F460980

General Info

Members Datasets Scaffolds Average Seq Length
538 241 1076 82

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11896576|Ga0070658_118965762
Length 88
Sequence VLKVSVISPEAVLFEGEVESLVAPAFDGEVGILTSHAPMVTLLGRGTLRLGAGAGERRFAVQGGFLQVADDEVRVVTEHAEAAGATAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.04
Rhizosphere 96.1
Stem 0
Stem Tuber 0
Unclassified 7.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11896576 3300005327 Bacteria 515
2 LJQas_1007821 3300000549 Bacteria 1310
3 JGI24739J22299_10218240 3300001989 Unclassified 559
4 Ga0058859_11347103 3300004798 Bacteria 532
5 Ga0058863_11916653 3300004799 Bacteria 649
6 Ga0058862_12668187 3300004803 Bacteria 723
7 Ga0070658_10002341 3300005327 Bacteria 15907
8 Ga0070658_10083007 3300005327 Bacteria 2633
9 Ga0070658_10128304 3300005327 Bacteria 2112
10 Ga0070658_10151400 3300005327 Bacteria 1942
11 Ga0070658_10513396 3300005327 Bacteria 1036
12 Ga0070658_10638519 3300005327 Bacteria 923
13 Ga0070658_11573230 3300005327 Bacteria 570
14 Ga0070658_11626898 3300005327 Bacteria 559
15 Ga0070658_11957761 3300005327 Bacteria 506
16 Ga0070683_100001776 3300005329 Bacteria 16796
17 Ga0070683_100028452 3300005329 Bacteria 5051
18 Ga0070683_100092879 3300005329 Bacteria 2834
19 Ga0070683_100093244 3300005329 Bacteria 2829
20 Ga0070683_100336241 3300005329 Bacteria 1438
21 Ga0070683_100352022 3300005329 Bacteria 1403
22 Ga0070683_100380220 3300005329 Bacteria 1345
23 Ga0070666_10284127 3300005335 Unclassified 1177
24 Ga0070680_100133284 3300005336 Bacteria 2080
25 Ga0070680_100414787 3300005336 Bacteria 1148
26 Ga0070680_101338516 3300005336 Bacteria 620
27 Ga0070682_100224268 3300005337 Bacteria 1340
28 Ga0070682_100589580 3300005337 Bacteria 876
29 Ga0070682_100632365 3300005337 Bacteria 849
30 Ga0070682_101009980 3300005337 Unclassified 691
31 Ga0068868_100008461 3300005338 Bacteria 7368
32 Ga0068868_100075729 3300005338 Bacteria 2690
33 Ga0068868_100108739 3300005338 Bacteria 2251
34 Ga0068868_100616418 3300005338 Bacteria 963
35 Ga0070660_100045540 3300005339 Bacteria 3359
36 Ga0070660_100084018 3300005339 Bacteria 2502
37 Ga0070660_100185400 3300005339 Bacteria 1685
38 Ga0070660_100212557 3300005339 Bacteria 1571
39 Ga0070660_100367993 3300005339 Bacteria 1185
40 Ga0070660_100779156 3300005339 Bacteria 804
41 Ga0070660_101748826 3300005339 Bacteria 530
42 Ga0070689_100299919 3300005340 Bacteria 1337
43 Ga0070691_10022398 3300005341 Bacteria 2930
44 Ga0070691_10061445 3300005341 Bacteria 1807
45 Ga0070687_100499419 3300005343 Bacteria 818
46 Ga0070687_100503538 3300005343 Bacteria 816
47 Ga0070661_100010908 3300005344 Bacteria 6329
48 Ga0070661_100011111 3300005344 Bacteria 6272
49 Ga0070661_100081992 3300005344 Bacteria 2382
50 Ga0070661_100388236 3300005344 Bacteria 1102
51 Ga0070661_100834623 3300005344 Bacteria 758
52 Ga0070661_100862121 3300005344 Bacteria 746
53 Ga0070661_100899887 3300005344 Unclassified 730
54 Ga0070692_10188174 3300005345 Bacteria 1201
55 Ga0070692_11069120 3300005345 Bacteria 568
56 Ga0070668_100410002 3300005347 Bacteria 1158
57 Ga0070675_100083108 3300005354 Bacteria 2672
58 Ga0070675_100343314 3300005354 Bacteria 1323
59 Ga0070671_101572514 3300005355 Unclassified 582
60 Ga0070674_100003496 3300005356 Bacteria 8824
61 Ga0070673_100341099 3300005364 Bacteria 1328
62 Ga0070673_100573913 3300005364 Bacteria 1026
63 Ga0070673_100738182 3300005364 Bacteria 906
64 Ga0070659_100378031 3300005366 Bacteria 1193
65 Ga0070659_101461317 3300005366 Bacteria 608
66 Ga0070709_10014648 3300005434 Bacteria 4439
67 Ga0070709_10273796 3300005434 Bacteria 1224
68 Ga0070709_10640588 3300005434 Bacteria 822
69 Ga0070714_100006635 3300005435 Bacteria 8956
70 Ga0070714_100082769 3300005435 Bacteria 2797
71 Ga0070714_100119768 3300005435 Bacteria 2340
72 Ga0070714_101775443 3300005435 Unclassified 602
73 Ga0070713_100000613 3300005436 Bacteria 22734
74 Ga0070713_100284482 3300005436 Bacteria 1518
75 Ga0070713_100730843 3300005436 Bacteria 946
76 Ga0070710_10131050 3300005437 Bacteria 1529
77 Ga0070710_10848888 3300005437 Bacteria 656
78 Ga0070711_100543602 3300005439 Bacteria 963
79 Ga0070711_101219928 3300005439 Bacteria 651
80 Ga0070663_100672556 3300005455 Bacteria 878
81 Ga0070663_101600674 3300005455 Bacteria 581
82 Ga0070662_100168132 3300005457 Bacteria 1720
83 Ga0070662_101094333 3300005457 Bacteria 684
84 Ga0070681_10001771 3300005458 Bacteria 19367
85 Ga0070681_10003898 3300005458 Bacteria 14056
86 Ga0070681_10111185 3300005458 Bacteria 2679
87 Ga0070681_10154440 3300005458 Bacteria 2221
88 Ga0070681_10194873 3300005458 Bacteria 1945
89 Ga0070681_10645158 3300005458 Bacteria 974
90 Ga0070681_10905450 3300005458 Bacteria 800
91 Ga0070681_11539230 3300005458 Unclassified 590
92 Ga0070681_11681370 3300005458 Bacteria 561
93 Ga0068867_100108243 3300005459 Bacteria 2131
94 Ga0070706_100589085 3300005467 Unclassified 1034
95 Ga0070706_100881459 3300005467 Bacteria 827
96 Ga0070699_100227394 3300005518 Bacteria 1663
97 Ga0070679_100001652 3300005530 Bacteria 20087
98 Ga0070679_100015156 3300005530 Bacteria 7406
99 Ga0070679_100025545 3300005530 Bacteria 5798
100 Ga0070679_100084025 3300005530 Bacteria 3172
101 Ga0070679_100084523 3300005530 Bacteria 3162
102 Ga0070679_100181701 3300005530 Bacteria 2075
103 Ga0070679_100211043 3300005530 Bacteria 1905
104 Ga0070679_100373384 3300005530 Bacteria 1373
105 Ga0070679_100546051 3300005530 Bacteria 1102
106 Ga0070679_101396110 3300005530 Bacteria 646
107 Ga0070679_101400108 3300005530 Bacteria 645
108 Ga0070684_100003503 3300005535 Bacteria 11785
109 Ga0070684_100006177 3300005535 Bacteria 9240
110 Ga0070684_100014975 3300005535 Bacteria 6297
111 Ga0070684_100267747 3300005535 Bacteria 1564
112 Ga0070684_100274228 3300005535 Bacteria 1544
113 Ga0070684_100744675 3300005535 Bacteria 915
114 Ga0070684_101109424 3300005535 Unclassified 743
115 Ga0070684_101427207 3300005535 Unclassified 652
116 Ga0070684_101861030 3300005535 Unclassified 568
117 Ga0068853_100050077 3300005539 Bacteria 3592
118 Ga0068853_100160653 3300005539 Bacteria 2027
119 Ga0068853_101095845 3300005539 Bacteria 768
120 Ga0068853_101190047 3300005539 Bacteria 736
121 Ga0070672_100104384 3300005543 Bacteria 2303
122 Ga0070686_100900820 3300005544 Bacteria 719
123 Ga0070693_100049642 3300005547 Bacteria 2395
124 Ga0070693_100221143 3300005547 Bacteria 1241
125 Ga0070704_100392053 3300005549 Bacteria 1183
126 Ga0068855_100401683 3300005563 Bacteria 1501
127 Ga0068855_100668168 3300005563 Bacteria 1114
128 Ga0068855_101121195 3300005563 Bacteria 821
129 Ga0068855_101734747 3300005563 Unclassified 636
130 Ga0068855_102095639 3300005563 Bacteria 570
131 Ga0070664_100007535 3300005564 Bacteria 8785
132 Ga0070664_100038589 3300005564 Bacteria 4021
133 Ga0070664_100050911 3300005564 Bacteria 3506
134 Ga0070664_100250951 3300005564 Bacteria 1590
135 Ga0070664_100534057 3300005564 Bacteria 1084
136 Ga0070664_101731816 3300005564 Bacteria 592
137 Ga0070664_101857387 3300005564 Unclassified 571
138 Ga0068857_100019452 3300005577 Bacteria 5963
139 Ga0068857_101044521 3300005577 Bacteria 787
140 Ga0068857_101479492 3300005577 Bacteria 661
141 Ga0068854_100222044 3300005578 Bacteria 1495
142 Ga0068854_100726228 3300005578 Bacteria 860
143 Ga0068856_100300183 3300005614 Bacteria 1624
144 Ga0068856_100322764 3300005614 Bacteria 1561
145 Ga0068856_100872962 3300005614 Bacteria 919
146 Ga0068856_100961026 3300005614 Bacteria 873
147 Ga0068856_101071202 3300005614 Bacteria 824
148 Ga0068856_101218316 3300005614 Bacteria 769
149 Ga0068856_101329446 3300005614 Bacteria 734
150 Ga0070702_100959977 3300005615 Bacteria 674
151 Ga0068852_100287689 3300005616 Bacteria 1586
152 Ga0068852_100348710 3300005616 Bacteria 1445
153 Ga0068852_100973895 3300005616 Bacteria 866
154 Ga0068852_101079930 3300005616 Bacteria 822
155 Ga0068864_101251591 3300005618 Bacteria 741
156 Ga0068866_10032539 3300005718 Bacteria 2523
157 Ga0068861_100336222 3300005719 Bacteria 1320
158 Ga0068861_101662073 3300005719 Bacteria 631
159 Ga0068851_10003964 3300005834 Bacteria 6630
160 Ga0068870_10007500 3300005840 Bacteria 4868
161 Ga0068863_100308569 3300005841 Bacteria 1535
162 Ga0068858_100419730 3300005842 Bacteria 1286
163 Ga0068858_101625692 3300005842 Unclassified 638
164 Ga0068860_100351942 3300005843 Bacteria 1450
165 Ga0068860_102132676 3300005843 Unclassified 582
166 Ga0070717_10008798 3300006028 Bacteria 7560
167 Ga0070717_11806959 3300006028 Unclassified 552
168 Ga0070716_100006614 3300006173 Bacteria 5669
169 Ga0070716_100500892 3300006173 Bacteria 896
170 Ga0070712_100008785 3300006175 Bacteria 6361
171 Ga0070712_100334495 3300006175 Bacteria 1235
172 Ga0070712_100391443 3300006175 Bacteria 1146
173 Ga0068871_101799270 3300006358 Bacteria 582
174 Ga0075430_100033785 3300006846 Bacteria 4340
175 Ga0075431_100171016 3300006847 Bacteria 2233
176 Ga0075431_100373745 3300006847 Bacteria 1430
177 Ga0075431_100413542 3300006847 Bacteria 1348
178 Ga0075434_100914261 3300006871 Bacteria 892
179 Ga0075429_100053682 3300006880 Bacteria 3506
180 Ga0075429_100404408 3300006880 Bacteria 1196
181 Ga0068865_100136594 3300006881 Bacteria 1844
182 Ga0075436_100259759 3300006914 Unclassified 1238
183 Ga0075435_100884191 3300007076 Bacteria 779
184 Ga0105240_10239882 3300009093 Bacteria 2102
185 Ga0105240_10350827 3300009093 Bacteria 1674
186 Ga0105240_11441103 3300009093 Bacteria 723
187 Ga0105240_11792862 3300009093 Bacteria 640
188 Ga0105240_12344105 3300009093 Bacteria 553
189 Ga0111539_12643489 3300009094 Bacteria 582
190 Ga0105245_10078445 3300009098 Bacteria 3013
191 Ga0105245_11263568 3300009098 Bacteria 787
192 Ga0105245_12547366 3300009098 Bacteria 565
193 Ga0105245_12974800 3300009098 Unclassified 525
194 Ga0105243_10520395 3300009148 Bacteria 1131
195 Ga0105241_10087003 3300009174 Bacteria 2458
196 Ga0105242_10831568 3300009176 Bacteria 917
197 Ga0105238_10033820 3300009551 Bacteria 5201
198 Ga0105249_10558194 3300009553 Bacteria 1196
199 Ga0105239_11834619 3300010375 Bacteria 703
200 Ga0105246_10058737 3300011119 Bacteria 2666
201 Ga0157373_10013623 3300013100 Bacteria 5966
202 Ga0157373_10030211 3300013100 Bacteria 3898
203 Ga0157373_10048967 3300013100 Bacteria 3012
204 Ga0157373_10140724 3300013100 Bacteria 1697
205 Ga0157373_10482247 3300013100 Bacteria 895
206 Ga0157373_10802704 3300013100 Bacteria 694
207 Ga0157373_11086484 3300013100 Bacteria 600
208 Ga0157371_10018474 3300013102 Bacteria 5154
209 Ga0157371_10052208 3300013102 Bacteria 2904
210 Ga0157371_10069163 3300013102 Bacteria 2500
211 Ga0157371_11137639 3300013102 Bacteria 600
212 Ga0157371_11345227 3300013102 Bacteria 554
213 Ga0157370_10032918 3300013104 Bacteria 5057
214 Ga0157370_10412521 3300013104 Bacteria 1243
215 Ga0157370_10534326 3300013104 Bacteria 1075
216 Ga0157370_10565560 3300013104 Bacteria 1042
217 Ga0157369_10048298 3300013105 Bacteria 4618
218 Ga0157369_10169713 3300013105 Bacteria 2299
219 Ga0157369_10271359 3300013105 Bacteria 1767
220 Ga0157369_10998990 3300013105 Bacteria 857
221 Ga0157369_12264208 3300013105 Unclassified 551
222 Ga0157369_12703919 3300013105 Bacteria 500
223 Ga0157374_10245093 3300013296 Bacteria 1763
224 Ga0157374_12018257 3300013296 Unclassified 603
225 Ga0157378_10986301 3300013297 Bacteria 876
226 Ga0157378_11175735 3300013297 Bacteria 806
227 Ga0157372_10001275 3300013307 Bacteria 27269
228 Ga0157372_10010695 3300013307 Bacteria 9765
229 Ga0157372_10019074 3300013307 Bacteria 7384
230 Ga0157372_10526333 3300013307 Bacteria 1378
231 Ga0157372_10604766 3300013307 Bacteria 1278
232 Ga0157372_11166769 3300013307 Bacteria 890
233 Ga0157372_11184785 3300013307 Bacteria 883
234 Ga0157372_11504423 3300013307 Bacteria 775
235 Ga0157372_12810940 3300013307 Bacteria 558
236 Ga0157375_10019621 3300013308 Bacteria 6155
237 Ga0163163_10875320 3300014325 Bacteria 962
238 Ga0157379_10442674 3300014968 Bacteria 1198
239 Ga0157376_12849424 3300014969 Unclassified 523
240 Ga0182007_10222681 3300015262 Unclassified 667
241 Ga0163161_10178053 3300017792 Bacteria 1629
242 Ga0163161_10671297 3300017792 Bacteria 860
243 Ga0213876_10159870 3300021384 Bacteria 1198
244 Ga0213875_10239937 3300021388 Bacteria 854
245 Ga0207697_10300483 3300025315 Bacteria 712
246 Ga0207656_10203467 3300025321 Bacteria 957
247 Ga0207692_10051269 3300025898 Unclassified 2092
248 Ga0207680_10083660 3300025903 Bacteria 2012
249 Ga0207685_10392387 3300025905 Bacteria 710
250 Ga0207699_10031402 3300025906 Bacteria 2982
251 Ga0207699_10183514 3300025906 Bacteria 1408
252 Ga0207699_10213620 3300025906 Bacteria 1313
253 Ga0207699_10327789 3300025906 Bacteria 1076
254 Ga0207705_10002235 3300025909 Bacteria 14943
255 Ga0207705_10003344 3300025909 Bacteria 12188
256 Ga0207705_10006207 3300025909 Bacteria 8882
257 Ga0207705_10066063 3300025909 Bacteria 2616
258 Ga0207705_10076591 3300025909 Bacteria 2432
259 Ga0207705_10269038 3300025909 Bacteria 1303
260 Ga0207705_10475629 3300025909 Bacteria 970
261 Ga0207654_10033665 3300025911 Bacteria 2842
262 Ga0207707_10010670 3300025912 Bacteria 7982
263 Ga0207707_10013457 3300025912 Bacteria 7129
264 Ga0207707_10040558 3300025912 Bacteria 4066
265 Ga0207707_10370770 3300025912 Bacteria 1232
266 Ga0207707_10611118 3300025912 Bacteria 922
267 Ga0207707_10666466 3300025912 Bacteria 876
268 Ga0207707_10939406 3300025912 Bacteria 713
269 Ga0207695_10113569 3300025913 Bacteria 2685
270 Ga0207693_10011643 3300025915 Bacteria 7116
271 Ga0207693_10053207 3300025915 Bacteria 3177
272 Ga0207663_10294604 3300025916 Bacteria 1210
273 Ga0207663_10487278 3300025916 Unclassified 956
274 Ga0207660_10041508 3300025917 Bacteria 3224
275 Ga0207660_10046048 3300025917 Bacteria 3077
276 Ga0207660_10137616 3300025917 Bacteria 1865
277 Ga0207660_10921322 3300025917 Bacteria 713
278 Ga0207660_11529684 3300025917 Bacteria 539
279 Ga0207657_10005224 3300025919 Bacteria 13602
280 Ga0207657_10017240 3300025919 Bacteria 6935
281 Ga0207657_10171792 3300025919 Bacteria 1756
282 Ga0207657_10256675 3300025919 Bacteria 1392
283 Ga0207657_10515926 3300025919 Bacteria 936
284 Ga0207649_10034397 3300025920 Bacteria 3036
285 Ga0207649_10188150 3300025920 Bacteria 1450
286 Ga0207649_10346267 3300025920 Bacteria 1098
287 Ga0207649_10878911 3300025920 Bacteria 702
288 Ga0207652_10005814 3300025921 Bacteria 10002
289 Ga0207652_10021686 3300025921 Bacteria 5303
290 Ga0207652_10049014 3300025921 Bacteria 3614
291 Ga0207652_10106008 3300025921 Bacteria 2487
292 Ga0207652_10107847 3300025921 Bacteria 2467
293 Ga0207652_10122872 3300025921 Unclassified 2311
294 Ga0207652_10133137 3300025921 Bacteria 2218
295 Ga0207652_10142088 3300025921 Bacteria 2147
296 Ga0207652_10321179 3300025921 Bacteria 1398
297 Ga0207652_10902461 3300025921 Bacteria 780
298 Ga0207652_11042330 3300025921 Bacteria 717
299 Ga0207694_10090011 3300025924 Bacteria 2421
300 Ga0207687_10300105 3300025927 Bacteria 1294
301 Ga0207687_11165508 3300025927 Bacteria 662
302 Ga0207700_10000550 3300025928 Bacteria 22006
303 Ga0207700_10392990 3300025928 Bacteria 1214
304 Ga0207700_10459101 3300025928 Bacteria 1123
305 Ga0207664_10014218 3300025929 Bacteria 5740
306 Ga0207664_10027233 3300025929 Bacteria 4331
307 Ga0207664_10081331 3300025929 Bacteria 2636
308 Ga0207664_11606244 3300025929 Unclassified 572
309 Ga0207690_10034040 3300025932 Bacteria 3280
310 Ga0207690_11688818 3300025932 Bacteria 529
311 Ga0207706_10144072 3300025933 Bacteria 2096
312 Ga0207706_10264630 3300025933 Bacteria 1501
313 Ga0207706_10290562 3300025933 Bacteria 1425
314 Ga0207706_10487178 3300025933 Bacteria 1065
315 Ga0207706_10669337 3300025933 Bacteria 888
316 Ga0207686_10024362 3300025934 Bacteria 3506
317 Ga0207709_10486034 3300025935 Bacteria 961
318 Ga0207670_11356603 3300025936 Bacteria 603
319 Ga0207704_10024285 3300025938 Bacteria 3284
320 Ga0207665_10318254 3300025939 Bacteria 1167
321 Ga0207691_10090179 3300025940 Bacteria 2749
322 Ga0207689_10432733 3300025942 Bacteria 1099
323 Ga0207661_10008149 3300025944 Bacteria 7476
324 Ga0207661_10038258 3300025944 Bacteria 3759
325 Ga0207661_10187236 3300025944 Bacteria 1812
326 Ga0207661_10283671 3300025944 Bacteria 1481
327 Ga0207661_10429701 3300025944 Bacteria 1200
328 Ga0207661_10671632 3300025944 Bacteria 952
329 Ga0207661_11653976 3300025944 Bacteria 585
330 Ga0207661_11765767 3300025944 Bacteria 564
331 Ga0207679_10083749 3300025945 Bacteria 2445
332 Ga0207679_10113078 3300025945 Bacteria 2147
333 Ga0207679_10115169 3300025945 Bacteria 2129
334 Ga0207679_10336440 3300025945 Bacteria 1312
335 Ga0207679_10532393 3300025945 Bacteria 1052
336 Ga0207679_10602241 3300025945 Bacteria 990
337 Ga0207667_10023861 3300025949 Bacteria 6731
338 Ga0207667_10413329 3300025949 Bacteria 1373
339 Ga0207667_10770513 3300025949 Bacteria 960
340 Ga0207667_11294178 3300025949 Bacteria 706
341 Ga0207667_11586669 3300025949 Bacteria 623
342 Ga0207712_10269885 3300025961 Bacteria 1383
343 Ga0207640_10002916 3300025981 Bacteria 9188
344 Ga0207640_10768556 3300025981 Bacteria 832
345 Ga0207658_11890727 3300025986 Bacteria 544
346 Ga0207677_10258955 3300026023 Bacteria 1417
347 Ga0207677_10264317 3300026023 Bacteria 1404
348 Ga0207677_11028434 3300026023 Bacteria 748
349 Ga0207703_10096883 3300026035 Bacteria 2491
350 Ga0207639_10194667 3300026041 Bacteria 1734
351 Ga0207639_10873197 3300026041 Bacteria 840
352 Ga0207639_11069409 3300026041 Bacteria 756
353 Ga0207678_10000126 3300026067 Bacteria 63715
354 Ga0207678_11064974 3300026067 Bacteria 716
355 Ga0207708_11926174 3300026075 Bacteria 518
356 Ga0207702_10268032 3300026078 Bacteria 1610
357 Ga0207702_10998181 3300026078 Bacteria 830
358 Ga0207702_11188718 3300026078 Bacteria 757
359 Ga0207702_11433796 3300026078 Bacteria 684
360 Ga0207641_11872404 3300026088 Bacteria 601
361 Ga0207648_10051818 3300026089 Bacteria 3587
362 Ga0207674_10008049 3300026116 Bacteria 12220
363 Ga0207674_10015560 3300026116 Bacteria 8354
364 Ga0207674_10206412 3300026116 Bacteria 1914
365 Ga0207675_100174707 3300026118 Bacteria 2055
366 Ga0207675_102224960 3300026118 Bacteria 563
367 Ga0207698_10121863 3300026142 Bacteria 2209
368 Ga0207698_10979210 3300026142 Unclassified 856
369 Ga0207698_11109558 3300026142 Bacteria 804
370 Ga0207698_11198161 3300026142 Bacteria 773
371 Ga0207698_11431867 3300026142 Bacteria 706
372 Ga0268264_10052628 3300028381 Bacteria 3395
373 Ga0307408_100755376 3300031548 Bacteria 879
374 Ga0307408_101343096 3300031548 Bacteria 671
375 Ga0307408_101739988 3300031548 Bacteria 595
376 Ga0316575_10323038 3300031665 Unclassified 655
377 Ga0307405_10000273 3300031731 Bacteria 18995
378 Ga0307405_10037928 3300031731 Bacteria 2901
379 Ga0307405_10678946 3300031731 Bacteria 850
380 Ga0307405_11033919 3300031731 Bacteria 703
381 Ga0307413_10002871 3300031824 Bacteria 7111
382 Ga0307413_10082037 3300031824 Bacteria 2070
383 Ga0307413_10161172 3300031824 Unclassified 1576
384 Ga0307413_10183241 3300031824 Bacteria 1495
385 Ga0307410_10000293 3300031852 Bacteria 19371
386 Ga0307410_10189725 3300031852 Unclassified 1562
387 Ga0307410_10213242 3300031852 Bacteria 1481
388 Ga0307410_10436320 3300031852 Bacteria 1065
389 Ga0307410_10451361 3300031852 Bacteria 1049
390 Ga0307406_10010462 3300031901 Bacteria 5233
391 Ga0307406_10107617 3300031901 Bacteria 1912
392 Ga0307406_10614755 3300031901 Bacteria 898
393 Ga0307406_11005315 3300031901 Bacteria 716
394 Ga0307406_11181738 3300031901 Bacteria 664
395 Ga0307406_11952646 3300031901 Bacteria 524
396 Ga0307407_10072516 3300031903 Bacteria 2054
397 Ga0307407_10089057 3300031903 Bacteria 1887
398 Ga0307407_10216001 3300031903 Bacteria 1294
399 Ga0307407_10841956 3300031903 Bacteria 700
400 Ga0307412_10000509 3300031911 Bacteria 23239
401 Ga0307409_100003011 3300031995 Bacteria 8993
402 Ga0307409_100013061 3300031995 Bacteria 5324
403 Ga0307409_100078488 3300031995 Bacteria 2656
404 Ga0307409_101336525 3300031995 Bacteria 742
405 Ga0307409_101476536 3300031995 Bacteria 707
406 Ga0307409_101862323 3300031995 Bacteria 631
407 Ga0307416_100000414 3300032002 Bacteria 21766
408 Ga0307416_100267814 3300032002 Unclassified 1675
409 Ga0307416_100327974 3300032002 Bacteria 1537
410 Ga0307416_100524907 3300032002 Bacteria 1253
411 Ga0307416_100708439 3300032002 Unclassified 1096
412 Ga0307416_100912694 3300032002 Bacteria 979
413 Ga0307416_101283393 3300032002 Bacteria 838
414 Ga0307414_10011890 3300032004 Bacteria 5127
415 Ga0307414_10155722 3300032004 Bacteria 1808
416 Ga0307414_11458898 3300032004 Bacteria 636
417 Ga0307414_12172207 3300032004 Bacteria 518
418 Ga0307414_12279462 3300032004 Unclassified 506
419 Ga0307411_10000890 3300032005 Bacteria 11305
420 Ga0307411_10020497 3300032005 Bacteria 3847
421 Ga0307411_10443812 3300032005 Bacteria 1084
422 Ga0307411_10778687 3300032005 Bacteria 840
423 Ga0307415_100000110 3300032126 Bacteria 35191
424 Ga0307415_100222899 3300032126 Bacteria 1513
425 Ga0307415_100365468 3300032126 Bacteria 1220
426 Ga0307415_100427169 3300032126 Bacteria 1139
427 Ga0307415_100692019 3300032126 Bacteria 919
428 Ga0307415_102293930 3300032126 Bacteria 529
429 Ga0373926_0000904 3300035083 Bacteria 8537
430 Ga0373940_0236050 3300035088 Bacteria 612
431 Ga0373936_0036155 3300035113 Bacteria 1968
432 Ga0373941_0148964 3300035115 Bacteria 857
433 Ga0373943_0000616 3300035170 Bacteria 15431
434 Ga0373943_0923304 3300035170 Bacteria 522
435 Ga0373946_0049914 3300035171 Bacteria 1746
436 Ga0373961_0300752 3300035241 Bacteria 593
437 Ga0373935_0014384 3300035692 Unclassified 4776
438 Ga0373927_0003259 3300035695 Bacteria 11676
439 Ga0373947_0004771 3300035725 Bacteria 7940
440 Ga0373937_0093422 3300036401 Bacteria 2789
441 Ga0373937_0592337 3300036401 Bacteria 1053
442 Ga0373925_0000472 3300037068 Bacteria 40154
443 Ga0395900_0094733 3300037418 Bacteria 3067
444 Ga0395898_1960304 3300037466 Bacteria 505
445 Ga0395905_0034238 3300037471 Bacteria 4769
446 Ga0395905_0603920 3300037471 Bacteria 999
447 Ga0395905_1144136 3300037471 Bacteria 682
448 Ga0436364_0455196 3300037853 Bacteria 1248
449 Ga0436364_0597219 3300037853 Bacteria 930
450 Ga0395901_0000690 3300038443 Bacteria 38627
451 Ga0436365_0356680 3300039437 Bacteria 853
452 Ga0436365_0612851 3300039437 Unclassified 538
453 Ga0436365_1109168 3300039437 Bacteria 1956
454 Ga0436363_0098403 3300039450 Bacteria 720
455 Ga0451849_0503250 3300041505 Bacteria 612
456 Ga0439448_0368593 3300042005 Bacteria 513
457 Ga0451577_0438112 3300042876 Bacteria 1187
458 Ga0451577_1127566 3300042876 Bacteria 701
459 Ga0466971_0453723 3300044719 Bacteria 629
460 Ga0466957_0926669 3300044842 Bacteria 623
461 Ga0466959_0364651 3300045049 Bacteria 984
462 Ga0451576_0081060 3300045051 Bacteria 3376
463 Ga0466958_0639919 3300045836 Bacteria 692
464 Ga0466967_1651007 3300045976 Bacteria 638
465 Ga0495603_0088398 3300046455 Bacteria 1813
466 Ga0495629_0005468 3300046459 Bacteria 9480
467 Ga0495629_0464679 3300046459 Bacteria 856
468 Ga0495580_0003627 3300046472 Bacteria 13071
469 Ga0495582_0002848 3300046473 Bacteria 9674
470 Ga0495639_0000089 3300046475 Bacteria 44172
471 Ga0495594_0179737 3300046499 Bacteria 1204
472 Ga0495596_0238427 3300046500 Bacteria 706
473 Ga0495628_1199630 3300046516 Bacteria 515
474 Ga0495630_0011984 3300046517 Bacteria 6286
475 Ga0495665_0000272 3300046531 Bacteria 26290
476 Ga0495587_0271715 3300046536 Bacteria 951
477 Ga0495598_0340796 3300046537 Bacteria 575
478 Ga0495621_0017768 3300046539 Bacteria 2303
479 Ga0495621_0160943 3300046539 Bacteria 888
480 Ga0495645_0593084 3300046543 Bacteria 682
481 Ga0495588_0000396 3300046674 Bacteria 24703
482 Ga0495657_0651720 3300046675 Bacteria 607
483 Ga0495658_0001700 3300046683 Bacteria 11442
484 Ga0495669_0144818 3300046684 Bacteria 1123
485 Ga0495613_0003824 3300046689 Bacteria 11271
486 Ga0495613_0019917 3300046689 Bacteria 5001
487 Ga0495581_0000124 3300047315 Bacteria 33166
488 Ga0495581_0658809 3300047315 Bacteria 605
489 Ga0495604_0071100 3300047317 Bacteria 2633
490 Ga0495604_0973518 3300047317 Bacteria 526
491 Ga0495674_0586883 3300047319 Bacteria 884
492 Ga0495675_0109722 3300047444 Bacteria 1723
493 Ga0495675_0374996 3300047444 Bacteria 833
494 Ga0495593_0000172 3300047673 Bacteria 33560
495 Ga0495602_0077432 3300048088 Bacteria 2814
496 Ga0495614_0000310 3300048089 Bacteria 19278
497 Ga0495615_0207851 3300048090 Bacteria 606
498 Ga0496100_0844447 3300048903 Bacteria 718
499 Ga0496101_0392726 3300048904 Bacteria 1092
500 Ga0496101_1404885 3300048904 Bacteria 544
501 Ga0496104_0023728 3300048907 Bacteria 5641
502 Ga0496106_0287825 3300048909 Bacteria 1317
503 Ga0496107_0017592 3300048910 Bacteria 5029
504 Ga0496110_1678011 3300048913 Unclassified 545
505 Ga0496112_0008328 3300048915 Bacteria 9281
506 Ga0496112_0230532 3300048915 Bacteria 1806
507 Ga0496113_0024737 3300048916 Bacteria 4274
508 Ga0496115_0060369 3300048918 Bacteria 3055
509 Ga0501307_065061 3300049162 Bacteria 572
510 Ga0501034_1280513 3300049571 Bacteria 610
511 Ga0501043_0185838 3300049579 Bacteria 1618
512 Ga0501046_0082657 3300049580 Bacteria 2480
513 Ga0501047_1323734 3300049581 Bacteria 535
514 Ga0501048_0657705 3300049582 Bacteria 752
515 Ga0501070_0056515 3300049586 Bacteria 3253
516 Ga0501075_0187300 3300049591 Bacteria 1578
517 Ga0501076_0104745 3300049592 Bacteria 2283
518 Ga0501249_130752 3300049679 Bacteria 619
519 Ga0501079_1677952 3300049741 Unclassified 500
520 Ga0501035_0305649 3300049822 Bacteria 1339
521 Ga0501044_1053852 3300049823 Bacteria 684
522 nmdc:mga09592_158353_c1 3300050508 Bacteria 1955
523 nmdc:mga09592_647859_c1 3300050508 Bacteria 902
524 nmdc:mga0qj67_201283_c1 3300050509 Bacteria 1618
525 nmdc:mga0qj67_322436_c1 3300050509 Unclassified 1251
526 nmdc:mga0qj67_389691_c1 3300050509 Bacteria 1125
527 nmdc:mga06r32_59673_c1 3300050510 Bacteria 3670
528 nmdc:mga08y16_1985412_c1 3300050511 Bacteria 531
529 nmdc:mga0n895_1043250_c1 3300050512 Bacteria 797
530 nmdc:mga0rr50_739768_c1 3300050513 Bacteria 839
531 nmdc:mga0rr50_832154_c1 3300050513 Bacteria 787
532 nmdc:mga08x19_141296_c1 3300050514 Unclassified 1626
533 Ga0501084_0299538 3300054114 Bacteria 1358
534 Ga0590071_192911 3300059421 Bacteria 535
535 Ga0590077_031705 3300059426 Bacteria 1156
536 Ga0501082_0471853 3300060353 Bacteria 1097
537 Ga0530510_0976962 3300061734 Bacteria 648
538 Ga0530510_1256908 3300061734 Unclassified 568
539 Ga0070658_11896576
540 LJQas_1007821
541 JGI24739J22299_10218240
542 Ga0058859_11347103
543 Ga0058863_11916653
544 Ga0058862_12668187
545 Ga0070658_10002341
546 Ga0070658_10083007
547 Ga0070658_10128304
548 Ga0070658_10151400
549 Ga0070658_10513396
550 Ga0070658_10638519
551 Ga0070658_11573230
552 Ga0070658_11626898
553 Ga0070658_11957761
554 Ga0070683_100001776
555 Ga0070683_100028452
556 Ga0070683_100092879
557 Ga0070683_100093244
558 Ga0070683_100336241
559 Ga0070683_100352022
560 Ga0070683_100380220
561 Ga0070666_10284127
562 Ga0070680_100133284
563 Ga0070680_100414787
564 Ga0070680_101338516
565 Ga0070682_100224268
566 Ga0070682_100589580
567 Ga0070682_100632365
568 Ga0070682_101009980
569 Ga0068868_100008461
570 Ga0068868_100075729
571 Ga0068868_100108739
572 Ga0068868_100616418
573 Ga0070660_100045540
574 Ga0070660_100084018
575 Ga0070660_100185400
576 Ga0070660_100212557
577 Ga0070660_100367993
578 Ga0070660_100779156
579 Ga0070660_101748826
580 Ga0070689_100299919
581 Ga0070691_10022398
582 Ga0070691_10061445
583 Ga0070687_100499419
584 Ga0070687_100503538
585 Ga0070661_100010908
586 Ga0070661_100011111
587 Ga0070661_100081992
588 Ga0070661_100388236
589 Ga0070661_100834623
590 Ga0070661_100862121
591 Ga0070661_100899887
592 Ga0070692_10188174
593 Ga0070692_11069120
594 Ga0070668_100410002
595 Ga0070675_100083108
596 Ga0070675_100343314
597 Ga0070671_101572514
598 Ga0070674_100003496
599 Ga0070673_100341099
600 Ga0070673_100573913
601 Ga0070673_100738182
602 Ga0070659_100378031
603 Ga0070659_101461317
604 Ga0070709_10014648
605 Ga0070709_10273796
606 Ga0070709_10640588
607 Ga0070714_100006635
608 Ga0070714_100082769
609 Ga0070714_100119768
610 Ga0070714_101775443
611 Ga0070713_100000613
612 Ga0070713_100284482
613 Ga0070713_100730843
614 Ga0070710_10131050
615 Ga0070710_10848888
616 Ga0070711_100543602
617 Ga0070711_101219928
618 Ga0070663_100672556
619 Ga0070663_101600674
620 Ga0070662_100168132
621 Ga0070662_101094333
622 Ga0070681_10001771
623 Ga0070681_10003898
624 Ga0070681_10111185
625 Ga0070681_10154440
626 Ga0070681_10194873
627 Ga0070681_10645158
628 Ga0070681_10905450
629 Ga0070681_11539230
630 Ga0070681_11681370
631 Ga0068867_100108243
632 Ga0070706_100589085
633 Ga0070706_100881459
634 Ga0070699_100227394
635 Ga0070679_100001652
636 Ga0070679_100015156
637 Ga0070679_100025545
638 Ga0070679_100084025
639 Ga0070679_100084523
640 Ga0070679_100181701
641 Ga0070679_100211043
642 Ga0070679_100373384
643 Ga0070679_100546051
644 Ga0070679_101396110
645 Ga0070679_101400108
646 Ga0070684_100003503
647 Ga0070684_100006177
648 Ga0070684_100014975
649 Ga0070684_100267747
650 Ga0070684_100274228
651 Ga0070684_100744675
652 Ga0070684_101109424
653 Ga0070684_101427207
654 Ga0070684_101861030
655 Ga0068853_100050077
656 Ga0068853_100160653
657 Ga0068853_101095845
658 Ga0068853_101190047
659 Ga0070672_100104384
660 Ga0070686_100900820
661 Ga0070693_100049642
662 Ga0070693_100221143
663 Ga0070704_100392053
664 Ga0068855_100401683
665 Ga0068855_100668168
666 Ga0068855_101121195
667 Ga0068855_101734747
668 Ga0068855_102095639
669 Ga0070664_100007535
670 Ga0070664_100038589
671 Ga0070664_100050911
672 Ga0070664_100250951
673 Ga0070664_100534057
674 Ga0070664_101731816
675 Ga0070664_101857387
676 Ga0068857_100019452
677 Ga0068857_101044521
678 Ga0068857_101479492
679 Ga0068854_100222044
680 Ga0068854_100726228
681 Ga0068856_100300183
682 Ga0068856_100322764
683 Ga0068856_100872962
684 Ga0068856_100961026
685 Ga0068856_101071202
686 Ga0068856_101218316
687 Ga0068856_101329446
688 Ga0070702_100959977
689 Ga0068852_100287689
690 Ga0068852_100348710
691 Ga0068852_100973895
692 Ga0068852_101079930
693 Ga0068864_101251591
694 Ga0068866_10032539
695 Ga0068861_100336222
696 Ga0068861_101662073
697 Ga0068851_10003964
698 Ga0068870_10007500
699 Ga0068863_100308569
700 Ga0068858_100419730
701 Ga0068858_101625692
702 Ga0068860_100351942
703 Ga0068860_102132676
704 Ga0070717_10008798
705 Ga0070717_11806959
706 Ga0070716_100006614
707 Ga0070716_100500892
708 Ga0070712_100008785
709 Ga0070712_100334495
710 Ga0070712_100391443
711 Ga0068871_101799270
712 Ga0075430_100033785
713 Ga0075431_100171016
714 Ga0075431_100373745
715 Ga0075431_100413542
716 Ga0075434_100914261
717 Ga0075429_100053682
718 Ga0075429_100404408
719 Ga0068865_100136594
720 Ga0075436_100259759
721 Ga0075435_100884191
722 Ga0105240_10239882
723 Ga0105240_10350827
724 Ga0105240_11441103
725 Ga0105240_11792862
726 Ga0105240_12344105
727 Ga0111539_12643489
728 Ga0105245_10078445
729 Ga0105245_11263568
730 Ga0105245_12547366
731 Ga0105245_12974800
732 Ga0105243_10520395
733 Ga0105241_10087003
734 Ga0105242_10831568
735 Ga0105238_10033820
736 Ga0105249_10558194
737 Ga0105239_11834619
738 Ga0105246_10058737
739 Ga0157373_10013623
740 Ga0157373_10030211
741 Ga0157373_10048967
742 Ga0157373_10140724
743 Ga0157373_10482247
744 Ga0157373_10802704
745 Ga0157373_11086484
746 Ga0157371_10018474
747 Ga0157371_10052208
748 Ga0157371_10069163
749 Ga0157371_11137639
750 Ga0157371_11345227
751 Ga0157370_10032918
752 Ga0157370_10412521
753 Ga0157370_10534326
754 Ga0157370_10565560
755 Ga0157369_10048298
756 Ga0157369_10169713
757 Ga0157369_10271359
758 Ga0157369_10998990
759 Ga0157369_12264208
760 Ga0157369_12703919
761 Ga0157374_10245093
762 Ga0157374_12018257
763 Ga0157378_10986301
764 Ga0157378_11175735
765 Ga0157372_10001275
766 Ga0157372_10010695
767 Ga0157372_10019074
768 Ga0157372_10526333
769 Ga0157372_10604766
770 Ga0157372_11166769
771 Ga0157372_11184785
772 Ga0157372_11504423
773 Ga0157372_12810940
774 Ga0157375_10019621
775 Ga0163163_10875320
776 Ga0157379_10442674
777 Ga0157376_12849424
778 Ga0182007_10222681
779 Ga0163161_10178053
780 Ga0163161_10671297
781 Ga0213876_10159870
782 Ga0213875_10239937
783 Ga0207697_10300483
784 Ga0207656_10203467
785 Ga0207692_10051269
786 Ga0207680_10083660
787 Ga0207685_10392387
788 Ga0207699_10031402
789 Ga0207699_10183514
790 Ga0207699_10213620
791 Ga0207699_10327789
792 Ga0207705_10002235
793 Ga0207705_10003344
794 Ga0207705_10006207
795 Ga0207705_10066063
796 Ga0207705_10076591
797 Ga0207705_10269038
798 Ga0207705_10475629
799 Ga0207654_10033665
800 Ga0207707_10010670
801 Ga0207707_10013457
802 Ga0207707_10040558
803 Ga0207707_10370770
804 Ga0207707_10611118
805 Ga0207707_10666466
806 Ga0207707_10939406
807 Ga0207695_10113569
808 Ga0207693_10011643
809 Ga0207693_10053207
810 Ga0207663_10294604
811 Ga0207663_10487278
812 Ga0207660_10041508
813 Ga0207660_10046048
814 Ga0207660_10137616
815 Ga0207660_10921322
816 Ga0207660_11529684
817 Ga0207657_10005224
818 Ga0207657_10017240
819 Ga0207657_10171792
820 Ga0207657_10256675
821 Ga0207657_10515926
822 Ga0207649_10034397
823 Ga0207649_10188150
824 Ga0207649_10346267
825 Ga0207649_10878911
826 Ga0207652_10005814
827 Ga0207652_10021686
828 Ga0207652_10049014
829 Ga0207652_10106008
830 Ga0207652_10107847
831 Ga0207652_10122872
832 Ga0207652_10133137
833 Ga0207652_10142088
834 Ga0207652_10321179
835 Ga0207652_10902461
836 Ga0207652_11042330
837 Ga0207694_10090011
838 Ga0207687_10300105
839 Ga0207687_11165508
840 Ga0207700_10000550
841 Ga0207700_10392990
842 Ga0207700_10459101
843 Ga0207664_10014218
844 Ga0207664_10027233
845 Ga0207664_10081331
846 Ga0207664_11606244
847 Ga0207690_10034040
848 Ga0207690_11688818
849 Ga0207706_10144072
850 Ga0207706_10264630
851 Ga0207706_10290562
852 Ga0207706_10487178
853 Ga0207706_10669337
854 Ga0207686_10024362
855 Ga0207709_10486034
856 Ga0207670_11356603
857 Ga0207704_10024285
858 Ga0207665_10318254
859 Ga0207691_10090179
860 Ga0207689_10432733
861 Ga0207661_10008149
862 Ga0207661_10038258
863 Ga0207661_10187236
864 Ga0207661_10283671
865 Ga0207661_10429701
866 Ga0207661_10671632
867 Ga0207661_11653976
868 Ga0207661_11765767
869 Ga0207679_10083749
870 Ga0207679_10113078
871 Ga0207679_10115169
872 Ga0207679_10336440
873 Ga0207679_10532393
874 Ga0207679_10602241
875 Ga0207667_10023861
876 Ga0207667_10413329
877 Ga0207667_10770513
878 Ga0207667_11294178
879 Ga0207667_11586669
880 Ga0207712_10269885
881 Ga0207640_10002916
882 Ga0207640_10768556
883 Ga0207658_11890727
884 Ga0207677_10258955
885 Ga0207677_10264317
886 Ga0207677_11028434
887 Ga0207703_10096883
888 Ga0207639_10194667
889 Ga0207639_10873197
890 Ga0207639_11069409
891 Ga0207678_10000126
892 Ga0207678_11064974
893 Ga0207708_11926174
894 Ga0207702_10268032
895 Ga0207702_10998181
896 Ga0207702_11188718
897 Ga0207702_11433796
898 Ga0207641_11872404
899 Ga0207648_10051818
900 Ga0207674_10008049
901 Ga0207674_10015560
902 Ga0207674_10206412
903 Ga0207675_100174707
904 Ga0207675_102224960
905 Ga0207698_10121863
906 Ga0207698_10979210
907 Ga0207698_11109558
908 Ga0207698_11198161
909 Ga0207698_11431867
910 Ga0268264_10052628
911 Ga0307408_100755376
912 Ga0307408_101343096
913 Ga0307408_101739988
914 Ga0316575_10323038
915 Ga0307405_10000273
916 Ga0307405_10037928
917 Ga0307405_10678946
918 Ga0307405_11033919
919 Ga0307413_10002871
920 Ga0307413_10082037
921 Ga0307413_10161172
922 Ga0307413_10183241
923 Ga0307410_10000293
924 Ga0307410_10189725
925 Ga0307410_10213242
926 Ga0307410_10436320
927 Ga0307410_10451361
928 Ga0307406_10010462
929 Ga0307406_10107617
930 Ga0307406_10614755
931 Ga0307406_11005315
932 Ga0307406_11181738
933 Ga0307406_11952646
934 Ga0307407_10072516
935 Ga0307407_10089057
936 Ga0307407_10216001
937 Ga0307407_10841956
938 Ga0307412_10000509
939 Ga0307409_100003011
940 Ga0307409_100013061
941 Ga0307409_100078488
942 Ga0307409_101336525
943 Ga0307409_101476536
944 Ga0307409_101862323
945 Ga0307416_100000414
946 Ga0307416_100267814
947 Ga0307416_100327974
948 Ga0307416_100524907
949 Ga0307416_100708439
950 Ga0307416_100912694
951 Ga0307416_101283393
952 Ga0307414_10011890
953 Ga0307414_10155722
954 Ga0307414_11458898
955 Ga0307414_12172207
956 Ga0307414_12279462
957 Ga0307411_10000890
958 Ga0307411_10020497
959 Ga0307411_10443812
960 Ga0307411_10778687
961 Ga0307415_100000110
962 Ga0307415_100222899
963 Ga0307415_100365468
964 Ga0307415_100427169
965 Ga0307415_100692019
966 Ga0307415_102293930
967 Ga0373926_0000904
968 Ga0373940_0236050
969 Ga0373936_0036155
970 Ga0373941_0148964
971 Ga0373943_0000616
972 Ga0373943_0923304
973 Ga0373946_0049914
974 Ga0373961_0300752
975 Ga0373935_0014384
976 Ga0373927_0003259
977 Ga0373947_0004771
978 Ga0373937_0093422
979 Ga0373937_0592337
980 Ga0373925_0000472
981 Ga0395900_0094733
982 Ga0395898_1960304
983 Ga0395905_0034238
984 Ga0395905_0603920
985 Ga0395905_1144136
986 Ga0436364_0455196
987 Ga0436364_0597219
988 Ga0395901_0000690
989 Ga0436365_0356680
990 Ga0436365_0612851
991 Ga0436365_1109168
992 Ga0436363_0098403
993 Ga0451849_0503250
994 Ga0439448_0368593
995 Ga0451577_0438112
996 Ga0451577_1127566
997 Ga0466971_0453723
998 Ga0466957_0926669
999 Ga0466959_0364651
1000 Ga0451576_0081060
1001 Ga0466958_0639919
1002 Ga0466967_1651007
1003 Ga0495603_0088398
1004 Ga0495629_0005468
1005 Ga0495629_0464679
1006 Ga0495580_0003627
1007 Ga0495582_0002848
1008 Ga0495639_0000089
1009 Ga0495594_0179737
1010 Ga0495596_0238427
1011 Ga0495628_1199630
1012 Ga0495630_0011984
1013 Ga0495665_0000272
1014 Ga0495587_0271715
1015 Ga0495598_0340796
1016 Ga0495621_0017768
1017 Ga0495621_0160943
1018 Ga0495645_0593084
1019 Ga0495588_0000396
1020 Ga0495657_0651720
1021 Ga0495658_0001700
1022 Ga0495669_0144818
1023 Ga0495613_0003824
1024 Ga0495613_0019917
1025 Ga0495581_0000124
1026 Ga0495581_0658809
1027 Ga0495604_0071100
1028 Ga0495604_0973518
1029 Ga0495674_0586883
1030 Ga0495675_0109722
1031 Ga0495675_0374996
1032 Ga0495593_0000172
1033 Ga0495602_0077432
1034 Ga0495614_0000310
1035 Ga0495615_0207851
1036 Ga0496100_0844447
1037 Ga0496101_0392726
1038 Ga0496101_1404885
1039 Ga0496104_0023728
1040 Ga0496106_0287825
1041 Ga0496107_0017592
1042 Ga0496110_1678011
1043 Ga0496112_0008328
1044 Ga0496112_0230532
1045 Ga0496113_0024737
1046 Ga0496115_0060369
1047 Ga0501307_065061
1048 Ga0501034_1280513
1049 Ga0501043_0185838
1050 Ga0501046_0082657
1051 Ga0501047_1323734
1052 Ga0501048_0657705
1053 Ga0501070_0056515
1054 Ga0501075_0187300
1055 Ga0501076_0104745
1056 Ga0501249_130752
1057 Ga0501079_1677952
1058 Ga0501035_0305649
1059 Ga0501044_1053852
1060 nmdc:mga09592_158353_c1
1061 nmdc:mga09592_647859_c1
1062 nmdc:mga0qj67_201283_c1
1063 nmdc:mga0qj67_322436_c1
1064 nmdc:mga0qj67_389691_c1
1065 nmdc:mga06r32_59673_c1
1066 nmdc:mga08y16_1985412_c1
1067 nmdc:mga0n895_1043250_c1
1068 nmdc:mga0rr50_739768_c1
1069 nmdc:mga0rr50_832154_c1
1070 nmdc:mga08x19_141296_c1
1071 Ga0501084_0299538
1072 Ga0590071_192911
1073 Ga0590077_031705
1074 Ga0501082_0471853
1075 Ga0530510_0976962
1076 Ga0530510_1256908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

2

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zwl-assembly1.cif.gz_E crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial f1-atpase 0.9295 2 82
6ree-assembly1.cif.gz_R cryo-em structure of polytomella f-atp synthase, rotary substate 3b, composite map 0.9263 3 82
6fkh-assembly1.cif.gz_e chloroplast f1fo conformation 2 0.9246 2 82
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9223 1 82
6n2z-assembly1.cif.gz_H bacillus ps3 atp synthase class 2 0.9221 2 82
ID Description Score Start End Superfamily
af_I1JML1_57_153_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9404 2 83 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9396 2 82 2.60.15.10
af_P9WPV1_1_120_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9324 2 82 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9307 2 82 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9281 2 82 2.60.15.10
ID Description Score Start End GO Terms
AF-X1U2A3-F1-model_v4 ATP synthase F1 complex delta/epsilon subunit N-terminal domain-containing protein 0.9777 2 83 GO:0045261
GO:0046933
AF-Q04S19-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9686 2 81 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A2N1T036-F1-model_v4 deleted 0.9684 2 82
AF-A0A1G3QPF2-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9684 2 82 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A838WE18-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9669 2 83 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933

Map