048907 Bacteria 1968
451 Ga0496104_0456320 3300048907 Unclassified 1190
452 Ga0496105_0004441 3300048908 Bacteria 10561
453 Ga0496105_0009164 3300048908 Bacteria 7724
454 Ga0496105_0009491 3300048908 Bacteria 7614
455 Ga0496105_0017558 3300048908 Bacteria 5739
456 Ga0496105_0047091 3300048908 Bacteria 3558
457 Ga0496105_0078813 3300048908 Bacteria 2720
458 Ga0496105_0080509 3300048908 Bacteria 2690
459 Ga0496105_0251956 3300048908 Bacteria 1430
460 Ga0496106_0210996 3300048909 Bacteria 1547
461 Ga0496107_0061592 3300048910 Bacteria 2717
462 Ga0496107_0078515 3300048910 Bacteria 2405
463 Ga0496108_0001019 3300048911 Bacteria 21834
464 Ga0496108_0004977 3300048911 Bacteria 10737
465 Ga0496108_0064492 3300048911 Bacteria 3086
466 Ga0496108_0094768 3300048911 Bacteria 2541
467 Ga0496108_0284248 3300048911 Unclassified 1440
468 Ga0496109_0002458 3300048912 Bacteria 15526
469 Ga0496109_0021738 3300048912 Bacteria 5678
470 Ga0496109_0053177 3300048912 Bacteria 3692
471 Ga0496109_0083294 3300048912 Bacteria 2949
472 Ga0496109_0294055 3300048912 Bacteria 1531
473 Ga0496110_0024611 3300048913 Bacteria 5133
474 Ga0496110_0083640 3300048913 Bacteria 2847
475 Ga0496110_0101871 3300048913 Bacteria 2574
476 Ga0496110_0134727 3300048913 Bacteria 2232
477 Ga0496110_0139812 3300048913 Bacteria 2189
478 Ga0496110_0156291 3300048913 Unclassified 2066
479 Ga0496110_0183956 3300048913 Unclassified 1897
480 Ga0496110_0230249 3300048913 Bacteria 1685
481 Ga0496110_0269965 3300048913 Bacteria 1549
482 Ga0496110_0424848 3300048913 Bacteria 1211
483 Ga0496111_0155712 3300048914 Bacteria 1695
484 Ga0496111_0208182 3300048914 Bacteria 1453
485 Ga0496112_0000554 3300048915 Bacteria 25663
486 Ga0496112_0016722 3300048915 Bacteria 6878
487 Ga0496112_0069154 3300048915 Bacteria 3488
488 Ga0496112_0538975 3300048915 Bacteria 1101
489 Ga0496113_0000808 3300048916 Bacteria 16247
490 Ga0496113_0008455 3300048916 Bacteria 6707
491 Ga0496113_0097525 3300048916 Unclassified 2274
492 Ga0496113_0289529 3300048916 Bacteria 1310
493 Ga0496113_0367720 3300048916 Bacteria 1154
494 Ga0496114_0482270 3300048917 Unclassified 1097
495 Ga0496115_0026416 3300048918 Bacteria 4532
496 Ga0496115_0034582 3300048918 Bacteria 3994
497 Ga0496115_0137436 3300048918 Bacteria 2015
498 Ga0496115_0193921 3300048918 Bacteria 1678
499 Ga0501067_0020953 3300049583 Bacteria 3617
500 nmdc:mga00v17_206796_c1 3300050491 Bacteria 1269
501 nmdc:mga0yw44_183775_c1 3300050492 Bacteria 1377
502 nmdc:mga0yw44_32620_c1 3300050492 Bacteria 3036
503 nmdc:mga0yw44_58550_c1 3300050492 Bacteria 2354
504 nmdc:mga0yw44_61654_c1 3300050492 Bacteria 2302
505 nmdc:mga05p37_224545_c1 3300050507 Unclassified 2265
506 nmdc:mga05p37_592286_c1 3300050507 Unclassified 1253
507 nmdc:mga05p37_719406_c1 3300050507 Bacteria 1106
508 nmdc:mga0qj67_129966_c1 3300050509 Bacteria 2040
509 nmdc:mga06r32_166281_c1 3300050510 Bacteria 2189
510 nmdc:mga06r32_278895_c1 3300050510 Bacteria 1658
511 nmdc:mga06r32_560756_c1 3300050510 Bacteria 1115
512 nmdc:mga06r32_60886_c1 3300050510 Bacteria 3633
513 nmdc:mga08y16_52071_c1 3300050511 Bacteria 4284
514 nmdc:mga08y16_61851_c1 3300050511 Bacteria 3910
515 nmdc:mga0n895_153155_c1 3300050512 Bacteria 2336
516 nmdc:mga0n895_436366_c1 3300050512 Bacteria 1323
517 nmdc:mga0n895_543163_c1 3300050512 Bacteria 1168
518 nmdc:mga0rr50_101595_c1 3300050513 Bacteria 2261
519 nmdc:mga08x19_72733_c1 3300050514 Bacteria 2243
520 nmdc:mga08x19_7644_c1 3300050514 Bacteria 6422
521 nmdc:mga0a205_125276_c1 3300050515 Bacteria 2469
522 nmdc:mga0a205_314865_c1 3300050515 Bacteria 1437
523 Ga0495601_0095132 3300053077 Bacteria 1920
524 Ga0495601_0144113 3300053077 Bacteria 1555
525 Ga0495612_0009133 3300053078 Bacteria 4023
526 Ga0495612_0020316 3300053078 Unclassified 2661
527 Ga0495655_0054471 3300053083 Bacteria 1070
528 Ga0495595_0118246 3300053084 Bacteria 1290
529 Ga0495619_0074826 3300053085 Bacteria 2272
530 Ga0495619_0284344 3300053085 Bacteria 1146
531 2728752776 2728368998 Bacteria 8720350
532 2824683257 2824679649 Bacteria 8248951
533 2874621295 2874620515 Bacteria 8290088
534 2874645551 2874645413 Bacteria 8214782
535 2885383215 2885374607 Bacteria 8927485
536 2904667965 2904666416 Bacteria 8226587
537 2922398746 2922393267 Bacteria 8285685
538 8056970506 8056967851 Bacteria 9038162
539 Ga0070699_100002814
540 rootL2_10236405
541 JGI25405J52794_10005924
542 Ga0065712_10000812
543 Ga0065707_10194599
544 Ga0070658_10088214
545 Ga0070683_100024187
546 Ga0070690_100210226
547 Ga0070670_100006844
548 Ga0070670_100027391
549 Ga0070670_100191036
550 Ga0070677_10060942
551 Ga0070680_100086552
552 Ga0070680_100181550
553 Ga0070661_100124002
554 Ga0070668_100229861
555 Ga0070668_100336960
556 Ga0070669_100030912
557 Ga0070673_100011109
558 Ga0070688_100331364
559 Ga0070659_100178315
560 Ga0070667_100108840
561 Ga0070709_10041987
562 Ga0070709_10136243
563 Ga0070709_10159574
564 Ga0070714_100025961
565 Ga0070714_100142714
566 Ga0070714_100150541
567 Ga0070713_100005517
568 Ga0070713_100025840
569 Ga0070713_100082215
570 Ga0070713_100114274
571 Ga0070710_10014013
572 Ga0070708_100079990
573 Ga0070708_100137257
574 Ga0070708_100427145
575 Ga0070678_100248470
576 Ga0070662_100214872
577 Ga0070681_10025308
578 Ga0070681_10083592
579 Ga0070681_10187912
580 Ga0070681_10419326
581 Ga0068867_100376294
582 Ga0068867_100423690
583 Ga0070685_10088869
584 Ga0070706_100006951
585 Ga0070706_100007448
586 Ga0070706_100053096
587 Ga0070706_100063199
588 Ga0070706_100100524
589 Ga0070706_100147686
590 Ga0070706_100153432
591 Ga0070706_100171598
592 Ga0070706_100206093
593 Ga0070706_100266173
594 Ga0070707_100023281
595 Ga0070707_100031157
596 Ga0070707_100141136
597 Ga0070707_100266377
598 Ga0070707_100318517
599 Ga0070707_100355153
600 Ga0070707_100355997
601 Ga0070698_100051731
602 Ga0070698_100111504
603 Ga0070698_100291337
604 Ga0070698_100326865
605 Ga0070698_100352070
606 Ga0070698_100459032
607 Ga0070699_100009610
608 Ga0070699_100018486
609 Ga0070699_100030897
610 Ga0070699_100044890
611 Ga0070699_100337767
612 Ga0070679_100014581
613 Ga0070679_100265212
614 Ga0070684_100325577
615 Ga0070697_100003021
616 Ga0070697_100022387
617 Ga0070697_100061739
618 Ga0070697_100114863
619 Ga0070697_100243427
620 Ga0068853_100032588
621 Ga0068853_100174608
622 Ga0068853_100223678
623 Ga0070672_100018751
624 Ga0070672_100211854
625 Ga0070672_100218243
626 Ga0070696_100013538
627 Ga0070696_100020265
628 Ga0070696_100096719
629 Ga0068855_100022696
630 Ga0068855_100452730
631 Ga0068857_100047523
632 Ga0068857_100128696
633 Ga0068854_100089736
634 Ga0068856_100000236
635 Ga0068856_100041684
636 Ga0070702_100071900
637 Ga0068852_100192190
638 Ga0068864_100008466
639 Ga0068861_100190786
640 Ga0068858_100182312
641 Ga0068860_100236032
642 Ga0068862_100166991
643 Ga0081455_10010080
644 Ga0081455_10035746
645 Ga0081455_10036882
646 Ga0081455_10038255
647 Ga0081455_10047845
648 Ga0081455_10049249
649 Ga0081455_10074121
650 Ga0081455_10094680
651 Ga0081455_10101598
652 Ga0081455_10276213
653 Ga0081538_10038722
654 Ga0081540_1021204
655 Ga0081540_1030995
656 Ga0070717_10033571
657 Ga0070717_10035187
658 Ga0070717_10073257
659 Ga0070717_10107295
660 Ga0070717_10248595
661 Ga0070717_10283020
662 Ga0070717_10407011
663 Ga0075365_10016047
664 Ga0075365_10071699
665 Ga0075365_10075226
666 Ga0075365_10077639
667 Ga0075365_10096972
668 Ga0075365_10189387
669 Ga0075364_10164654
670 Ga0070715_10013388
671 Ga0070715_10048876
672 Ga0070715_10068399
673 Ga0070716_100011158
674 Ga0070716_100125935
675 Ga0070716_100134574
676 Ga0070712_100038121
677 Ga0070712_100059842
678 Ga0070712_100109022
679 Ga0070712_100255336
680 Ga0070712_100272924
681 Ga0097621_100136879
682 Ga0075370_10052794
683 Ga0068871_100255786
684 Ga0068871_100559342
685 Ga0075428_100104605
686 Ga0075428_100195452
687 Ga0075428_100411255
688 Ga0075428_100420669
689 Ga0075428_100428421
690 Ga0075428_100471050
691 Ga0075428_100752728
692 Ga0075430_100007999
693 Ga0075430_100143488
694 Ga0075431_100097103
695 Ga0075431_100190997
696 Ga0075431_100492153
697 Ga0075433_10302882
698 Ga0075434_100107339
699 Ga0075434_100151538
700 Ga0075434_100295592
701 Ga0075434_100352195
702 Ga0075429_100013785
703 Ga0075429_100491870
704 Ga0075436_100114248
705 Ga0075435_100105448
706 Ga0075435_100132844
707 Ga0099794_10012964
708 Ga0099795_10042563
709 Ga0105240_10081277
710 Ga0105240_10083161
711 Ga0105240_10142221
712 Ga0105240_10576863
713 Ga0111539_10025653
714 Ga0111539_10030804
715 Ga0111539_10279491
716 Ga0111539_10484414
717 Ga0105245_10235182
718 Ga0105245_10317596
719 Ga0105245_10417370
720 Ga0105247_10268813
721 Ga0114129_10398346
722 Ga0114129_10447104
723 Ga0114129_10746035
724 Ga0114129_10860030
725 Ga0105241_10373793
726 Ga0105242_10498097
727 Ga0105248_10031765
728 Ga0105248_10038110
729 Ga0105248_10059838
730 Ga0105248_10277101
731 Ga0105237_10059113
732 Ga0105237_10098376
733 Ga0105237_10267611
734 Ga0105238_10331153
735 Ga0105249_10198112
736 Ga0105249_10441786
737 Ga0105239_10198460
738 Ga0105246_10008111
739 Ga0105246_10362285
740 Ga0157373_10243420
741 Ga0157370_10033753
742 Ga0157370_10044826
743 Ga0157370_10091650
744 Ga0157369_10010211
745 Ga0157369_10068819
746 Ga0157374_10571617
747 Ga0157378_10120718
748 Ga0157378_10196057
749 Ga0163162_10317809
750 Ga0163162_10404770
751 Ga0163162_10505987
752 Ga0163162_10607779
753 Ga0157372_10006140
754 Ga0157372_10015986
755 Ga0157375_10223657
756 Ga0157375_10276381
757 Ga0157375_10302037
758 Ga0163163_10033577
759 Ga0163163_10326927
760 Ga0163163_10340393
761 Ga0163163_10401233
762 Ga0157380_10271407
763 Ga0157377_10164830
764 Ga0157379_10336278
765 Ga0157376_10008504
766 Ga0157376_10062232
767 Ga0157376_10373758
768 Ga0163161_10183600
769 Ga0163161_10279328
770 Ga0163161_10317938
771 Ga0163161_10439081
772 Ga0207682_10115594
773 Ga0207692_10011021
774 Ga0207642_10039341
775 Ga0207710_10135082
776 Ga0207688_10179395
777 Ga0207685_10082646
778 Ga0207699_10058119
779 Ga0207699_10181743
780 Ga0207684_10003355
781 Ga0207684_10012194
782 Ga0207684_10013913
783 Ga0207684_10022146
784 Ga0207684_10030251
785 Ga0207684_10132653
786 Ga0207684_10161258
787 Ga0207707_10022153
788 Ga0207707_10048058
789 Ga0207707_10071458
790 Ga0207695_10014716
791 Ga0207695_10206340
792 Ga0207695_10318452
793 Ga0207671_10245783
794 Ga0207671_10258189
795 Ga0207693_10041447
796 Ga0207693_10043387
797 Ga0207693_10080776
798 Ga0207693_10108011
799 Ga0207693_10191799
800 Ga0207693_10353087
801 Ga0207693_10411158
802 Ga0207663_10030970
803 Ga0207663_10084157
804 Ga0207660_10010073
805 Ga0207660_10090462
806 Ga0207660_10310006
807 Ga0207662_10226411
808 Ga0207649_10315092
809 Ga0207652_10055769
810 Ga0207652_10074591
811 Ga0207646_10004816
812 Ga0207646_10011485
813 Ga0207646_10037762
814 Ga0207646_10096014
815 Ga0207646_10112566
816 Ga0207646_10154151
817 Ga0207646_10269486
818 Ga0207646_10345658
819 Ga0207646_10399534
820 Ga0207681_10034032
821 Ga0207659_10285311
822 Ga0207687_10260452
823 Ga0207700_10019219
824 Ga0207700_10222022
825 Ga0207700_10408016
826 Ga0207664_10132876
827 Ga0207664_10139890
828 Ga0207664_10279916
829 Ga0207664_10287323
830 Ga0207706_10147034
831 Ga0207706_10159894
832 Ga0207706_10363465
833 Ga0207669_10367612
834 Ga0207665_10000576
835 Ga0207665_10115712
836 Ga0207665_10234785
837 Ga0207691_10030754
838 Ga0207691_10111451
839 Ga0207711_10024476
840 Ga0207711_10036000
841 Ga0207661_10033144
842 Ga0207667_10121298
843 Ga0207667_10436396
844 Ga0207712_10181662
845 Ga0207712_10357267
846 Ga0207658_10143497
847 Ga0207658_10548813
848 Ga0207639_10050911
849 Ga0207639_10344264
850 Ga0207678_10119096
851 Ga0207708_10172833
852 Ga0207702_10000081
853 Ga0207702_10403927
854 Ga0207702_10599452
855 Ga0207675_100184101
856 Ga0207675_100243188
857 Ga0207683_10052430
858 Ga0207683_10102880
859 Ga0207683_10422577
860 Ga0207698_10311538
861 Ga0207698_10338848
862 Ga0209588_1017696
863 Ga0207428_10006400
864 Ga0207428_10175006
865 Ga0268266_10425024
866 Ga0268265_10203904
867 Ga0268265_10226458
868 Ga0268264_10427965
869 Ga0265332_10097143
870 Ga0307510_10137984
871 Ga0373944_0017232
872 Ga0373936_0068619
873 Ga0373939_0017546
874 Ga0373945_0021302
875 Ga0373953_0008108
876 Ga0373956_0010521
877 Ga0373957_0006759
878 Ga0373943_0002805
879 Ga0373943_0013984
880 Ga0373946_0023708
881 Ga0373946_0062153
882 Ga0373955_0033311
883 Ga0373935_0026366
884 Ga0373935_0042093
885 Ga0373927_0004182
886 Ga0373927_0034912
887 Ga0373927_0067321
888 Ga0373933_0053861
889 Ga0373947_0000377
890 Ga0373947_0249247
891 Ga0373947_0267132
892 Ga0373937_0570744
893 Ga0373925_0027310
894 Ga0373925_0046659
895 Ga0395900_0009765
896 Ga0395898_0019500
897 Ga0395901_0070048
898 Ga0395901_0146682
899 Ga0395901_0316020
900 Ga0395901_0453130
901 Ga0395901_0560328
902 Ga0436363_0836995
903 Ga0451853_2433772
904 Ga0451577_0045699
905 Ga0453683_0045160
906 Ga0453683_0108264
907 Ga0453684_0026940
908 Ga0466967_0128061
909 Ga0495592_0037403
910 Ga0495603_0060583
911 Ga0495603_0207289
912 Ga0495641_0040252
913 Ga0495641_0147650
914 Ga0495651_0011643
915 Ga0495651_0099072
916 Ga0495653_0103625
917 Ga0495580_0069286
918 Ga0495582_0014962
919 Ga0495582_0150582
920 Ga0495639_0091435
921 Ga0495662_0007012
922 Ga0495662_0036168
923 Ga0495585_0119005
924 Ga0495594_0146858
925 Ga0495608_0019862
926 Ga0495620_0093241
927 Ga0495628_0007577
928 Ga0495630_0095412
929 Ga0495630_0235505
930 Ga0495630_0361557
931 Ga0495637_0040980
932 Ga0495652_0029885
933 Ga0495652_0264927
934 Ga0495652_0348705
935 Ga0495640_0071432
936 Ga0495587_0047195
937 Ga0495587_0138082
938 Ga0495645_0025884
939 Ga0495667_0052270
940 Ga0495656_0070977
941 Ga0495668_0068361
942 Ga0495668_0201764
943 Ga0495634_0012669
944 Ga0495634_0240024
945 Ga0495635_0007501
946 Ga0495635_0040299
947 Ga0495661_0224745
948 Ga0495588_0021885
949 Ga0495657_0024177
950 Ga0495599_0026015
951 Ga0495623_0053477
952 Ga0495623_0054270
953 Ga0495646_0079359
954 Ga0495613_0125370
955 Ga0495624_0021615
956 Ga0495624_0072130
957 Ga0495624_0081072
958 Ga0495600_0023891
959 Ga0495581_0072438
960 Ga0495674_0051903
961 Ga0495674_0376462
962 Ga0495676_0070165
963 Ga0495676_0078302
964 Ga0495676_0084850
965 Ga0495675_0201396
966 Ga0495684_0002474
967 Ga0495684_0037176
968 Ga0495602_0018414
969 Ga0495602_0200076
970 Ga0496100_0241213
971 Ga0496101_0333129
972 Ga0496101_0386452
973 Ga0496102_0077606
974 Ga0496102_0093261
975 Ga0496102_0158532
976 Ga0496102_0539106
977 Ga0496103_0063516
978 Ga0496103_0099501
979 Ga0496104_0001667
980 Ga0496104_0002519
981 Ga0496104_0003564
982 Ga0496104_0017271
983 Ga0496104_0022578
984 Ga0496104_0030199
985 Ga0496104_0030424
986 Ga0496104_0125800
987 Ga0496104_0169653
988 Ga0496104_0189399
989 Ga0496104_0456320
990 Ga0496105_0004441
991 Ga0496105_0009164
992 Ga0496105_0009491
993 Ga0496105_0017558
994 Ga0496105_0047091
995 Ga0496105_0078813
996 Ga0496105_0080509
997 Ga0496105_0251956
998 Ga0496106_0210996
999 Ga0496107_0061592
1000 Ga0496107_0078515
1001 Ga0496108_0001019
1002 Ga0496108_0004977
1003 Ga0496108_0064492
1004 Ga0496108_0094768
1005 Ga0496108_0284248
1006 Ga0496109_0002458
1007 Ga0496109_0021738
1008 Ga0496109_0053177
1009 Ga0496109_0083294
1010 Ga0496109_0294055
1011 Ga0496110_0024611
1012 Ga0496110_0083640
1013 Ga0496110_0101871
1014 Ga0496110_0134727
1015 Ga0496110_0139812
1016 Ga0496110_0156291
1017 Ga0496110_0183956
1018 Ga0496110_0230249
1019 Ga0496110_0269965
1020 Ga0496110_0424848
1021 Ga0496111_0155712
1022 Ga0496111_0208182
1023 Ga0496112_0000554
1024 Ga0496112_0016722
1025 Ga0496112_0069154
1026 Ga0496112_0538975
1027 Ga0496113_0000808
1028 Ga0496113_0008455
1029 Ga0496113_0097525
1030 Ga0496113_0289529
1031 Ga0496113_0367720
1032 Ga0496114_0482270
1033 Ga0496115_0026416
1034 Ga0496115_0034582
1035 Ga0496115_0137436
1036 Ga0496115_0193921
1037 Ga0501067_0020953
1038 nmdc:mga00v17_206796_c1
1039 nmdc:mga0yw44_183775_c1
1040 nmdc:mga0yw44_32620_c1
1041 nmdc:mga0yw44_58550_c1
1042 nmdc:mga0yw44_61654_c1
1043 nmdc:mga05p37_224545_c1
1044 nmdc:mga05p37_592286_c1
1045 nmdc:mga05p37_719406_c1
1046 nmdc:mga0qj67_129966_c1
1047 nmdc:mga06r32_166281_c1
1048 nmdc:mga06r32_278895_c1
1049 nmdc:mga06r32_560756_c1
1050 nmdc:mga06r32_60886_c1
1051 nmdc:mga08y16_52071_c1
1052 nmdc:mga08y16_61851_c1
1053 nmdc:mga0n895_153155_c1
1054 nmdc:mga0n895_436366_c1
1055 nmdc:mga0n895_543163_c1
1056 nmdc:mga0rr50_101595_c1
1057 nmdc:mga08x19_72733_c1
1058 nmdc:mga08x19_7644_c1
1059 nmdc:mga0a205_125276_c1
1060 nmdc:mga0a205_314865_c1
1061 Ga0495601_0095132
1062 Ga0495601_0144113
1063 Ga0495612_0009133
1064 Ga0495612_0020316
1065 Ga0495655_0054471
1066 Ga0495595_0118246
1067 Ga0495619_0074826
1068 Ga0495619_0284344
1069 2728752776
1070 2824683257
1071 2874621295
1072 2874645551
1073 2885383215
1074 2904667965
1075 2922398746
1076 8056970506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

27

321

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9029 27 324
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8968 28 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8948 30 325
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8944 27 324
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8891 30 325
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8871 146 325 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8786 146 324 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.87 146 325 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8561 146 324 3.40.50.2300
2wrzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7814 159 250 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A317GWG2-F1-model_v4 ABC transporter substrate-binding protein 0.9772 28 326
AF-A0A317GWG2-F1-model_v4 ABC transporter substrate-binding protein 0.9708 28 326
AF-A0A1N6H715-F1-model_v4 deleted 0.9654 72 322
AF-A0A7W6AL87-F1-model_v4 Putative ABC transport system substrate-binding protein 0.9559 66 326
AF-A0A840MUP0-F1-model_v4 Putative ABC transport system substrate-binding protein 0.9538 91 326

Map