F460937

General Info

Members Datasets Scaffolds Average Seq Length
537 296 513 138

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0051708|Ga0466958_0051708_775_1254
Length 159
Sequence MRHSRSGILVVLLTVLRFNDVMFDHCLYFNSSALARLAEREWSAAYAPFGLTPAQGFVLRVVLASPGCLSSQIADVLGIARPTATRLIDNLCQKQLVERRQAESDGREWGVYPTRAGKALDRPINDASAQIAKTLREKVGTDLFQSAVSSMHGIRKALS

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
7 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
8 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
9 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
10 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
11 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
12 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
13 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
14 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
15 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
16 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
17 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
18 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
19 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
20 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
21 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
22 2928058823 Ralstonia sp. 1138 Isolate Unclassified
23 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
36 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
37 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
38 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
39 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
48 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
49 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
50 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
164 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
189 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
190 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
255 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
263 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
293 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.41
Metatranscriptomes 1.12
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.6
Nodule 1.68
Rhizoplane 4.84
Rhizosphere 62.2
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004919 3300001915 Bacteria 2878
2 JGI24740J21852_10000068 3300001979 Bacteria 34079
3 JGI24740J21852_10000165 3300001979 Bacteria 26307
4 JGI24740J21852_10001559 3300001979 Bacteria 10529
5 JGI24735J21928_10032090 3300002067 Bacteria 1555
6 JGI25156J39149_1018613 3300002705 Bacteria 1278
7 JGI25156J39149_1019183 3300002705 Bacteria 1240
8 JGI25156J39149_1035552 3300002705 Bacteria 715
9 JGI25162J39368_1000079 3300002737 Bacteria 115162
10 JGI25163J39215_1005496 3300002771 Bacteria 802
11 JGI25150J39212_1004070 3300002774 Bacteria 3308
12 JGI25150J39212_1006550 3300002774 Bacteria 2396
13 JGI25159J45721_1000295 3300002987 Bacteria 23372
14 JGI25151J46595_10005589 3300003187 Bacteria 6469
15 JGI25151J46595_10006626 3300003187 Bacteria 5778
16 JGI25165J46597_1000135 3300003214 Bacteria 122924
17 rootH2_10229482 3300003320 Bacteria 1133
18 rootH1_10324460 3300003323 Bacteria 2632
19 JGI25160J50197_1000223 3300003354 Bacteria 45156
20 JGI25161J50226_1000013 3300003374 Bacteria 199086
21 Ga0006562J51391_1196130 3300003578 Bacteria 840
22 Ga0055538_1000055 3300003751 Bacteria 122924
23 Ga0055538_1001015 3300003751 Bacteria 6437
24 Ga0055538_1001935 3300003751 Bacteria 3406
25 Ga0055538_1003845 3300003751 Bacteria 1815
26 Ga0055538_1004025 3300003751 Bacteria 1738
27 Ga0055539_1000080 3300003752 Bacteria 122924
28 Ga0055539_1000081 3300003752 Bacteria 122891
29 Ga0055539_1000201 3300003752 Bacteria 47514
30 Ga0055533_1000086 3300003756 Bacteria 122924
31 Ga0055533_1004854 3300003756 Bacteria 2311
32 Ga0055533_1007168 3300003756 Bacteria 1545
33 Ga0055533_1007546 3300003756 Bacteria 1469
34 Ga0055533_1008633 3300003756 Bacteria 1268
35 Ga0055532_1000048 3300003758 Bacteria 175560
36 Ga0055532_1000073 3300003758 Bacteria 131021
37 Ga0055525_1000114 3300003759 Bacteria 122924
38 Ga0055525_1000640 3300003759 Bacteria 14087
39 Ga0055525_1000820 3300003759 Bacteria 9496
40 Ga0055527_1001283 3300003760 Bacteria 5494
41 Ga0055527_1001715 3300003760 Bacteria 4274
42 Ga0055535_1000035 3300003761 Bacteria 175560
43 Ga0055535_1000055 3300003761 Bacteria 131021
44 Ga0055529_1000101 3300003763 Bacteria 130709
45 Ga0055529_1000877 3300003763 Bacteria 17223
46 Ga0055526_1037248 3300003771 Bacteria 1275
47 Ga0055537_1011474 3300003773 Bacteria 1795
48 Ga0055534_1030703 3300003784 Bacteria 828
49 Ga0055530_10012725 3300003791 Bacteria 2915
50 Ga0055541_1000057 3300003841 Bacteria 122924
51 Ga0055541_1000601 3300003841 Bacteria 9618
52 Ga0055541_1005563 3300003841 Bacteria 2192
53 Ga0055541_1009153 3300003841 Bacteria 1545
54 Ga0055541_1011830 3300003841 Bacteria 1268
55 Ga0055543_1000211 3300004625 Bacteria 47109
56 Ga0070683_100638034 3300005329 Bacteria 1020
57 Ga0070666_10137808 3300005335 Bacteria 1699
58 Ga0070682_100076290 3300005337 Bacteria 2157
59 Ga0070682_101165173 3300005337 Bacteria 649
60 Ga0070687_100042021 3300005343 Bacteria 2314
61 Ga0070661_100000061 3300005344 Bacteria 86581
62 Ga0070661_100000093 3300005344 Bacteria 73157
63 Ga0070661_100176890 3300005344 Bacteria 1622
64 Ga0070661_100214892 3300005344 Bacteria 1473
65 Ga0070675_100934448 3300005354 Bacteria 795
66 Ga0070671_100153176 3300005355 Bacteria 1947
67 Ga0070674_100660726 3300005356 Bacteria 889
68 Ga0070659_100740194 3300005366 Bacteria 852
69 Ga0070667_101043425 3300005367 Bacteria 763
70 Ga0070713_100098224 3300005436 Bacteria 2532
71 Ga0070713_100503711 3300005436 Bacteria 1143
72 Ga0070663_100000009 3300005455 Bacteria 187718
73 Ga0070663_100000024 3300005455 Bacteria 108544
74 Ga0070663_100147335 3300005455 Bacteria 1802
75 Ga0070663_100247361 3300005455 Bacteria 1410
76 Ga0070662_100620969 3300005457 Bacteria 910
77 Ga0068867_101446660 3300005459 Bacteria 638
78 Ga0068855_100460112 3300005563 Bacteria 1387
79 Ga0070664_100000010 3300005564 Bacteria 165664
80 Ga0070664_100000022 3300005564 Bacteria 108544
81 Ga0070664_100106292 3300005564 Bacteria 2445
82 Ga0070664_100163160 3300005564 Bacteria 1973
83 Ga0068857_100011536 3300005577 Bacteria 7688
84 Ga0068857_100039179 3300005577 Bacteria 4197
85 Ga0068857_100833646 3300005577 Bacteria 882
86 Ga0068854_100000077 3300005578 Bacteria 69779
87 Ga0068854_100000088 3300005578 Bacteria 65455
88 Ga0068854_101788471 3300005578 Unclassified 563
89 Ga0068856_100000049 3300005614 Bacteria 108544
90 Ga0068856_100000069 3300005614 Bacteria 95628
91 Ga0068852_100091229 3300005616 Bacteria 2726
92 Ga0068852_100505022 3300005616 Bacteria 1204
93 Ga0068863_102396890 3300005841 Bacteria 537
94 Ga0081455_10311175 3300005937 Bacteria 1126
95 Ga0070717_10039890 3300006028 Bacteria 3822
96 Ga0075363_100036886 3300006048 Bacteria 2565
97 Ga0075364_10010177 3300006051 Bacteria 5672
98 Ga0070716_100316109 3300006173 Bacteria 1092
99 Ga0075366_10003812 3300006195 Bacteria 8023
100 Ga0075366_10183672 3300006195 Bacteria 1270
101 Ga0075366_10274515 3300006195 Bacteria 1030
102 Ga0068871_100112759 3300006358 Unclassified 2289
103 Ga0068871_102129948 3300006358 Bacteria 534
104 Ga0079104_1000033 3300006946 Bacteria 202636
105 Ga0105244_10170616 3300009036 Bacteria 1035
106 Ga0105250_10184252 3300009092 Bacteria 877
107 Ga0105240_10059453 3300009093 Unclassified 4770
108 Ga0105240_10151469 3300009093 Bacteria 2762
109 Ga0105240_10158069 3300009093 Bacteria 2694
110 Ga0105240_10392540 3300009093 Bacteria 1565
111 Ga0105240_10496802 3300009093 Bacteria 1357
112 Ga0105245_10333101 3300009098 Unclassified 1499
113 Ga0105247_10173988 3300009101 Bacteria 1433
114 Ga0105241_10405089 3300009174 Bacteria 1197
115 Ga0105241_10767865 3300009174 Bacteria 885
116 Ga0105248_10025385 3300009177 Bacteria 6589
117 Ga0105246_10107305 3300011119 Bacteria 2045
118 Ga0157373_10070355 3300013100 Bacteria 2472
119 Ga0157373_10166796 3300013100 Bacteria 1550
120 Ga0157371_10000088 3300013102 Bacteria 145526
121 Ga0157371_10000089 3300013102 Bacteria 145483
122 Ga0157371_10054674 3300013102 Bacteria 2834
123 Ga0157370_10000002 3300013104 Bacteria 431400
124 Ga0157370_10000041 3300013104 Bacteria 133912
125 Ga0157370_11254720 3300013104 Unclassified 668
126 Ga0157369_10000138 3300013105 Bacteria 102776
127 Ga0157369_10000233 3300013105 Bacteria 76995
128 Ga0157369_10003845 3300013105 Bacteria 17842
129 Ga0157369_10004358 3300013105 Bacteria 16698
130 Ga0157369_10100340 3300013105 Bacteria 3086
131 Ga0157369_10348990 3300013105 Bacteria 1537
132 Ga0157374_10999331 3300013296 Bacteria 856
133 Ga0157378_10879906 3300013297 Bacteria 925
134 Ga0163162_10011368 3300013306 Bacteria 8679
135 Ga0157372_10000363 3300013307 Bacteria 50093
136 Ga0157375_10020561 3300013308 Bacteria 6033
137 Ga0182006_1000917 3300015261 Bacteria 19685
138 Ga0182006_1005883 3300015261 Bacteria 5770
139 Ga0182007_10018289 3300015262 Bacteria 2541
140 Ga0182005_1065890 3300015265 Bacteria 992
141 Ga0163161_10286938 3300017792 Bacteria 1293
142 Ga0206351_10441816 3300020077 Bacteria 1473
143 Ga0206354_11129042 3300020081 Plasmid 1475
144 Ga0206353_11265201 3300020082 Bacteria 2552
145 Ga0154015_1281252 3300020610 Bacteria 7512
146 Ga0154015_1319505 3300020610 Bacteria 17918
147 Ga0209760_100874 3300025207 Bacteria 3864
148 Ga0209436_105523 3300025208 Bacteria 2897
149 Ga0209784_100008 3300025224 Bacteria 740293
150 Ga0209784_100010 3300025224 Bacteria 683664
151 Ga0209784_100024 3300025224 Bacteria 394613
152 Ga0209784_102577 3300025224 Bacteria 1775
153 Ga0209566_100006 3300025225 Bacteria 789272
154 Ga0209566_100008 3300025225 Bacteria 683664
155 Ga0209566_100018 3300025225 Bacteria 448638
156 Ga0209566_100582 3300025225 Bacteria 23555
157 Ga0209566_100612 3300025225 Bacteria 22172
158 Ga0209674_100019 3300025226 Bacteria 683664
159 Ga0209674_100045 3300025226 Bacteria 362387
160 Ga0209674_100046 3300025226 Bacteria 357920
161 Ga0209674_100870 3300025226 Bacteria 9859
162 Ga0209674_103063 3300025226 Bacteria 3214
163 Ga0209674_106797 3300025226 Bacteria 1511
164 Ga0209672_100127 3300025228 Bacteria 78095
165 Ga0209672_100650 3300025228 Bacteria 17785
166 Ga0209147_100005 3300025229 Bacteria 1036530
167 Ga0209147_100008 3300025229 Bacteria 777096
168 Ga0209563_100016 3300025230 Bacteria 802091
169 Ga0209563_100021 3300025230 Bacteria 683764
170 Ga0209563_100039 3300025230 Bacteria 409717
171 Ga0209563_100090 3300025230 Bacteria 169322
172 Ga0209563_102848 3300025230 Bacteria 3765
173 Ga0209563_105007 3300025230 Bacteria 2456
174 Ga0209563_105643 3300025230 Bacteria 2238
175 Ga0207427_102464 3300025231 Bacteria 4959
176 Ga0209437_100019 3300025233 Bacteria 683764
177 Ga0209258_100007 3300025242 Bacteria 1036530
178 Ga0209258_100013 3300025242 Bacteria 777096
179 Ga0207425_1002014 3300025245 Bacteria 7568
180 Ga0209026_1035270 3300025250 Bacteria 734
181 Ga0209677_100008 3300025253 Bacteria 802091
182 Ga0209677_100011 3300025253 Bacteria 683664
183 Ga0209677_100024 3300025253 Bacteria 406035
184 Ga0209148_1001888 3300025254 Bacteria 8659
185 Ga0209148_1002127 3300025254 Bacteria 7421
186 Ga0209759_1002288 3300025256 Bacteria 8641
187 Ga0209759_1004083 3300025256 Bacteria 5580
188 Ga0209759_1005154 3300025256 Bacteria 4657
189 Ga0209759_1018784 3300025256 Bacteria 1662
190 Ga0209759_1029053 3300025256 Bacteria 1114
191 Ga0209129_1004929 3300025258 Bacteria 4968
192 Ga0209233_1000025 3300025261 Bacteria 683764
193 Ga0209565_1000768 3300025263 Bacteria 18752
194 Ga0209455_1000011 3300025272 Bacteria 947242
195 Ga0209455_1000042 3300025272 Bacteria 419638
196 Ga0209130_1000064 3300025284 Bacteria 196568
197 Ga0209675_1004319 3300025291 Bacteria 6370
198 Ga0209676_1001583 3300025292 Bacteria 20274
199 Ga0209025_1003115 3300025294 Bacteria 16255
200 Ga0209564_1006428 3300025295 Bacteria 6339
201 Ga0209758_1013860 3300025297 Bacteria 4348
202 Ga0209758_1041073 3300025297 Bacteria 1735
203 Ga0209050_1005684 3300025298 Bacteria 7712
204 Ga0209256_1026726 3300025299 Bacteria 1657
205 Ga0207426_1000116 3300025302 Bacteria 225245
206 Ga0209051_1096316 3300025303 Bacteria 808
207 Ga0209257_1018538 3300025304 Bacteria 2672
208 Ga0207710_10295499 3300025900 Bacteria 817
209 Ga0207680_10084147 3300025903 Bacteria 2006
210 Ga0207654_10591546 3300025911 Bacteria 791
211 Ga0207695_10000739 3300025913 Bacteria 63264
212 Ga0207695_10005647 3300025913 Bacteria 16509
213 Ga0207695_10193665 3300025913 Bacteria 1950
214 Ga0207695_10626388 3300025913 Bacteria 957
215 Ga0207663_11350797 3300025916 Bacteria 574
216 Ga0207662_10066541 3300025918 Bacteria 2171
217 Ga0207649_10000588 3300025920 Bacteria 24754
218 Ga0207649_10001707 3300025920 Bacteria 12643
219 Ga0207700_10802136 3300025928 Bacteria 842
220 Ga0207690_10026235 3300025932 Bacteria 3668
221 Ga0207690_10988618 3300025932 Unclassified 700
222 Ga0207665_10205609 3300025939 Bacteria 1436
223 Ga0207711_10033590 3300025941 Bacteria 4342
224 Ga0207679_10000002 3300025945 Bacteria 634491
225 Ga0207679_10000004 3300025945 Bacteria 589021
226 Ga0207679_10542975 3300025945 Bacteria 1042
227 Ga0207667_10005394 3300025949 Bacteria 15595
228 Ga0207640_10000058 3300025981 Bacteria 92862
229 Ga0207640_10000358 3300025981 Bacteria 29693
230 Ga0207658_11008787 3300025986 Bacteria 759
231 Ga0207678_10000012 3300026067 Bacteria 145324
232 Ga0207678_10000018 3300026067 Bacteria 135549
233 Ga0207678_10061760 3300026067 Bacteria 3223
234 Ga0207678_10433218 3300026067 Bacteria 1141
235 Ga0207708_10427258 3300026075 Unclassified 1099
236 Ga0207702_10000020 3300026078 Bacteria 203299
237 Ga0207702_10000053 3300026078 Bacteria 137538
238 Ga0207641_11512818 3300026088 Bacteria 673
239 Ga0207648_10341686 3300026089 Bacteria 1348
240 Ga0207674_10001653 3300026116 Bacteria 28692
241 Ga0207674_10021641 3300026116 Bacteria 6923
242 Ga0207674_11528258 3300026116 Bacteria 636
243 Ga0207683_10137905 3300026121 Bacteria 2196
244 Ga0207698_10384078 3300026142 Bacteria 1337
245 Ga0207698_10602226 3300026142 Bacteria 1083
246 Ga0207698_10797583 3300026142 Bacteria 946
247 Ga0207698_12695378 3300026142 Unclassified 506
248 Ga0209281_1000043 3300027111 Bacteria 341543
249 Ga0307517_10321612 3300028786 Bacteria 856
250 Ga0265338_10000092 3300028800 Bacteria 168538
251 Ga0316183_1116527 3300030742 Unclassified 513
252 Ga0316181_1137718 3300030744 Bacteria 1290
253 Ga0307513_10000316 3300031456 Bacteria 69426
254 Ga0307408_100035846 3300031548 Bacteria 3483
255 Ga0307508_10022414 3300031616 Bacteria 5741
256 Ga0307516_10001925 3300031730 Bacteria 28437
257 Ga0307516_10061874 3300031730 Bacteria 3630
258 Ga0307405_10188848 3300031731 Bacteria 1486
259 Ga0307412_11485752 3300031911 Bacteria 616
260 Ga0307409_100323670 3300031995 Bacteria 1444
261 Ga0307411_11247640 3300032005 Bacteria 675
262 Ga0307411_11707039 3300032005 Bacteria 583
263 Ga0307507_10201025 3300033179 Bacteria 1379
264 Ga0373944_0046347 3300035089 Bacteria 1359
265 Ga0395899_0578009 3300037312 Bacteria 719
266 Ga0395899_0764734 3300037312 Bacteria 600
267 Ga0395900_0001682 3300037418 Bacteria 25734
268 Ga0395900_0004085 3300037418 Bacteria 15559
269 Ga0395900_0332884 3300037418 Bacteria 1496
270 Ga0395900_0436436 3300037418 Bacteria 1268
271 Ga0395900_0636590 3300037418 Unclassified 1004
272 Ga0395898_0006835 3300037466 Bacteria 12131
273 Ga0395898_0109504 3300037466 Bacteria 2648
274 Ga0395898_0342169 3300037466 Bacteria 1426
275 Ga0395898_0767300 3300037466 Bacteria 905
276 Ga0395905_0000017 3300037471 Bacteria 376619
277 Ga0395905_0407210 3300037471 Bacteria 1255
278 Ga0395901_0000003 3300038443 Bacteria 701538
279 Ga0395901_0000576 3300038443 Bacteria 42723
280 Ga0395901_0296622 3300038443 Bacteria 1676
281 Ga0395901_0403792 3300038443 Bacteria 1403
282 Ga0395901_0528219 3300038443 Bacteria 1198
283 Ga0395901_1236963 3300038443 Unclassified 711
284 Ga0451791_1272617 3300041451 Bacteria 1198
285 Ga0451853_3666298 3300041512 Bacteria 741
286 Ga0439448_0004132 3300042005 Bacteria 4089
287 Ga0439458_0051408 3300042157 Bacteria 1017
288 Ga0451577_0000002 3300042876 Bacteria 1731375
289 Ga0451577_1279088 3300042876 Unclassified 653
290 Ga0466986_0035085 3300044650 Bacteria 3427
291 Ga0466986_0132431 3300044650 Bacteria 1697
292 Ga0466969_0052369 3300044656 Bacteria 2005
293 Ga0466969_0070884 3300044656 Bacteria 1676
294 Ga0466969_0279018 3300044656 Bacteria 757
295 Ga0466969_0330735 3300044656 Bacteria 689
296 Ga0466972_0000525 3300044658 Bacteria 18965
297 Ga0466972_0014565 3300044658 Bacteria 3938
298 Ga0466972_0204027 3300044658 Unclassified 926
299 Ga0466977_0538646 3300044666 Bacteria 635
300 Ga0466978_0040083 3300044671 Bacteria 2896
301 Ga0466982_0020349 3300044672 Bacteria 3768
302 Ga0453683_0000003 3300044673 Bacteria 942572
303 Ga0466965_0027509 3300044683 Bacteria 2761
304 Ga0466965_0195448 3300044683 Bacteria 1071
305 Ga0466965_0350948 3300044683 Bacteria 808
306 Ga0466965_0854512 3300044683 Unclassified 529
307 Ga0466966_0001454 3300044684 Bacteria 15231
308 Ga0466966_0036383 3300044684 Bacteria 3178
309 Ga0466966_0100654 3300044684 Bacteria 1787
310 Ga0466966_0101727 3300044684 Bacteria 1777
311 Ga0466966_0379324 3300044684 Bacteria 849
312 Ga0466966_0455114 3300044684 Bacteria 769
313 Ga0466961_0000200 3300044693 Bacteria 40374
314 Ga0466961_0118319 3300044693 Bacteria 1664
315 Ga0466961_0186266 3300044693 Bacteria 1288
316 Ga0466961_0195249 3300044693 Bacteria 1253
317 Ga0466961_0727271 3300044693 Unclassified 594
318 Ga0466963_0049837 3300044694 Bacteria 2770
319 Ga0466963_0300161 3300044694 Bacteria 1130
320 Ga0466963_1172793 3300044694 Bacteria 540
321 Ga0466964_0001591 3300044706 Bacteria 7817
322 Ga0453684_0000002 3300044712 Bacteria 1731375
323 Ga0453684_0000077 3300044712 Bacteria 435536
324 Ga0453684_0001440 3300044712 Bacteria 67958
325 Ga0466971_0007071 3300044719 Bacteria 4885
326 Ga0466971_0137877 3300044719 Bacteria 1135
327 Ga0466971_0304906 3300044719 Bacteria 765
328 Ga0466968_0110146 3300044735 Bacteria 1237
329 Ga0466970_0001088 3300044765 Bacteria 13183
330 Ga0466970_0327377 3300044765 Unclassified 867
331 Ga0466970_0567180 3300044765 Bacteria 657
332 Ga0466957_0016078 3300044842 Bacteria 4374
333 Ga0466957_0041940 3300044842 Bacteria 2767
334 Ga0466957_0425080 3300044842 Bacteria 912
335 Ga0466957_1118551 3300044842 Bacteria 568
336 Ga0466960_0032649 3300044901 Bacteria 2412
337 Ga0466960_1025507 3300044901 Unclassified 508
338 Ga0466959_0000415 3300045049 Bacteria 24900
339 Ga0466959_0021535 3300045049 Bacteria 4755
340 Ga0466959_0432286 3300045049 Bacteria 893
341 Ga0466959_0450501 3300045049 Bacteria 872
342 Ga0466959_0774644 3300045049 Bacteria 642
343 Ga0451576_0001215 3300045051 Bacteria 45894
344 Ga0451576_2434180 3300045051 Bacteria 535
345 Ga0451576_2522695 3300045051 Unclassified 525
346 Ga0466958_0051708 3300045836 Bacteria 2488
347 Ga0466958_0086822 3300045836 Bacteria 1931
348 Ga0466958_0810564 3300045836 Unclassified 610
349 Ga0466958_1068715 3300045836 Unclassified 527
350 Ga0466967_0016641 3300045976 Bacteria 5807
351 Ga0466967_0262517 3300045976 Bacteria 1652
352 Ga0466967_1093562 3300045976 Bacteria 794
353 Ga0495617_002536 3300046452 Bacteria 7212
354 Ga0495603_0062002 3300046455 Bacteria 2208
355 Ga0495629_0001542 3300046459 Bacteria 18094
356 Ga0495638_0006093 3300046460 Bacteria 8828
357 Ga0495651_0012482 3300046462 Bacteria 6552
358 Ga0495651_0780848 3300046462 Bacteria 590
359 Ga0495650_0000319 3300046471 Bacteria 86032
360 Ga0495650_0039410 3300046471 Bacteria 2039
361 Ga0495650_0042257 3300046471 Bacteria 1942
362 Ga0495650_0239395 3300046471 Bacteria 620
363 Ga0495605_0007310 3300046474 Bacteria 6274
364 Ga0495605_0291379 3300046474 Bacteria 692
365 Ga0495584_0007943 3300046491 Bacteria 5517
366 Ga0495584_0024433 3300046491 Bacteria 3065
367 Ga0495584_0056337 3300046491 Bacteria 1978
368 Ga0495584_0089209 3300046491 Unclassified 1555
369 Ga0495585_0008776 3300046492 Bacteria 6108
370 Ga0495585_0009930 3300046492 Bacteria 5686
371 Ga0495594_0045491 3300046499 Bacteria 2409
372 Ga0495596_0016190 3300046500 Bacteria 3102
373 Ga0495607_0026334 3300046501 Bacteria 3608
374 Ga0495583_0001554 3300046506 Bacteria 22730
375 Ga0495583_0017907 3300046506 Bacteria 3747
376 Ga0495583_0369938 3300046506 Bacteria 564
377 Ga0495583_0371988 3300046506 Bacteria 563
378 Ga0495606_0000070 3300046507 Bacteria 177343
379 Ga0495606_0026978 3300046507 Bacteria 4080
380 Ga0495606_0147467 3300046507 Bacteria 1384
381 Ga0495610_0099714 3300046512 Bacteria 1303
382 Ga0495628_0000214 3300046516 Bacteria 50431
383 Ga0495628_0003096 3300046516 Bacteria 14909
384 Ga0495631_0008415 3300046518 Bacteria 5200
385 Ga0495631_0038943 3300046518 Bacteria 2111
386 Ga0495631_0055638 3300046518 Bacteria 1724
387 Ga0495632_0090643 3300046519 Bacteria 1450
388 Ga0495643_0068068 3300046522 Bacteria 1874
389 Ga0495644_0161464 3300046523 Bacteria 859
390 Ga0495666_0252753 3300046526 Bacteria 803
391 Ga0495642_0106933 3300046528 Bacteria 1194
392 Ga0495642_0120324 3300046528 Bacteria 1126
393 Ga0495642_0195326 3300046528 Unclassified 882
394 Ga0495652_0078476 3300046529 Bacteria 2733
395 Ga0495652_0360170 3300046529 Bacteria 1039
396 Ga0495654_0201605 3300046530 Bacteria 851
397 Ga0495586_0445556 3300046535 Bacteria 746
398 Ga0495609_0020470 3300046538 Bacteria 3058
399 Ga0495609_0055399 3300046538 Bacteria 1759
400 Ga0495597_0013284 3300046542 Bacteria 3950
401 Ga0495597_0078691 3300046542 Bacteria 1412
402 Ga0495597_0128829 3300046542 Bacteria 1050
403 Ga0495622_0000130 3300046557 Bacteria 65123
404 Ga0495622_0073679 3300046557 Bacteria 1575
405 Ga0495633_0009805 3300046558 Bacteria 5264
406 Ga0495633_0104408 3300046558 Bacteria 1315
407 Ga0495633_0174480 3300046558 Bacteria 990
408 Ga0495667_0438124 3300046559 Unclassified 822
409 Ga0495668_0020680 3300046616 Bacteria 3783
410 Ga0495668_0262260 3300046616 Bacteria 946
411 Ga0495668_0263606 3300046616 Bacteria 943
412 Ga0495668_0448210 3300046616 Bacteria 710
413 Ga0495625_0740354 3300046660 Bacteria 577
414 Ga0495635_0075144 3300046663 Bacteria 2315
415 Ga0495661_0003080 3300046665 Bacteria 12539
416 Ga0495661_0029100 3300046665 Bacteria 3529
417 Ga0495661_0039611 3300046665 Bacteria 2927
418 Ga0495661_0081270 3300046665 Bacteria 1868
419 Ga0495661_0110697 3300046665 Bacteria 1531
420 Ga0495661_0161181 3300046665 Bacteria 1204
421 Ga0495661_0200824 3300046665 Bacteria 1044
422 Ga0495588_0075157 3300046674 Bacteria 1760
423 Ga0495588_0130709 3300046674 Bacteria 1324
424 Ga0495623_0029070 3300046679 Bacteria 3558
425 Ga0495669_0007914 3300046684 Bacteria 4464
426 Ga0495624_0066566 3300046690 Bacteria 2249
427 Ga0495624_0341158 3300046690 Unclassified 901
428 Ga0495670_0002993 3300046691 Bacteria 8332
429 Ga0495670_0009425 3300046691 Bacteria 4799
430 Ga0495671_0270167 3300046692 Bacteria 820
431 Ga0495671_0302318 3300046692 Bacteria 769
432 Ga0495649_0230538 3300046694 Bacteria 956
433 Ga0495589_0174117 3300046794 Bacteria 1022
434 Ga0495660_0012227 3300046810 Bacteria 4982
435 Ga0495581_0210951 3300047315 Bacteria 1135
436 Ga0495604_0045382 3300047317 Bacteria 3430
437 Ga0495674_0012343 3300047319 Bacteria 8047
438 Ga0495674_0021280 3300047319 Bacteria 6000
439 Ga0495674_0087929 3300047319 Bacteria 2658
440 Ga0495672_0004866 3300047320 Bacteria 10805
441 Ga0495683_0043528 3300047323 Bacteria 2260
442 Ga0495687_046086 3300047443 Bacteria 1884
443 Ga0495687_126340 3300047443 Bacteria 913
444 Ga0495677_0232483 3300047445 Bacteria 719
445 Ga0495677_0244672 3300047445 Bacteria 701
446 Ga0495673_0036297 3300047469 Bacteria 2263
447 Ga0495681_0008321 3300047470 Bacteria 6515
448 Ga0495686_0000044 3300047472 Bacteria 288079
449 Ga0495686_0095131 3300047472 Bacteria 1804
450 Ga0495593_0096522 3300047673 Bacteria 1519
451 Ga0495602_0183668 3300048088 Bacteria 1610
452 Ga0495602_0639680 3300048088 Bacteria 727
453 Ga0495602_0684501 3300048088 Archaea 697
454 Ga0495615_0135107 3300048090 Bacteria 724
455 Ga0495626_0001165 3300048091 Bacteria 21902
456 Ga0495626_0031716 3300048091 Bacteria 2541
457 Ga0496100_0042332 3300048903 Bacteria 2909
458 Ga0496100_1495471 3300048903 Unclassified 533
459 Ga0496100_1551160 3300048903 Bacteria 523
460 Ga0496101_0033584 3300048904 Bacteria 3619
461 Ga0496102_0343506 3300048905 Bacteria 1405
462 Ga0496102_0446447 3300048905 Bacteria 1213
463 Ga0496102_1126488 3300048905 Bacteria 704
464 Ga0496103_0107900 3300048906 Bacteria 1766
465 Ga0496103_0195417 3300048906 Bacteria 1301
466 Ga0496103_0389194 3300048906 Bacteria 896
467 Ga0496104_0826231 3300048907 Bacteria 832
468 Ga0496104_1313029 3300048907 Bacteria 627
469 Ga0496105_0100253 3300048908 Bacteria 2392
470 Ga0496105_0243478 3300048908 Bacteria 1459
471 Ga0496106_0857543 3300048909 Bacteria 719
472 Ga0496108_0074217 3300048911 Bacteria 2872
473 Ga0496109_0407673 3300048912 Bacteria 1284
474 Ga0496109_1044373 3300048912 Unclassified 754
475 Ga0496110_0135222 3300048913 Bacteria 2227
476 Ga0496111_0428571 3300048914 Bacteria 977
477 Ga0496111_0939595 3300048914 Bacteria 621
478 Ga0496114_0148367 3300048917 Bacteria 2034
479 Ga0496115_0127716 3300048918 Bacteria 2095
480 Ga0496115_0180998 3300048918 Bacteria 1742
481 Ga0496116_0120696 3300048919 Bacteria 1518
482 Ga0496117_0173220 3300048920 Bacteria 1250
483 Ga0496118_0000378 3300048921 Bacteria 74801
484 Ga0496118_0225440 3300048921 Bacteria 1086
485 Ga0496118_0461529 3300048921 Bacteria 642
486 Ga0496118_0641646 3300048921 Bacteria 501
487 Ga0496121_0539371 3300048924 Bacteria 732
488 Ga0496122_0000018 3300048925 Bacteria 426350
489 Ga0496122_0121679 3300048925 Bacteria 1681
490 Ga0496123_0000015 3300048926 Bacteria 426088
491 Ga0496123_0020681 3300048926 Bacteria 5141
492 Ga0496124_0100832 3300048927 Bacteria 2340
493 Ga0496125_0002112 3300048928 Bacteria 26704
494 Ga0496125_0007190 3300048928 Bacteria 11870
495 Ga0496125_0017207 3300048928 Bacteria 6909
496 Ga0496126_0004109 3300048929 Bacteria 17613
497 Ga0495678_001831 3300049459 Bacteria 15626
498 Ga0495678_071359 3300049459 Bacteria 1272
499 Ga0501067_0009870 3300049583 Bacteria 5286
500 nmdc:mga0yw44_418407_c1 3300050492 Bacteria 907
501 nmdc:mga0k408_2819_c2 3300050493 Bacteria 8839
502 nmdc:mga0k408_290135_c1 3300050493 Bacteria 976
503 nmdc:mga0k408_44306_c1 3300050493 Bacteria 2565
504 Ga0500618_000096 3300053125 Bacteria 72003
505 Ga0500618_007664 3300053125 Bacteria 3062
506 Ga0500618_009766 3300053125 Bacteria 2606
507 Ga0500622_0064505 3300053156 Bacteria 1863
508 Ga0500624_012022 3300053157 Bacteria 1273
509 Ga0500633_0276124 3300053160 Bacteria 622
510 Ga0500645_011016 3300053730 Bacteria 2968
511 Ga0500645_043691 3300053730 Bacteria 1319
512 Ga0466962_0043183 3300061719 Bacteria 2157
513 Ga0466962_0406816 3300061719 Unclassified 682

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048090 Ga0495615_0135107 Ga0495615_0135107_25_441 123
2 3300045836 Ga0466958_0810564 Ga0466958_0810564_219_599 126
3 iso_pu_bacteria 2501025504 2501414402 134
4 iso_pu_bacteria 2510917014 2511099654 134
5 iso_pu_bacteria 2510917015 2511106829 134
6 iso_pu_bacteria 2511231002 2511243646 134
7 iso_pu_bacteria 2513237166 2514050800 134
8 iso_pu_bacteria 2515154189 2516022953 134
9 iso_pu_bacteria 2596583598 2597028048 134
10 iso_pu_bacteria 2599185178 2599444722 134
11 iso_pu_bacteria 2721755763 2723875782 134
12 iso_pu_bacteria 2791355137 2792833653 134
13 iso_pu_bacteria 2818991461 2819685880 134
14 iso_pu_bacteria 2838736955 2838739686 134
15 iso_pu_bacteria 2841840854 2841844190 134
16 iso_pu_bacteria 2842140634 2842143911 134
17 iso_pu_bacteria 2842324504 2842332619 134
18 iso_pu_bacteria 2842348783 2842355950 134
19 iso_pu_bacteria 2842454564 2842460994 134
20 iso_pu_bacteria 2854916844 2854918821 134
21 iso_pu_bacteria 2883087390 2883091492 134
22 iso_pu_bacteria 2900577576 2900578196 134
23 iso_pu_bacteria 2900577576 2900578399 134
24 iso_pu_bacteria 2904615490 2904618568 134
25 iso_pu_bacteria 2928058823 2928059858 134
26 iso_pu_bacteria 8054460903 8054461066 134
27 3300001915 JGI24741J21665_1004919 JGI24741J21665_10049195 138
28 3300001979 JGI24740J21852_10000068 JGI24740J21852_1000006834 138
29 3300001979 JGI24740J21852_10000165 JGI24740J21852_1000016521 138
30 3300001979 JGI24740J21852_10001559 JGI24740J21852_100015598 138
31 3300002067 JGI24735J21928_10032090 JGI24735J21928_100320902 138
32 3300002705 JGI25156J39149_1018613 JGI25156J39149_10186132 138
33 3300002705 JGI25156J39149_1019183 JGI25156J39149_10191832 138
34 3300002705 JGI25156J39149_1035552 JGI25156J39149_10355521 138
35 3300002737 JGI25162J39368_1000079 JGI25162J39368_100007977 138
36 3300002771 JGI25163J39215_1005496 JGI25163J39215_10054962 138
37 3300002774 JGI25150J39212_1004070 JGI25150J39212_10040702 138
38 3300002774 JGI25150J39212_1006550 JGI25150J39212_10065504 138
39 3300002987 JGI25159J45721_1000295 JGI25159J45721_100029518 138
40 3300003187 JGI25151J46595_10005589 JGI25151J46595_100055894 138
41 3300003187 JGI25151J46595_10006626 JGI25151J46595_100066267 138
42 3300003214 JGI25165J46597_1000135 JGI25165J46597_100013583 138
43 3300003320 rootH2_10229482 rootH2_102294822 138
44 3300003323 rootH1_10324460 rootH1_103244603 138
45 3300003354 JGI25160J50197_1000223 JGI25160J50197_100022318 138
46 3300003374 JGI25161J50226_1000013 JGI25161J50226_1000013145 138
47 3300003578 Ga0006562J51391_1196130 Ga0006562J51391_11961302 138
48 3300003751 Ga0055538_1000055 Ga0055538_100005583 138
49 3300003751 Ga0055538_1001015 Ga0055538_10010151 138
50 3300003751 Ga0055538_1001935 Ga0055538_10019352 138
51 3300003751 Ga0055538_1003845 Ga0055538_10038452 138
52 3300003751 Ga0055538_1004025 Ga0055538_10040252 138
53 3300003752 Ga0055539_1000080 Ga0055539_100008021 138
54 3300003752 Ga0055539_1000081 Ga0055539_10000811 138
55 3300003752 Ga0055539_1000201 Ga0055539_100020126 138
56 3300003756 Ga0055533_1000086 Ga0055533_100008621 138
57 3300003756 Ga0055533_1004854 Ga0055533_10048542 138
58 3300003756 Ga0055533_1007168 Ga0055533_10071682 138
59 3300003756 Ga0055533_1007546 Ga0055533_10075462 138
60 3300003756 Ga0055533_1008633 Ga0055533_10086332 138
61 3300003758 Ga0055532_1000048 Ga0055532_1000048134 138
62 3300003758 Ga0055532_1000073 Ga0055532_100007311 138
63 3300003759 Ga0055525_1000114 Ga0055525_100011483 138
64 3300003759 Ga0055525_1000640 Ga0055525_100064014 138
65 3300003759 Ga0055525_1000820 Ga0055525_10008203 138
66 3300003760 Ga0055527_1001283 Ga0055527_10012837 138
67 3300003760 Ga0055527_1001715 Ga0055527_10017156 138
68 3300003761 Ga0055535_1000035 Ga0055535_1000035134 138
69 3300003761 Ga0055535_1000055 Ga0055535_100005511 138
70 3300003763 Ga0055529_1000101 Ga0055529_100010136 138
71 3300003763 Ga0055529_1000877 Ga0055529_100087717 138
72 3300003771 Ga0055526_1037248 Ga0055526_10372481 138
73 3300003773 Ga0055537_1011474 Ga0055537_10114743 138
74 3300003784 Ga0055534_1030703 Ga0055534_10307031 138
75 3300003791 Ga0055530_10012725 Ga0055530_100127253 138
76 3300003841 Ga0055541_1000057 Ga0055541_100005721 138
77 3300003841 Ga0055541_1000601 Ga0055541_10006012 138
78 3300003841 Ga0055541_1005563 Ga0055541_10055632 138
79 3300003841 Ga0055541_1009153 Ga0055541_10091532 138
80 3300003841 Ga0055541_1011830 Ga0055541_10118302 138
81 3300004625 Ga0055543_1000211 Ga0055543_100021131 138
82 3300005329 Ga0070683_100638034 Ga0070683_1006380341 138
83 3300005335 Ga0070666_10137808 Ga0070666_101378082 138
84 3300005337 Ga0070682_100076290 Ga0070682_1000762904 138
85 3300005337 Ga0070682_101165173 Ga0070682_1011651731 138
86 3300005343 Ga0070687_100042021 Ga0070687_1000420212 138
87 3300005344 Ga0070661_100000061 Ga0070661_10000006162 138
88 3300005344 Ga0070661_100000093 Ga0070661_10000009375 138
89 3300005344 Ga0070661_100176890 Ga0070661_1001768901 138
90 3300005344 Ga0070661_100214892 Ga0070661_1002148922 138
91 3300005354 Ga0070675_100934448 Ga0070675_1009344482 138
92 3300005355 Ga0070671_100153176 Ga0070671_1001531764 138
93 3300005356 Ga0070674_100660726 Ga0070674_1006607261 138
94 3300005366 Ga0070659_100740194 Ga0070659_1007401941 138
95 3300005367 Ga0070667_101043425 Ga0070667_1010434252 138
96 3300005436 Ga0070713_100098224 Ga0070713_1000982246 138
97 3300005436 Ga0070713_100503711 Ga0070713_1005037112 138
98 3300005455 Ga0070663_100000009 Ga0070663_10000000940 138
99 3300005455 Ga0070663_100000024 Ga0070663_1000000241 138
100 3300005455 Ga0070663_100147335 Ga0070663_1001473353 138
101 3300005455 Ga0070663_100247361 Ga0070663_1002473612 138
102 3300005457 Ga0070662_100620969 Ga0070662_1006209691 138
103 3300005459 Ga0068867_101446660 Ga0068867_1014466602 138
104 3300005563 Ga0068855_100460112 Ga0068855_1004601122 138
105 3300005564 Ga0070664_100000010 Ga0070664_10000001034 138
106 3300005564 Ga0070664_100000022 Ga0070664_1000000221 138
107 3300005564 Ga0070664_100106292 Ga0070664_1001062924 138
108 3300005564 Ga0070664_100163160 Ga0070664_1001631601 138
109 3300005577 Ga0068857_100011536 Ga0068857_10001153610 138
110 3300005577 Ga0068857_100039179 Ga0068857_1000391792 138
111 3300005577 Ga0068857_100833646 Ga0068857_1008336462 138
112 3300005578 Ga0068854_100000077 Ga0068854_10000007757 138
113 3300005578 Ga0068854_100000088 Ga0068854_10000008867 138
114 3300005578 Ga0068854_101788471 Ga0068854_1017884711 138
115 3300005614 Ga0068856_100000049 Ga0068856_1000000491 138
116 3300005614 Ga0068856_100000069 Ga0068856_10000006910 138
117 3300005616 Ga0068852_100091229 Ga0068852_1000912292 138
118 3300005616 Ga0068852_100505022 Ga0068852_1005050222 138
119 3300005841 Ga0068863_102396890 Ga0068863_1023968901 138
120 3300005937 Ga0081455_10311175 Ga0081455_103111752 138
121 3300006028 Ga0070717_10039890 Ga0070717_100398904 138
122 3300006048 Ga0075363_100036886 Ga0075363_1000368863 138
123 3300006051 Ga0075364_10010177 Ga0075364_100101776 138
124 3300006173 Ga0070716_100316109 Ga0070716_1003161092 138
125 3300006195 Ga0075366_10003812 Ga0075366_100038125 138
126 3300006195 Ga0075366_10183672 Ga0075366_101836722 138
127 3300006195 Ga0075366_10274515 Ga0075366_102745152 138
128 3300006358 Ga0068871_100112759 Ga0068871_1001127592 138
129 3300006358 Ga0068871_102129948 Ga0068871_1021299481 138
130 3300006946 Ga0079104_1000033 Ga0079104_100003313 138
131 3300009036 Ga0105244_10170616 Ga0105244_101706162 138
132 3300009092 Ga0105250_10184252 Ga0105250_101842521 138
133 3300009093 Ga0105240_10059453 Ga0105240_100594534 138
134 3300009093 Ga0105240_10151469 Ga0105240_101514693 138
135 3300009093 Ga0105240_10158069 Ga0105240_101580692 138
136 3300009093 Ga0105240_10392540 Ga0105240_103925402 138
137 3300009093 Ga0105240_10496802 Ga0105240_104968022 138
138 3300009098 Ga0105245_10333101 Ga0105245_103331012 138
139 3300009101 Ga0105247_10173988 Ga0105247_101739882 138
140 3300009174 Ga0105241_10405089 Ga0105241_104050891 138
141 3300009174 Ga0105241_10767865 Ga0105241_107678652 138
142 3300009177 Ga0105248_10025385 Ga0105248_100253855 138
143 3300011119 Ga0105246_10107305 Ga0105246_101073052 138
144 3300013100 Ga0157373_10070355 Ga0157373_100703552 138
145 3300013100 Ga0157373_10166796 Ga0157373_101667962 138
146 3300013102 Ga0157371_10000088 Ga0157371_10000088113 138
147 3300013102 Ga0157371_10000089 Ga0157371_100000891 138
148 3300013102 Ga0157371_10054674 Ga0157371_100546742 138
149 3300013104 Ga0157370_10000002 Ga0157370_10000002252 138
150 3300013104 Ga0157370_10000041 Ga0157370_10000041113 138
151 3300013104 Ga0157370_11254720 Ga0157370_112547201 138
152 3300013105 Ga0157369_10000138 Ga0157369_1000013831 138
153 3300013105 Ga0157369_10000233 Ga0157369_1000023321 138
154 3300013105 Ga0157369_10003845 Ga0157369_100038457 138
155 3300013105 Ga0157369_10004358 Ga0157369_1000435810 138
156 3300013105 Ga0157369_10100340 Ga0157369_101003405 138
157 3300013105 Ga0157369_10348990 Ga0157369_103489902 138
158 3300013296 Ga0157374_10999331 Ga0157374_109993312 138
159 3300013297 Ga0157378_10879906 Ga0157378_108799061 138
160 3300013306 Ga0163162_10011368 Ga0163162_100113686 138
161 3300013307 Ga0157372_10000363 Ga0157372_100003631 138
162 3300013308 Ga0157375_10020561 Ga0157375_100205611 138
163 3300015261 Ga0182006_1000917 Ga0182006_100091712 138
164 3300015261 Ga0182006_1005883 Ga0182006_10058835 138
165 3300015262 Ga0182007_10018289 Ga0182007_100182892 138
166 3300015265 Ga0182005_1065890 Ga0182005_10658902 138
167 3300017792 Ga0163161_10286938 Ga0163161_102869382 138
168 3300020077 Ga0206351_10441816 Ga0206351_104418162 138
169 3300020081 Ga0206354_11129042 Ga0206354_111290424 138
170 3300020082 Ga0206353_11265201 Ga0206353_112652012 138
171 3300020610 Ga0154015_1281252 Ga0154015_12812527 138
172 3300020610 Ga0154015_1319505 Ga0154015_13195052 138
173 3300025207 Ga0209760_100874 Ga0209760_1008743 138
174 3300025208 Ga0209436_105523 Ga0209436_1055233 138
175 3300025224 Ga0209784_100008 Ga0209784_100008214 138
176 3300025224 Ga0209784_100010 Ga0209784_10001088 138
177 3300025224 Ga0209784_100024 Ga0209784_100024226 138
178 3300025224 Ga0209784_102577 Ga0209784_1025772 138
179 3300025225 Ga0209566_100006 Ga0209566_100006214 138
180 3300025225 Ga0209566_100008 Ga0209566_10000888 138
181 3300025225 Ga0209566_100018 Ga0209566_100018226 138
182 3300025225 Ga0209566_100582 Ga0209566_10058212 138
183 3300025225 Ga0209566_100612 Ga0209566_10061211 138
184 3300025226 Ga0209674_100019 Ga0209674_10001988 138
185 3300025226 Ga0209674_100045 Ga0209674_10004597 138
186 3300025226 Ga0209674_100046 Ga0209674_100046137 138
187 3300025226 Ga0209674_100870 Ga0209674_1008707 138
188 3300025226 Ga0209674_103063 Ga0209674_1030633 138
189 3300025226 Ga0209674_106797 Ga0209674_1067973 138
190 3300025228 Ga0209672_100127 Ga0209672_10012745 138
191 3300025228 Ga0209672_100650 Ga0209672_10065020 138
192 3300025229 Ga0209147_100005 Ga0209147_100005208 138
193 3300025229 Ga0209147_100008 Ga0209147_100008152 138
194 3300025230 Ga0209563_100016 Ga0209563_100016214 138
195 3300025230 Ga0209563_100021 Ga0209563_10002188 138
196 3300025230 Ga0209563_100039 Ga0209563_100039137 138
197 3300025230 Ga0209563_100090 Ga0209563_100090102 138
198 3300025230 Ga0209563_102848 Ga0209563_1028482 138
199 3300025230 Ga0209563_105007 Ga0209563_1050072 138
200 3300025230 Ga0209563_105643 Ga0209563_1056432 138
201 3300025231 Ga0207427_102464 Ga0207427_1024643 138
202 3300025233 Ga0209437_100019 Ga0209437_10001988 138
203 3300025242 Ga0209258_100007 Ga0209258_100007208 138
204 3300025242 Ga0209258_100013 Ga0209258_100013152 138
205 3300025245 Ga0207425_1002014 Ga0207425_10020147 138
206 3300025250 Ga0209026_1035270 Ga0209026_10352702 138
207 3300025253 Ga0209677_100008 Ga0209677_100008478 138
208 3300025253 Ga0209677_100011 Ga0209677_10001188 138
209 3300025253 Ga0209677_100024 Ga0209677_100024135 138
210 3300025254 Ga0209148_1001888 Ga0209148_10018882 138
211 3300025254 Ga0209148_1002127 Ga0209148_10021277 138
212 3300025256 Ga0209759_1002288 Ga0209759_100228813 138
213 3300025256 Ga0209759_1004083 Ga0209759_10040835 138
214 3300025256 Ga0209759_1005154 Ga0209759_10051543 138
215 3300025256 Ga0209759_1018784 Ga0209759_10187842 138
216 3300025256 Ga0209759_1029053 Ga0209759_10290531 138
217 3300025258 Ga0209129_1004929 Ga0209129_10049293 138
218 3300025261 Ga0209233_1000025 Ga0209233_100002588 138
219 3300025263 Ga0209565_1000768 Ga0209565_100076814 138
220 3300025272 Ga0209455_1000011 Ga0209455_1000011133 138
221 3300025272 Ga0209455_1000042 Ga0209455_1000042152 138
222 3300025284 Ga0209130_1000064 Ga0209130_1000064137 138
223 3300025291 Ga0209675_1004319 Ga0209675_10043198 138
224 3300025292 Ga0209676_1001583 Ga0209676_100158316 138
225 3300025294 Ga0209025_1003115 Ga0209025_100311512 138
226 3300025295 Ga0209564_1006428 Ga0209564_10064286 138
227 3300025297 Ga0209758_1013860 Ga0209758_10138605 138
228 3300025297 Ga0209758_1041073 Ga0209758_10410733 138
229 3300025298 Ga0209050_1005684 Ga0209050_10056847 138
230 3300025299 Ga0209256_1026726 Ga0209256_10267262 138
231 3300025302 Ga0207426_1000116 Ga0207426_1000116114 138
232 3300025303 Ga0209051_1096316 Ga0209051_10963161 138
233 3300025304 Ga0209257_1018538 Ga0209257_10185384 138
234 3300025900 Ga0207710_10295499 Ga0207710_102954992 138
235 3300025903 Ga0207680_10084147 Ga0207680_100841472 138
236 3300025911 Ga0207654_10591546 Ga0207654_105915461 138
237 3300025913 Ga0207695_10000739 Ga0207695_1000073949 138
238 3300025913 Ga0207695_10005647 Ga0207695_1000564716 138
239 3300025913 Ga0207695_10193665 Ga0207695_101936652 138
240 3300025913 Ga0207695_10626388 Ga0207695_106263881 138
241 3300025916 Ga0207663_11350797 Ga0207663_113507971 138
242 3300025918 Ga0207662_10066541 Ga0207662_100665412 138
243 3300025920 Ga0207649_10000588 Ga0207649_100005881 138
244 3300025920 Ga0207649_10001707 Ga0207649_100017078 138
245 3300025928 Ga0207700_10802136 Ga0207700_108021362 138
246 3300025932 Ga0207690_10026235 Ga0207690_100262353 138
247 3300025932 Ga0207690_10988618 Ga0207690_109886181 138
248 3300025939 Ga0207665_10205609 Ga0207665_102056092 138
249 3300025941 Ga0207711_10033590 Ga0207711_100335905 138
250 3300025945 Ga0207679_10000002 Ga0207679_10000002505 138
251 3300025945 Ga0207679_10000004 Ga0207679_10000004411 138
252 3300025945 Ga0207679_10542975 Ga0207679_105429751 138
253 3300025949 Ga0207667_10005394 Ga0207667_1000539414 138
254 3300025981 Ga0207640_10000058 Ga0207640_1000005830 138
255 3300025981 Ga0207640_10000358 Ga0207640_100003582 138
256 3300025986 Ga0207658_11008787 Ga0207658_110087872 138
257 3300026067 Ga0207678_10000012 Ga0207678_100000121 138
258 3300026067 Ga0207678_10000018 Ga0207678_10000018110 138
259 3300026067 Ga0207678_10061760 Ga0207678_100617603 138
260 3300026067 Ga0207678_10433218 Ga0207678_104332182 138
261 3300026075 Ga0207708_10427258 Ga0207708_104272582 138
262 3300026078 Ga0207702_10000020 Ga0207702_1000002054 138
263 3300026078 Ga0207702_10000053 Ga0207702_1000005348 138
264 3300026088 Ga0207641_11512818 Ga0207641_115128182 138
265 3300026089 Ga0207648_10341686 Ga0207648_103416863 138
266 3300026116 Ga0207674_10001653 Ga0207674_1000165324 138
267 3300026116 Ga0207674_10021641 Ga0207674_100216414 138
268 3300026116 Ga0207674_11528258 Ga0207674_115282581 138
269 3300026121 Ga0207683_10137905 Ga0207683_101379052 138
270 3300026142 Ga0207698_10384078 Ga0207698_103840782 138
271 3300026142 Ga0207698_10602226 Ga0207698_106022262 138
272 3300026142 Ga0207698_10797583 Ga0207698_107975832 138
273 3300026142 Ga0207698_12695378 Ga0207698_126953781 138
274 3300027111 Ga0209281_1000043 Ga0209281_1000043151 138
275 3300028786 Ga0307517_10321612 Ga0307517_103216122 138
276 3300028800 Ga0265338_10000092 Ga0265338_1000009253 138
277 3300030742 Ga0316183_1116527 Ga0316183_11165271 138
278 3300030744 Ga0316181_1137718 Ga0316181_11377181 138
279 3300031456 Ga0307513_10000316 Ga0307513_1000031648 138
280 3300031548 Ga0307408_100035846 Ga0307408_1000358462 138
281 3300031616 Ga0307508_10022414 Ga0307508_100224142 138
282 3300031730 Ga0307516_10001925 Ga0307516_1000192519 138
283 3300031730 Ga0307516_10061874 Ga0307516_100618743 138
284 3300031731 Ga0307405_10188848 Ga0307405_101888482 138
285 3300031911 Ga0307412_11485752 Ga0307412_114857521 138
286 3300031995 Ga0307409_100323670 Ga0307409_1003236703 138
287 3300032005 Ga0307411_11247640 Ga0307411_112476401 138
288 3300032005 Ga0307411_11707039 Ga0307411_117070391 138
289 3300033179 Ga0307507_10201025 Ga0307507_102010252 138
290 3300035089 Ga0373944_0046347 Ga0373944_0046347_42_470 138
291 3300037312 Ga0395899_0578009 Ga0395899_0578009_12_428 138
292 3300037312 Ga0395899_0764734 Ga0395899_0764734_41_460 138
293 3300037418 Ga0395900_0001682 Ga0395900_0001682_13437_13856 138
294 3300037418 Ga0395900_0004085 Ga0395900_0004085_9162_9578 138
295 3300037418 Ga0395900_0332884 Ga0395900_0332884_442_858 138
296 3300037418 Ga0395900_0436436 Ga0395900_0436436_98_517 138
297 3300037418 Ga0395900_0636590 Ga0395900_0636590_47_463 138
298 3300037466 Ga0395898_0006835 Ga0395898_0006835_5354_5770 138
299 3300037466 Ga0395898_0109504 Ga0395898_0109504_1448_1864 138
300 3300037466 Ga0395898_0342169 Ga0395898_0342169_264_680 138
301 3300037466 Ga0395898_0767300 Ga0395898_0767300_407_826 138
302 3300037471 Ga0395905_0000017 Ga0395905_0000017_351794_352210 138
303 3300037471 Ga0395905_0407210 Ga0395905_0407210_114_530 138
304 3300038443 Ga0395901_0000003 Ga0395901_0000003_312432_312848 138
305 3300038443 Ga0395901_0000576 Ga0395901_0000576_1712_2128 138
306 3300038443 Ga0395901_0296622 Ga0395901_0296622_619_1035 138
307 3300038443 Ga0395901_0403792 Ga0395901_0403792_86_502 138
308 3300038443 Ga0395901_0528219 Ga0395901_0528219_549_965 138
309 3300038443 Ga0395901_1236963 Ga0395901_1236963_92_508 138
310 3300041451 Ga0451791_1272617 Ga0451791_1272617_656_1072 138
311 3300041512 Ga0451853_3666298 Ga0451853_3666298_136_552 138
312 3300042005 Ga0439448_0004132 Ga0439448_0004132_29_445 138
313 3300042157 Ga0439458_0051408 Ga0439458_0051408_572_988 138
314 3300042876 Ga0451577_0000002 Ga0451577_0000002_6522_6938 138
315 3300042876 Ga0451577_1279088 Ga0451577_1279088_17_433 138
316 3300044650 Ga0466986_0035085 Ga0466986_0035085_2736_3152 138
317 3300044650 Ga0466986_0132431 Ga0466986_0132431_727_1146 138
318 3300044656 Ga0466969_0052369 Ga0466969_0052369_283_699 138
319 3300044656 Ga0466969_0070884 Ga0466969_0070884_1053_1472 138
320 3300044656 Ga0466969_0279018 Ga0466969_0279018_301_717 138
321 3300044656 Ga0466969_0330735 Ga0466969_0330735_87_515 138
322 3300044658 Ga0466972_0000525 Ga0466972_0000525_15360_15779 138
323 3300044658 Ga0466972_0014565 Ga0466972_0014565_3401_3817 138
324 3300044658 Ga0466972_0204027 Ga0466972_0204027_69_485 138
325 3300044666 Ga0466977_0538646 Ga0466977_0538646_205_624 138
326 3300044671 Ga0466978_0040083 Ga0466978_0040083_178_597 138
327 3300044672 Ga0466982_0020349 Ga0466982_0020349_2889_3308 138
328 3300044673 Ga0453683_0000003 Ga0453683_0000003_6522_6938 138
329 3300044683 Ga0466965_0027509 Ga0466965_0027509_1331_1747 138
330 3300044683 Ga0466965_0195448 Ga0466965_0195448_283_699 138
331 3300044683 Ga0466965_0350948 Ga0466965_0350948_250_666 138
332 3300044683 Ga0466965_0854512 Ga0466965_0854512_84_500 138
333 3300044684 Ga0466966_0001454 Ga0466966_0001454_5314_5730 138
334 3300044684 Ga0466966_0036383 Ga0466966_0036383_418_834 138
335 3300044684 Ga0466966_0100654 Ga0466966_0100654_662_1078 138
336 3300044684 Ga0466966_0101727 Ga0466966_0101727_1102_1521 138
337 3300044684 Ga0466966_0379324 Ga0466966_0379324_369_785 138
338 3300044684 Ga0466966_0455114 Ga0466966_0455114_184_600 138
339 3300044693 Ga0466961_0000200 Ga0466961_0000200_21206_21625 138
340 3300044693 Ga0466961_0118319 Ga0466961_0118319_519_935 138
341 3300044693 Ga0466961_0186266 Ga0466961_0186266_328_744 138
342 3300044693 Ga0466961_0195249 Ga0466961_0195249_712_1128 138
343 3300044693 Ga0466961_0727271 Ga0466961_0727271_119_535 138
344 3300044694 Ga0466963_0049837 Ga0466963_0049837_1018_1434 138
345 3300044694 Ga0466963_0300161 Ga0466963_0300161_57_473 138
346 3300044694 Ga0466963_1172793 Ga0466963_1172793_52_471 138
347 3300044706 Ga0466964_0001591 Ga0466964_0001591_3066_3485 138
348 3300044712 Ga0453684_0000002 Ga0453684_0000002_1724438_1724854 138
349 3300044712 Ga0453684_0000077 Ga0453684_0000077_162506_162922 138
350 3300044712 Ga0453684_0001440 Ga0453684_0001440_35879_36295 138
351 3300044719 Ga0466971_0007071 Ga0466971_0007071_2595_3011 138
352 3300044719 Ga0466971_0137877 Ga0466971_0137877_482_898 138
353 3300044719 Ga0466971_0304906 Ga0466971_0304906_218_637 138
354 3300044735 Ga0466968_0110146 Ga0466968_0110146_661_1080 138
355 3300044765 Ga0466970_0001088 Ga0466970_0001088_4822_5241 138
356 3300044765 Ga0466970_0327377 Ga0466970_0327377_202_618 138
357 3300044765 Ga0466970_0567180 Ga0466970_0567180_32_448 138
358 3300044842 Ga0466957_0016078 Ga0466957_0016078_3617_4033 138
359 3300044842 Ga0466957_0041940 Ga0466957_0041940_728_1144 138
360 3300044842 Ga0466957_0425080 Ga0466957_0425080_235_651 138
361 3300044842 Ga0466957_1118551 Ga0466957_1118551_29_445 138
362 3300044901 Ga0466960_0032649 Ga0466960_0032649_212_631 138
363 3300044901 Ga0466960_1025507 Ga0466960_1025507_31_447 138
364 3300045049 Ga0466959_0000415 Ga0466959_0000415_3649_4068 138
365 3300045049 Ga0466959_0021535 Ga0466959_0021535_919_1335 138
366 3300045049 Ga0466959_0432286 Ga0466959_0432286_105_521 138
367 3300045049 Ga0466959_0450501 Ga0466959_0450501_309_725 138
368 3300045049 Ga0466959_0774644 Ga0466959_0774644_156_572 138
369 3300045051 Ga0451576_0001215 Ga0451576_0001215_38957_39373 138
370 3300045051 Ga0451576_2434180 Ga0451576_2434180_22_438 138
371 3300045051 Ga0451576_2522695 Ga0451576_2522695_51_467 138
372 3300045836 Ga0466958_0051708 Ga0466958_0051708_775_1254 138
373 3300045836 Ga0466958_0086822 Ga0466958_0086822_1318_1737 138
374 3300045836 Ga0466958_1068715 Ga0466958_1068715_33_449 138
375 3300045976 Ga0466967_0016641 Ga0466967_0016641_3011_3430 138
376 3300045976 Ga0466967_0262517 Ga0466967_0262517_287_706 138
377 3300045976 Ga0466967_1093562 Ga0466967_1093562_55_471 138
378 3300046452 Ga0495617_002536 Ga0495617_002536_3604_4083 138
379 3300046455 Ga0495603_0062002 Ga0495603_0062002_553_969 138
380 3300046459 Ga0495629_0001542 Ga0495629_0001542_12583_12999 138
381 3300046460 Ga0495638_0006093 Ga0495638_0006093_5123_5539 138
382 3300046462 Ga0495651_0012482 Ga0495651_0012482_1079_1495 138
383 3300046462 Ga0495651_0780848 Ga0495651_0780848_152_568 138
384 3300046471 Ga0495650_0000319 Ga0495650_0000319_63500_63916 138
385 3300046471 Ga0495650_0039410 Ga0495650_0039410_231_647 138
386 3300046471 Ga0495650_0042257 Ga0495650_0042257_1394_1810 138
387 3300046471 Ga0495650_0239395 Ga0495650_0239395_88_504 138
388 3300046474 Ga0495605_0007310 Ga0495605_0007310_3259_3675 138
389 3300046474 Ga0495605_0291379 Ga0495605_0291379_179_595 138
390 3300046491 Ga0495584_0007943 Ga0495584_0007943_752_1168 138
391 3300046491 Ga0495584_0024433 Ga0495584_0024433_900_1316 138
392 3300046491 Ga0495584_0056337 Ga0495584_0056337_1359_1775 138
393 3300046491 Ga0495584_0089209 Ga0495584_0089209_806_1222 138
394 3300046492 Ga0495585_0008776 Ga0495585_0008776_3098_3514 138
395 3300046492 Ga0495585_0009930 Ga0495585_0009930_3561_3977 138
396 3300046499 Ga0495594_0045491 Ga0495594_0045491_1830_2246 138
397 3300046500 Ga0495596_0016190 Ga0495596_0016190_170_586 138
398 3300046501 Ga0495607_0026334 Ga0495607_0026334_1531_1947 138
399 3300046506 Ga0495583_0001554 Ga0495583_0001554_5030_5446 138
400 3300046506 Ga0495583_0017907 Ga0495583_0017907_306_722 138
401 3300046506 Ga0495583_0369938 Ga0495583_0369938_125_541 138
402 3300046506 Ga0495583_0371988 Ga0495583_0371988_127_543 138
403 3300046507 Ga0495606_0000070 Ga0495606_0000070_156511_156927 138
404 3300046507 Ga0495606_0026978 Ga0495606_0026978_3077_3493 138
405 3300046507 Ga0495606_0147467 Ga0495606_0147467_643_1059 138
406 3300046512 Ga0495610_0099714 Ga0495610_0099714_851_1267 138
407 3300046516 Ga0495628_0000214 Ga0495628_0000214_49144_49560 138
408 3300046516 Ga0495628_0003096 Ga0495628_0003096_2576_2992 138
409 3300046518 Ga0495631_0008415 Ga0495631_0008415_3312_3728 138
410 3300046518 Ga0495631_0038943 Ga0495631_0038943_1512_1928 138
411 3300046518 Ga0495631_0055638 Ga0495631_0055638_722_1138 138
412 3300046519 Ga0495632_0090643 Ga0495632_0090643_411_827 138
413 3300046522 Ga0495643_0068068 Ga0495643_0068068_20_436 138
414 3300046523 Ga0495644_0161464 Ga0495644_0161464_183_599 138
415 3300046526 Ga0495666_0252753 Ga0495666_0252753_120_536 138
416 3300046528 Ga0495642_0106933 Ga0495642_0106933_447_863 138
417 3300046528 Ga0495642_0120324 Ga0495642_0120324_116_532 138
418 3300046528 Ga0495642_0195326 Ga0495642_0195326_383_799 138
419 3300046529 Ga0495652_0078476 Ga0495652_0078476_2225_2641 138
420 3300046529 Ga0495652_0360170 Ga0495652_0360170_144_560 138
421 3300046530 Ga0495654_0201605 Ga0495654_0201605_280_696 138
422 3300046535 Ga0495586_0445556 Ga0495586_0445556_269_685 138
423 3300046538 Ga0495609_0020470 Ga0495609_0020470_874_1290 138
424 3300046538 Ga0495609_0055399 Ga0495609_0055399_142_558 138
425 3300046542 Ga0495597_0013284 Ga0495597_0013284_1556_1972 138
426 3300046542 Ga0495597_0078691 Ga0495597_0078691_856_1272 138
427 3300046542 Ga0495597_0128829 Ga0495597_0128829_44_460 138
428 3300046557 Ga0495622_0000130 Ga0495622_0000130_37203_37619 138
429 3300046557 Ga0495622_0073679 Ga0495622_0073679_1104_1520 138
430 3300046558 Ga0495633_0009805 Ga0495633_0009805_1489_1905 138
431 3300046558 Ga0495633_0104408 Ga0495633_0104408_320_736 138
432 3300046558 Ga0495633_0174480 Ga0495633_0174480_292_708 138
433 3300046559 Ga0495667_0438124 Ga0495667_0438124_302_718 138
434 3300046616 Ga0495668_0020680 Ga0495668_0020680_1735_2151 138
435 3300046616 Ga0495668_0262260 Ga0495668_0262260_59_475 138
436 3300046616 Ga0495668_0263606 Ga0495668_0263606_260_676 138
437 3300046616 Ga0495668_0448210 Ga0495668_0448210_216_632 138
438 3300046660 Ga0495625_0740354 Ga0495625_0740354_124_540 138
439 3300046663 Ga0495635_0075144 Ga0495635_0075144_1794_2210 138
440 3300046665 Ga0495661_0003080 Ga0495661_0003080_8285_8701 138
441 3300046665 Ga0495661_0029100 Ga0495661_0029100_2432_2848 138
442 3300046665 Ga0495661_0039611 Ga0495661_0039611_187_603 138
443 3300046665 Ga0495661_0081270 Ga0495661_0081270_94_510 138
444 3300046665 Ga0495661_0110697 Ga0495661_0110697_558_974 138
445 3300046665 Ga0495661_0161181 Ga0495661_0161181_277_693 138
446 3300046665 Ga0495661_0200824 Ga0495661_0200824_260_676 138
447 3300046674 Ga0495588_0075157 Ga0495588_0075157_801_1217 138
448 3300046674 Ga0495588_0130709 Ga0495588_0130709_380_796 138
449 3300046679 Ga0495623_0029070 Ga0495623_0029070_244_660 138
450 3300046684 Ga0495669_0007914 Ga0495669_0007914_827_1243 138
451 3300046690 Ga0495624_0066566 Ga0495624_0066566_1774_2190 138
452 3300046690 Ga0495624_0341158 Ga0495624_0341158_64_480 138
453 3300046691 Ga0495670_0002993 Ga0495670_0002993_25_441 138
454 3300046691 Ga0495670_0009425 Ga0495670_0009425_3375_3791 138
455 3300046692 Ga0495671_0270167 Ga0495671_0270167_153_569 138
456 3300046692 Ga0495671_0302318 Ga0495671_0302318_54_470 138
457 3300046694 Ga0495649_0230538 Ga0495649_0230538_272_718 138
458 3300046794 Ga0495589_0174117 Ga0495589_0174117_154_570 138
459 3300046810 Ga0495660_0012227 Ga0495660_0012227_3016_3432 138
460 3300047315 Ga0495581_0210951 Ga0495581_0210951_94_510 138
461 3300047317 Ga0495604_0045382 Ga0495604_0045382_261_677 138
462 3300047319 Ga0495674_0012343 Ga0495674_0012343_7279_7695 138
463 3300047319 Ga0495674_0021280 Ga0495674_0021280_2396_2812 138
464 3300047319 Ga0495674_0087929 Ga0495674_0087929_1849_2265 138
465 3300047320 Ga0495672_0004866 Ga0495672_0004866_3002_3418 138
466 3300047323 Ga0495683_0043528 Ga0495683_0043528_938_1354 138
467 3300047443 Ga0495687_046086 Ga0495687_046086_1043_1459 138
468 3300047443 Ga0495687_126340 Ga0495687_126340_426_842 138
469 3300047445 Ga0495677_0232483 Ga0495677_0232483_85_501 138
470 3300047445 Ga0495677_0244672 Ga0495677_0244672_111_527 138
471 3300047469 Ga0495673_0036297 Ga0495673_0036297_330_746 138
472 3300047470 Ga0495681_0008321 Ga0495681_0008321_263_679 138
473 3300047472 Ga0495686_0000044 Ga0495686_0000044_204412_204828 138
474 3300047472 Ga0495686_0095131 Ga0495686_0095131_1239_1655 138
475 3300047673 Ga0495593_0096522 Ga0495593_0096522_169_585 138
476 3300048088 Ga0495602_0183668 Ga0495602_0183668_932_1348 138
477 3300048088 Ga0495602_0639680 Ga0495602_0639680_202_618 138
478 3300048088 Ga0495602_0684501 Ga0495602_0684501_206_622 138
479 3300048091 Ga0495626_0001165 Ga0495626_0001165_9192_9608 138
480 3300048091 Ga0495626_0031716 Ga0495626_0031716_452_868 138
481 3300048903 Ga0496100_0042332 Ga0496100_0042332_1687_2103 138
482 3300048903 Ga0496100_1495471 Ga0496100_1495471_17_433 138
483 3300048903 Ga0496100_1551160 Ga0496100_1551160_43_459 138
484 3300048904 Ga0496101_0033584 Ga0496101_0033584_81_497 138
485 3300048905 Ga0496102_0343506 Ga0496102_0343506_185_601 138
486 3300048905 Ga0496102_0446447 Ga0496102_0446447_512_928 138
487 3300048905 Ga0496102_1126488 Ga0496102_1126488_230_646 138
488 3300048906 Ga0496103_0107900 Ga0496103_0107900_524_940 138
489 3300048906 Ga0496103_0195417 Ga0496103_0195417_149_565 138
490 3300048906 Ga0496103_0389194 Ga0496103_0389194_268_684 138
491 3300048907 Ga0496104_0826231 Ga0496104_0826231_193_609 138
492 3300048907 Ga0496104_1313029 Ga0496104_1313029_42_458 138
493 3300048908 Ga0496105_0100253 Ga0496105_0100253_485_901 138
494 3300048908 Ga0496105_0243478 Ga0496105_0243478_728_1144 138
495 3300048909 Ga0496106_0857543 Ga0496106_0857543_241_657 138
496 3300048911 Ga0496108_0074217 Ga0496108_0074217_1674_2090 138
497 3300048912 Ga0496109_0407673 Ga0496109_0407673_149_565 138
498 3300048912 Ga0496109_1044373 Ga0496109_1044373_184_600 138
499 3300048913 Ga0496110_0135222 Ga0496110_0135222_1149_1565 138
500 3300048914 Ga0496111_0428571 Ga0496111_0428571_505_921 138
501 3300048914 Ga0496111_0939595 Ga0496111_0939595_173_589 138
502 3300048917 Ga0496114_0148367 Ga0496114_0148367_778_1194 138
503 3300048918 Ga0496115_0127716 Ga0496115_0127716_1257_1673 138
504 3300048918 Ga0496115_0180998 Ga0496115_0180998_365_781 138
505 3300048919 Ga0496116_0120696 Ga0496116_0120696_41_460 138
506 3300048920 Ga0496117_0173220 Ga0496117_0173220_227_646 138
507 3300048921 Ga0496118_0000378 Ga0496118_0000378_12143_12559 138
508 3300048921 Ga0496118_0225440 Ga0496118_0225440_561_980 138
509 3300048921 Ga0496118_0461529 Ga0496118_0461529_61_477 138
510 3300048921 Ga0496118_0641646 Ga0496118_0641646_57_473 138
511 3300048924 Ga0496121_0539371 Ga0496121_0539371_242_658 138
512 3300048925 Ga0496122_0000018 Ga0496122_0000018_227918_228334 138
513 3300048925 Ga0496122_0121679 Ga0496122_0121679_579_995 138
514 3300048926 Ga0496123_0000015 Ga0496123_0000015_227918_228334 138
515 3300048926 Ga0496123_0020681 Ga0496123_0020681_3894_4310 138
516 3300048927 Ga0496124_0100832 Ga0496124_0100832_731_1147 138
517 3300048928 Ga0496125_0002112 Ga0496125_0002112_24665_25081 138
518 3300048928 Ga0496125_0007190 Ga0496125_0007190_7909_8328 138
519 3300048928 Ga0496125_0017207 Ga0496125_0017207_6292_6708 138
520 3300048929 Ga0496126_0004109 Ga0496126_0004109_11981_12397 138
521 3300049459 Ga0495678_001831 Ga0495678_001831_2420_2836 138
522 3300049459 Ga0495678_071359 Ga0495678_071359_79_495 138
523 3300049583 Ga0501067_0009870 Ga0501067_0009870_2690_3106 138
524 3300050492 nmdc:mga0yw44_418407_c1 nmdc:mga0yw44_418407_c1_23_439 138
525 3300050493 nmdc:mga0k408_2819_c2 nmdc:mga0k408_2819_c2_4037_4453 138
526 3300050493 nmdc:mga0k408_290135_c1 nmdc:mga0k408_290135_c1_260_676 138
527 3300050493 nmdc:mga0k408_44306_c1 nmdc:mga0k408_44306_c1_696_1112 138
528 3300053125 Ga0500618_000096 Ga0500618_000096_19068_19484 138
529 3300053125 Ga0500618_007664 Ga0500618_007664_1700_2116 138
530 3300053125 Ga0500618_009766 Ga0500618_009766_355_771 138
531 3300053156 Ga0500622_0064505 Ga0500622_0064505_1078_1494 138
532 3300053157 Ga0500624_012022 Ga0500624_012022_562_978 138
533 3300053160 Ga0500633_0276124 Ga0500633_0276124_43_459 138
534 3300053730 Ga0500645_011016 Ga0500645_011016_2491_2907 138
535 3300053730 Ga0500645_043691 Ga0500645_043691_853_1269 138
536 3300061719 Ga0466962_0043183 Ga0466962_0043183_83_499 138
537 3300061719 Ga0466962_0406816 Ga0466962_0406816_158_574 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

51

109

0.99

PF12802

MarR_2

MarR family

49

108

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9559 34 82
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.926 47 92
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9111 34 92
7el3-assembly1.cif.gz_B crystal structure of hpar-dna complex from acinetobacter baumannii 0.9063 6 135
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.9043 34 92
ID Description Score Start End Superfamily
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9622 34 94 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9401 33 91 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9399 46 92 3.30.230.130
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9345 30 93 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.926 47 92 1.10.10.10
ID Description Score Start End GO Terms
AF-G3ACI8-F1-model_v4 Transcriptional regulator, MarR family 0.9957 1 138 GO:0003677
GO:0003700
AF-A0A4Q4X706-F1-model_v4 Pyroglutamyl-peptidase I (EC 3.4.19.3) 0.9918 1 137 GO:0003700
GO:0005829
GO:0006508
GO:0016920
AF-A0A1R3TAJ0-F1-model_v4 Salmolysin 0.99 1 138 GO:0003677
GO:0003700
AF-G3ACI8-F1-model_v4 Transcriptional regulator, MarR family 0.9886 1 138 GO:0003677
GO:0003700
AF-A0A4Q4XIZ4-F1-model_v4 HTH marR-type domain-containing protein 0.9875 1 132 GO:0003677
GO:0003700
GO:0016853

Feature Viewer

pLDDT pTM Quality
94.58 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map