F460937
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 537 | 296 | 513 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0051708|Ga0466958_0051708_775_1254 |
| Length | 159 |
| Sequence | MRHSRSGILVVLLTVLRFNDVMFDHCLYFNSSALARLAEREWSAAYAPFGLTPAQGFVLRVVLASPGCLSSQIADVLGIARPTATRLIDNLCQKQLVERRQAESDGREWGVYPTRAGKALDRPINDASAQIAKTLREKVGTDLFQSAVSSMHGIRKALS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 2 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 4 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 5 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 6 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 7 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 8 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 9 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 10 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 11 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 12 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 13 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 14 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 15 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 16 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 17 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 18 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 19 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 20 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 21 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 22 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 23 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 26 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 27 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 28 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 29 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 30 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 33 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 36 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 37 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 38 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 49 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 164 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 174 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 183 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 184 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 185 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 186 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 189 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 190 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 191 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 197 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 290 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 293 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 294 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 295 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 296 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.41 |
| Metatranscriptomes | 1.12 |
| Isolates | 4.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.6 |
| Nodule | 1.68 |
| Rhizoplane | 4.84 |
| Rhizosphere | 62.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1004919 | 3300001915 | Bacteria | 2878 |
| 2 | JGI24740J21852_10000068 | 3300001979 | Bacteria | 34079 |
| 3 | JGI24740J21852_10000165 | 3300001979 | Bacteria | 26307 |
| 4 | JGI24740J21852_10001559 | 3300001979 | Bacteria | 10529 |
| 5 | JGI24735J21928_10032090 | 3300002067 | Bacteria | 1555 |
| 6 | JGI25156J39149_1018613 | 3300002705 | Bacteria | 1278 |
| 7 | JGI25156J39149_1019183 | 3300002705 | Bacteria | 1240 |
| 8 | JGI25156J39149_1035552 | 3300002705 | Bacteria | 715 |
| 9 | JGI25162J39368_1000079 | 3300002737 | Bacteria | 115162 |
| 10 | JGI25163J39215_1005496 | 3300002771 | Bacteria | 802 |
| 11 | JGI25150J39212_1004070 | 3300002774 | Bacteria | 3308 |
| 12 | JGI25150J39212_1006550 | 3300002774 | Bacteria | 2396 |
| 13 | JGI25159J45721_1000295 | 3300002987 | Bacteria | 23372 |
| 14 | JGI25151J46595_10005589 | 3300003187 | Bacteria | 6469 |
| 15 | JGI25151J46595_10006626 | 3300003187 | Bacteria | 5778 |
| 16 | JGI25165J46597_1000135 | 3300003214 | Bacteria | 122924 |
| 17 | rootH2_10229482 | 3300003320 | Bacteria | 1133 |
| 18 | rootH1_10324460 | 3300003323 | Bacteria | 2632 |
| 19 | JGI25160J50197_1000223 | 3300003354 | Bacteria | 45156 |
| 20 | JGI25161J50226_1000013 | 3300003374 | Bacteria | 199086 |
| 21 | Ga0006562J51391_1196130 | 3300003578 | Bacteria | 840 |
| 22 | Ga0055538_1000055 | 3300003751 | Bacteria | 122924 |
| 23 | Ga0055538_1001015 | 3300003751 | Bacteria | 6437 |
| 24 | Ga0055538_1001935 | 3300003751 | Bacteria | 3406 |
| 25 | Ga0055538_1003845 | 3300003751 | Bacteria | 1815 |
| 26 | Ga0055538_1004025 | 3300003751 | Bacteria | 1738 |
| 27 | Ga0055539_1000080 | 3300003752 | Bacteria | 122924 |
| 28 | Ga0055539_1000081 | 3300003752 | Bacteria | 122891 |
| 29 | Ga0055539_1000201 | 3300003752 | Bacteria | 47514 |
| 30 | Ga0055533_1000086 | 3300003756 | Bacteria | 122924 |
| 31 | Ga0055533_1004854 | 3300003756 | Bacteria | 2311 |
| 32 | Ga0055533_1007168 | 3300003756 | Bacteria | 1545 |
| 33 | Ga0055533_1007546 | 3300003756 | Bacteria | 1469 |
| 34 | Ga0055533_1008633 | 3300003756 | Bacteria | 1268 |
| 35 | Ga0055532_1000048 | 3300003758 | Bacteria | 175560 |
| 36 | Ga0055532_1000073 | 3300003758 | Bacteria | 131021 |
| 37 | Ga0055525_1000114 | 3300003759 | Bacteria | 122924 |
| 38 | Ga0055525_1000640 | 3300003759 | Bacteria | 14087 |
| 39 | Ga0055525_1000820 | 3300003759 | Bacteria | 9496 |
| 40 | Ga0055527_1001283 | 3300003760 | Bacteria | 5494 |
| 41 | Ga0055527_1001715 | 3300003760 | Bacteria | 4274 |
| 42 | Ga0055535_1000035 | 3300003761 | Bacteria | 175560 |
| 43 | Ga0055535_1000055 | 3300003761 | Bacteria | 131021 |
| 44 | Ga0055529_1000101 | 3300003763 | Bacteria | 130709 |
| 45 | Ga0055529_1000877 | 3300003763 | Bacteria | 17223 |
| 46 | Ga0055526_1037248 | 3300003771 | Bacteria | 1275 |
| 47 | Ga0055537_1011474 | 3300003773 | Bacteria | 1795 |
| 48 | Ga0055534_1030703 | 3300003784 | Bacteria | 828 |
| 49 | Ga0055530_10012725 | 3300003791 | Bacteria | 2915 |
| 50 | Ga0055541_1000057 | 3300003841 | Bacteria | 122924 |
| 51 | Ga0055541_1000601 | 3300003841 | Bacteria | 9618 |
| 52 | Ga0055541_1005563 | 3300003841 | Bacteria | 2192 |
| 53 | Ga0055541_1009153 | 3300003841 | Bacteria | 1545 |
| 54 | Ga0055541_1011830 | 3300003841 | Bacteria | 1268 |
| 55 | Ga0055543_1000211 | 3300004625 | Bacteria | 47109 |
| 56 | Ga0070683_100638034 | 3300005329 | Bacteria | 1020 |
| 57 | Ga0070666_10137808 | 3300005335 | Bacteria | 1699 |
| 58 | Ga0070682_100076290 | 3300005337 | Bacteria | 2157 |
| 59 | Ga0070682_101165173 | 3300005337 | Bacteria | 649 |
| 60 | Ga0070687_100042021 | 3300005343 | Bacteria | 2314 |
| 61 | Ga0070661_100000061 | 3300005344 | Bacteria | 86581 |
| 62 | Ga0070661_100000093 | 3300005344 | Bacteria | 73157 |
| 63 | Ga0070661_100176890 | 3300005344 | Bacteria | 1622 |
| 64 | Ga0070661_100214892 | 3300005344 | Bacteria | 1473 |
| 65 | Ga0070675_100934448 | 3300005354 | Bacteria | 795 |
| 66 | Ga0070671_100153176 | 3300005355 | Bacteria | 1947 |
| 67 | Ga0070674_100660726 | 3300005356 | Bacteria | 889 |
| 68 | Ga0070659_100740194 | 3300005366 | Bacteria | 852 |
| 69 | Ga0070667_101043425 | 3300005367 | Bacteria | 763 |
| 70 | Ga0070713_100098224 | 3300005436 | Bacteria | 2532 |
| 71 | Ga0070713_100503711 | 3300005436 | Bacteria | 1143 |
| 72 | Ga0070663_100000009 | 3300005455 | Bacteria | 187718 |
| 73 | Ga0070663_100000024 | 3300005455 | Bacteria | 108544 |
| 74 | Ga0070663_100147335 | 3300005455 | Bacteria | 1802 |
| 75 | Ga0070663_100247361 | 3300005455 | Bacteria | 1410 |
| 76 | Ga0070662_100620969 | 3300005457 | Bacteria | 910 |
| 77 | Ga0068867_101446660 | 3300005459 | Bacteria | 638 |
| 78 | Ga0068855_100460112 | 3300005563 | Bacteria | 1387 |
| 79 | Ga0070664_100000010 | 3300005564 | Bacteria | 165664 |
| 80 | Ga0070664_100000022 | 3300005564 | Bacteria | 108544 |
| 81 | Ga0070664_100106292 | 3300005564 | Bacteria | 2445 |
| 82 | Ga0070664_100163160 | 3300005564 | Bacteria | 1973 |
| 83 | Ga0068857_100011536 | 3300005577 | Bacteria | 7688 |
| 84 | Ga0068857_100039179 | 3300005577 | Bacteria | 4197 |
| 85 | Ga0068857_100833646 | 3300005577 | Bacteria | 882 |
| 86 | Ga0068854_100000077 | 3300005578 | Bacteria | 69779 |
| 87 | Ga0068854_100000088 | 3300005578 | Bacteria | 65455 |
| 88 | Ga0068854_101788471 | 3300005578 | Unclassified | 563 |
| 89 | Ga0068856_100000049 | 3300005614 | Bacteria | 108544 |
| 90 | Ga0068856_100000069 | 3300005614 | Bacteria | 95628 |
| 91 | Ga0068852_100091229 | 3300005616 | Bacteria | 2726 |
| 92 | Ga0068852_100505022 | 3300005616 | Bacteria | 1204 |
| 93 | Ga0068863_102396890 | 3300005841 | Bacteria | 537 |
| 94 | Ga0081455_10311175 | 3300005937 | Bacteria | 1126 |
| 95 | Ga0070717_10039890 | 3300006028 | Bacteria | 3822 |
| 96 | Ga0075363_100036886 | 3300006048 | Bacteria | 2565 |
| 97 | Ga0075364_10010177 | 3300006051 | Bacteria | 5672 |
| 98 | Ga0070716_100316109 | 3300006173 | Bacteria | 1092 |
| 99 | Ga0075366_10003812 | 3300006195 | Bacteria | 8023 |
| 100 | Ga0075366_10183672 | 3300006195 | Bacteria | 1270 |
| 101 | Ga0075366_10274515 | 3300006195 | Bacteria | 1030 |
| 102 | Ga0068871_100112759 | 3300006358 | Unclassified | 2289 |
| 103 | Ga0068871_102129948 | 3300006358 | Bacteria | 534 |
| 104 | Ga0079104_1000033 | 3300006946 | Bacteria | 202636 |
| 105 | Ga0105244_10170616 | 3300009036 | Bacteria | 1035 |
| 106 | Ga0105250_10184252 | 3300009092 | Bacteria | 877 |
| 107 | Ga0105240_10059453 | 3300009093 | Unclassified | 4770 |
| 108 | Ga0105240_10151469 | 3300009093 | Bacteria | 2762 |
| 109 | Ga0105240_10158069 | 3300009093 | Bacteria | 2694 |
| 110 | Ga0105240_10392540 | 3300009093 | Bacteria | 1565 |
| 111 | Ga0105240_10496802 | 3300009093 | Bacteria | 1357 |
| 112 | Ga0105245_10333101 | 3300009098 | Unclassified | 1499 |
| 113 | Ga0105247_10173988 | 3300009101 | Bacteria | 1433 |
| 114 | Ga0105241_10405089 | 3300009174 | Bacteria | 1197 |
| 115 | Ga0105241_10767865 | 3300009174 | Bacteria | 885 |
| 116 | Ga0105248_10025385 | 3300009177 | Bacteria | 6589 |
| 117 | Ga0105246_10107305 | 3300011119 | Bacteria | 2045 |
| 118 | Ga0157373_10070355 | 3300013100 | Bacteria | 2472 |
| 119 | Ga0157373_10166796 | 3300013100 | Bacteria | 1550 |
| 120 | Ga0157371_10000088 | 3300013102 | Bacteria | 145526 |
| 121 | Ga0157371_10000089 | 3300013102 | Bacteria | 145483 |
| 122 | Ga0157371_10054674 | 3300013102 | Bacteria | 2834 |
| 123 | Ga0157370_10000002 | 3300013104 | Bacteria | 431400 |
| 124 | Ga0157370_10000041 | 3300013104 | Bacteria | 133912 |
| 125 | Ga0157370_11254720 | 3300013104 | Unclassified | 668 |
| 126 | Ga0157369_10000138 | 3300013105 | Bacteria | 102776 |
| 127 | Ga0157369_10000233 | 3300013105 | Bacteria | 76995 |
| 128 | Ga0157369_10003845 | 3300013105 | Bacteria | 17842 |
| 129 | Ga0157369_10004358 | 3300013105 | Bacteria | 16698 |
| 130 | Ga0157369_10100340 | 3300013105 | Bacteria | 3086 |
| 131 | Ga0157369_10348990 | 3300013105 | Bacteria | 1537 |
| 132 | Ga0157374_10999331 | 3300013296 | Bacteria | 856 |
| 133 | Ga0157378_10879906 | 3300013297 | Bacteria | 925 |
| 134 | Ga0163162_10011368 | 3300013306 | Bacteria | 8679 |
| 135 | Ga0157372_10000363 | 3300013307 | Bacteria | 50093 |
| 136 | Ga0157375_10020561 | 3300013308 | Bacteria | 6033 |
| 137 | Ga0182006_1000917 | 3300015261 | Bacteria | 19685 |
| 138 | Ga0182006_1005883 | 3300015261 | Bacteria | 5770 |
| 139 | Ga0182007_10018289 | 3300015262 | Bacteria | 2541 |
| 140 | Ga0182005_1065890 | 3300015265 | Bacteria | 992 |
| 141 | Ga0163161_10286938 | 3300017792 | Bacteria | 1293 |
| 142 | Ga0206351_10441816 | 3300020077 | Bacteria | 1473 |
| 143 | Ga0206354_11129042 | 3300020081 | Plasmid | 1475 |
| 144 | Ga0206353_11265201 | 3300020082 | Bacteria | 2552 |
| 145 | Ga0154015_1281252 | 3300020610 | Bacteria | 7512 |
| 146 | Ga0154015_1319505 | 3300020610 | Bacteria | 17918 |
| 147 | Ga0209760_100874 | 3300025207 | Bacteria | 3864 |
| 148 | Ga0209436_105523 | 3300025208 | Bacteria | 2897 |
| 149 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 150 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 151 | Ga0209784_100024 | 3300025224 | Bacteria | 394613 |
| 152 | Ga0209784_102577 | 3300025224 | Bacteria | 1775 |
| 153 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 154 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 155 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 156 | Ga0209566_100582 | 3300025225 | Bacteria | 23555 |
| 157 | Ga0209566_100612 | 3300025225 | Bacteria | 22172 |
| 158 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 159 | Ga0209674_100045 | 3300025226 | Bacteria | 362387 |
| 160 | Ga0209674_100046 | 3300025226 | Bacteria | 357920 |
| 161 | Ga0209674_100870 | 3300025226 | Bacteria | 9859 |
| 162 | Ga0209674_103063 | 3300025226 | Bacteria | 3214 |
| 163 | Ga0209674_106797 | 3300025226 | Bacteria | 1511 |
| 164 | Ga0209672_100127 | 3300025228 | Bacteria | 78095 |
| 165 | Ga0209672_100650 | 3300025228 | Bacteria | 17785 |
| 166 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 167 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 168 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 169 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 170 | Ga0209563_100039 | 3300025230 | Bacteria | 409717 |
| 171 | Ga0209563_100090 | 3300025230 | Bacteria | 169322 |
| 172 | Ga0209563_102848 | 3300025230 | Bacteria | 3765 |
| 173 | Ga0209563_105007 | 3300025230 | Bacteria | 2456 |
| 174 | Ga0209563_105643 | 3300025230 | Bacteria | 2238 |
| 175 | Ga0207427_102464 | 3300025231 | Bacteria | 4959 |
| 176 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 177 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 178 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 179 | Ga0207425_1002014 | 3300025245 | Bacteria | 7568 |
| 180 | Ga0209026_1035270 | 3300025250 | Bacteria | 734 |
| 181 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 182 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 183 | Ga0209677_100024 | 3300025253 | Bacteria | 406035 |
| 184 | Ga0209148_1001888 | 3300025254 | Bacteria | 8659 |
| 185 | Ga0209148_1002127 | 3300025254 | Bacteria | 7421 |
| 186 | Ga0209759_1002288 | 3300025256 | Bacteria | 8641 |
| 187 | Ga0209759_1004083 | 3300025256 | Bacteria | 5580 |
| 188 | Ga0209759_1005154 | 3300025256 | Bacteria | 4657 |
| 189 | Ga0209759_1018784 | 3300025256 | Bacteria | 1662 |
| 190 | Ga0209759_1029053 | 3300025256 | Bacteria | 1114 |
| 191 | Ga0209129_1004929 | 3300025258 | Bacteria | 4968 |
| 192 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 193 | Ga0209565_1000768 | 3300025263 | Bacteria | 18752 |
| 194 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 195 | Ga0209455_1000042 | 3300025272 | Bacteria | 419638 |
| 196 | Ga0209130_1000064 | 3300025284 | Bacteria | 196568 |
| 197 | Ga0209675_1004319 | 3300025291 | Bacteria | 6370 |
| 198 | Ga0209676_1001583 | 3300025292 | Bacteria | 20274 |
| 199 | Ga0209025_1003115 | 3300025294 | Bacteria | 16255 |
| 200 | Ga0209564_1006428 | 3300025295 | Bacteria | 6339 |
| 201 | Ga0209758_1013860 | 3300025297 | Bacteria | 4348 |
| 202 | Ga0209758_1041073 | 3300025297 | Bacteria | 1735 |
| 203 | Ga0209050_1005684 | 3300025298 | Bacteria | 7712 |
| 204 | Ga0209256_1026726 | 3300025299 | Bacteria | 1657 |
| 205 | Ga0207426_1000116 | 3300025302 | Bacteria | 225245 |
| 206 | Ga0209051_1096316 | 3300025303 | Bacteria | 808 |
| 207 | Ga0209257_1018538 | 3300025304 | Bacteria | 2672 |
| 208 | Ga0207710_10295499 | 3300025900 | Bacteria | 817 |
| 209 | Ga0207680_10084147 | 3300025903 | Bacteria | 2006 |
| 210 | Ga0207654_10591546 | 3300025911 | Bacteria | 791 |
| 211 | Ga0207695_10000739 | 3300025913 | Bacteria | 63264 |
| 212 | Ga0207695_10005647 | 3300025913 | Bacteria | 16509 |
| 213 | Ga0207695_10193665 | 3300025913 | Bacteria | 1950 |
| 214 | Ga0207695_10626388 | 3300025913 | Bacteria | 957 |
| 215 | Ga0207663_11350797 | 3300025916 | Bacteria | 574 |
| 216 | Ga0207662_10066541 | 3300025918 | Bacteria | 2171 |
| 217 | Ga0207649_10000588 | 3300025920 | Bacteria | 24754 |
| 218 | Ga0207649_10001707 | 3300025920 | Bacteria | 12643 |
| 219 | Ga0207700_10802136 | 3300025928 | Bacteria | 842 |
| 220 | Ga0207690_10026235 | 3300025932 | Bacteria | 3668 |
| 221 | Ga0207690_10988618 | 3300025932 | Unclassified | 700 |
| 222 | Ga0207665_10205609 | 3300025939 | Bacteria | 1436 |
| 223 | Ga0207711_10033590 | 3300025941 | Bacteria | 4342 |
| 224 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 225 | Ga0207679_10000004 | 3300025945 | Bacteria | 589021 |
| 226 | Ga0207679_10542975 | 3300025945 | Bacteria | 1042 |
| 227 | Ga0207667_10005394 | 3300025949 | Bacteria | 15595 |
| 228 | Ga0207640_10000058 | 3300025981 | Bacteria | 92862 |
| 229 | Ga0207640_10000358 | 3300025981 | Bacteria | 29693 |
| 230 | Ga0207658_11008787 | 3300025986 | Bacteria | 759 |
| 231 | Ga0207678_10000012 | 3300026067 | Bacteria | 145324 |
| 232 | Ga0207678_10000018 | 3300026067 | Bacteria | 135549 |
| 233 | Ga0207678_10061760 | 3300026067 | Bacteria | 3223 |
| 234 | Ga0207678_10433218 | 3300026067 | Bacteria | 1141 |
| 235 | Ga0207708_10427258 | 3300026075 | Unclassified | 1099 |
| 236 | Ga0207702_10000020 | 3300026078 | Bacteria | 203299 |
| 237 | Ga0207702_10000053 | 3300026078 | Bacteria | 137538 |
| 238 | Ga0207641_11512818 | 3300026088 | Bacteria | 673 |
| 239 | Ga0207648_10341686 | 3300026089 | Bacteria | 1348 |
| 240 | Ga0207674_10001653 | 3300026116 | Bacteria | 28692 |
| 241 | Ga0207674_10021641 | 3300026116 | Bacteria | 6923 |
| 242 | Ga0207674_11528258 | 3300026116 | Bacteria | 636 |
| 243 | Ga0207683_10137905 | 3300026121 | Bacteria | 2196 |
| 244 | Ga0207698_10384078 | 3300026142 | Bacteria | 1337 |
| 245 | Ga0207698_10602226 | 3300026142 | Bacteria | 1083 |
| 246 | Ga0207698_10797583 | 3300026142 | Bacteria | 946 |
| 247 | Ga0207698_12695378 | 3300026142 | Unclassified | 506 |
| 248 | Ga0209281_1000043 | 3300027111 | Bacteria | 341543 |
| 249 | Ga0307517_10321612 | 3300028786 | Bacteria | 856 |
| 250 | Ga0265338_10000092 | 3300028800 | Bacteria | 168538 |
| 251 | Ga0316183_1116527 | 3300030742 | Unclassified | 513 |
| 252 | Ga0316181_1137718 | 3300030744 | Bacteria | 1290 |
| 253 | Ga0307513_10000316 | 3300031456 | Bacteria | 69426 |
| 254 | Ga0307408_100035846 | 3300031548 | Bacteria | 3483 |
| 255 | Ga0307508_10022414 | 3300031616 | Bacteria | 5741 |
| 256 | Ga0307516_10001925 | 3300031730 | Bacteria | 28437 |
| 257 | Ga0307516_10061874 | 3300031730 | Bacteria | 3630 |
| 258 | Ga0307405_10188848 | 3300031731 | Bacteria | 1486 |
| 259 | Ga0307412_11485752 | 3300031911 | Bacteria | 616 |
| 260 | Ga0307409_100323670 | 3300031995 | Bacteria | 1444 |
| 261 | Ga0307411_11247640 | 3300032005 | Bacteria | 675 |
| 262 | Ga0307411_11707039 | 3300032005 | Bacteria | 583 |
| 263 | Ga0307507_10201025 | 3300033179 | Bacteria | 1379 |
| 264 | Ga0373944_0046347 | 3300035089 | Bacteria | 1359 |
| 265 | Ga0395899_0578009 | 3300037312 | Bacteria | 719 |
| 266 | Ga0395899_0764734 | 3300037312 | Bacteria | 600 |
| 267 | Ga0395900_0001682 | 3300037418 | Bacteria | 25734 |
| 268 | Ga0395900_0004085 | 3300037418 | Bacteria | 15559 |
| 269 | Ga0395900_0332884 | 3300037418 | Bacteria | 1496 |
| 270 | Ga0395900_0436436 | 3300037418 | Bacteria | 1268 |
| 271 | Ga0395900_0636590 | 3300037418 | Unclassified | 1004 |
| 272 | Ga0395898_0006835 | 3300037466 | Bacteria | 12131 |
| 273 | Ga0395898_0109504 | 3300037466 | Bacteria | 2648 |
| 274 | Ga0395898_0342169 | 3300037466 | Bacteria | 1426 |
| 275 | Ga0395898_0767300 | 3300037466 | Bacteria | 905 |
| 276 | Ga0395905_0000017 | 3300037471 | Bacteria | 376619 |
| 277 | Ga0395905_0407210 | 3300037471 | Bacteria | 1255 |
| 278 | Ga0395901_0000003 | 3300038443 | Bacteria | 701538 |
| 279 | Ga0395901_0000576 | 3300038443 | Bacteria | 42723 |
| 280 | Ga0395901_0296622 | 3300038443 | Bacteria | 1676 |
| 281 | Ga0395901_0403792 | 3300038443 | Bacteria | 1403 |
| 282 | Ga0395901_0528219 | 3300038443 | Bacteria | 1198 |
| 283 | Ga0395901_1236963 | 3300038443 | Unclassified | 711 |
| 284 | Ga0451791_1272617 | 3300041451 | Bacteria | 1198 |
| 285 | Ga0451853_3666298 | 3300041512 | Bacteria | 741 |
| 286 | Ga0439448_0004132 | 3300042005 | Bacteria | 4089 |
| 287 | Ga0439458_0051408 | 3300042157 | Bacteria | 1017 |
| 288 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 289 | Ga0451577_1279088 | 3300042876 | Unclassified | 653 |
| 290 | Ga0466986_0035085 | 3300044650 | Bacteria | 3427 |
| 291 | Ga0466986_0132431 | 3300044650 | Bacteria | 1697 |
| 292 | Ga0466969_0052369 | 3300044656 | Bacteria | 2005 |
| 293 | Ga0466969_0070884 | 3300044656 | Bacteria | 1676 |
| 294 | Ga0466969_0279018 | 3300044656 | Bacteria | 757 |
| 295 | Ga0466969_0330735 | 3300044656 | Bacteria | 689 |
| 296 | Ga0466972_0000525 | 3300044658 | Bacteria | 18965 |
| 297 | Ga0466972_0014565 | 3300044658 | Bacteria | 3938 |
| 298 | Ga0466972_0204027 | 3300044658 | Unclassified | 926 |
| 299 | Ga0466977_0538646 | 3300044666 | Bacteria | 635 |
| 300 | Ga0466978_0040083 | 3300044671 | Bacteria | 2896 |
| 301 | Ga0466982_0020349 | 3300044672 | Bacteria | 3768 |
| 302 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 303 | Ga0466965_0027509 | 3300044683 | Bacteria | 2761 |
| 304 | Ga0466965_0195448 | 3300044683 | Bacteria | 1071 |
| 305 | Ga0466965_0350948 | 3300044683 | Bacteria | 808 |
| 306 | Ga0466965_0854512 | 3300044683 | Unclassified | 529 |
| 307 | Ga0466966_0001454 | 3300044684 | Bacteria | 15231 |
| 308 | Ga0466966_0036383 | 3300044684 | Bacteria | 3178 |
| 309 | Ga0466966_0100654 | 3300044684 | Bacteria | 1787 |
| 310 | Ga0466966_0101727 | 3300044684 | Bacteria | 1777 |
| 311 | Ga0466966_0379324 | 3300044684 | Bacteria | 849 |
| 312 | Ga0466966_0455114 | 3300044684 | Bacteria | 769 |
| 313 | Ga0466961_0000200 | 3300044693 | Bacteria | 40374 |
| 314 | Ga0466961_0118319 | 3300044693 | Bacteria | 1664 |
| 315 | Ga0466961_0186266 | 3300044693 | Bacteria | 1288 |
| 316 | Ga0466961_0195249 | 3300044693 | Bacteria | 1253 |
| 317 | Ga0466961_0727271 | 3300044693 | Unclassified | 594 |
| 318 | Ga0466963_0049837 | 3300044694 | Bacteria | 2770 |
| 319 | Ga0466963_0300161 | 3300044694 | Bacteria | 1130 |
| 320 | Ga0466963_1172793 | 3300044694 | Bacteria | 540 |
| 321 | Ga0466964_0001591 | 3300044706 | Bacteria | 7817 |
| 322 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 323 | Ga0453684_0000077 | 3300044712 | Bacteria | 435536 |
| 324 | Ga0453684_0001440 | 3300044712 | Bacteria | 67958 |
| 325 | Ga0466971_0007071 | 3300044719 | Bacteria | 4885 |
| 326 | Ga0466971_0137877 | 3300044719 | Bacteria | 1135 |
| 327 | Ga0466971_0304906 | 3300044719 | Bacteria | 765 |
| 328 | Ga0466968_0110146 | 3300044735 | Bacteria | 1237 |
| 329 | Ga0466970_0001088 | 3300044765 | Bacteria | 13183 |
| 330 | Ga0466970_0327377 | 3300044765 | Unclassified | 867 |
| 331 | Ga0466970_0567180 | 3300044765 | Bacteria | 657 |
| 332 | Ga0466957_0016078 | 3300044842 | Bacteria | 4374 |
| 333 | Ga0466957_0041940 | 3300044842 | Bacteria | 2767 |
| 334 | Ga0466957_0425080 | 3300044842 | Bacteria | 912 |
| 335 | Ga0466957_1118551 | 3300044842 | Bacteria | 568 |
| 336 | Ga0466960_0032649 | 3300044901 | Bacteria | 2412 |
| 337 | Ga0466960_1025507 | 3300044901 | Unclassified | 508 |
| 338 | Ga0466959_0000415 | 3300045049 | Bacteria | 24900 |
| 339 | Ga0466959_0021535 | 3300045049 | Bacteria | 4755 |
| 340 | Ga0466959_0432286 | 3300045049 | Bacteria | 893 |
| 341 | Ga0466959_0450501 | 3300045049 | Bacteria | 872 |
| 342 | Ga0466959_0774644 | 3300045049 | Bacteria | 642 |
| 343 | Ga0451576_0001215 | 3300045051 | Bacteria | 45894 |
| 344 | Ga0451576_2434180 | 3300045051 | Bacteria | 535 |
| 345 | Ga0451576_2522695 | 3300045051 | Unclassified | 525 |
| 346 | Ga0466958_0051708 | 3300045836 | Bacteria | 2488 |
| 347 | Ga0466958_0086822 | 3300045836 | Bacteria | 1931 |
| 348 | Ga0466958_0810564 | 3300045836 | Unclassified | 610 |
| 349 | Ga0466958_1068715 | 3300045836 | Unclassified | 527 |
| 350 | Ga0466967_0016641 | 3300045976 | Bacteria | 5807 |
| 351 | Ga0466967_0262517 | 3300045976 | Bacteria | 1652 |
| 352 | Ga0466967_1093562 | 3300045976 | Bacteria | 794 |
| 353 | Ga0495617_002536 | 3300046452 | Bacteria | 7212 |
| 354 | Ga0495603_0062002 | 3300046455 | Bacteria | 2208 |
| 355 | Ga0495629_0001542 | 3300046459 | Bacteria | 18094 |
| 356 | Ga0495638_0006093 | 3300046460 | Bacteria | 8828 |
| 357 | Ga0495651_0012482 | 3300046462 | Bacteria | 6552 |
| 358 | Ga0495651_0780848 | 3300046462 | Bacteria | 590 |
| 359 | Ga0495650_0000319 | 3300046471 | Bacteria | 86032 |
| 360 | Ga0495650_0039410 | 3300046471 | Bacteria | 2039 |
| 361 | Ga0495650_0042257 | 3300046471 | Bacteria | 1942 |
| 362 | Ga0495650_0239395 | 3300046471 | Bacteria | 620 |
| 363 | Ga0495605_0007310 | 3300046474 | Bacteria | 6274 |
| 364 | Ga0495605_0291379 | 3300046474 | Bacteria | 692 |
| 365 | Ga0495584_0007943 | 3300046491 | Bacteria | 5517 |
| 366 | Ga0495584_0024433 | 3300046491 | Bacteria | 3065 |
| 367 | Ga0495584_0056337 | 3300046491 | Bacteria | 1978 |
| 368 | Ga0495584_0089209 | 3300046491 | Unclassified | 1555 |
| 369 | Ga0495585_0008776 | 3300046492 | Bacteria | 6108 |
| 370 | Ga0495585_0009930 | 3300046492 | Bacteria | 5686 |
| 371 | Ga0495594_0045491 | 3300046499 | Bacteria | 2409 |
| 372 | Ga0495596_0016190 | 3300046500 | Bacteria | 3102 |
| 373 | Ga0495607_0026334 | 3300046501 | Bacteria | 3608 |
| 374 | Ga0495583_0001554 | 3300046506 | Bacteria | 22730 |
| 375 | Ga0495583_0017907 | 3300046506 | Bacteria | 3747 |
| 376 | Ga0495583_0369938 | 3300046506 | Bacteria | 564 |
| 377 | Ga0495583_0371988 | 3300046506 | Bacteria | 563 |
| 378 | Ga0495606_0000070 | 3300046507 | Bacteria | 177343 |
| 379 | Ga0495606_0026978 | 3300046507 | Bacteria | 4080 |
| 380 | Ga0495606_0147467 | 3300046507 | Bacteria | 1384 |
| 381 | Ga0495610_0099714 | 3300046512 | Bacteria | 1303 |
| 382 | Ga0495628_0000214 | 3300046516 | Bacteria | 50431 |
| 383 | Ga0495628_0003096 | 3300046516 | Bacteria | 14909 |
| 384 | Ga0495631_0008415 | 3300046518 | Bacteria | 5200 |
| 385 | Ga0495631_0038943 | 3300046518 | Bacteria | 2111 |
| 386 | Ga0495631_0055638 | 3300046518 | Bacteria | 1724 |
| 387 | Ga0495632_0090643 | 3300046519 | Bacteria | 1450 |
| 388 | Ga0495643_0068068 | 3300046522 | Bacteria | 1874 |
| 389 | Ga0495644_0161464 | 3300046523 | Bacteria | 859 |
| 390 | Ga0495666_0252753 | 3300046526 | Bacteria | 803 |
| 391 | Ga0495642_0106933 | 3300046528 | Bacteria | 1194 |
| 392 | Ga0495642_0120324 | 3300046528 | Bacteria | 1126 |
| 393 | Ga0495642_0195326 | 3300046528 | Unclassified | 882 |
| 394 | Ga0495652_0078476 | 3300046529 | Bacteria | 2733 |
| 395 | Ga0495652_0360170 | 3300046529 | Bacteria | 1039 |
| 396 | Ga0495654_0201605 | 3300046530 | Bacteria | 851 |
| 397 | Ga0495586_0445556 | 3300046535 | Bacteria | 746 |
| 398 | Ga0495609_0020470 | 3300046538 | Bacteria | 3058 |
| 399 | Ga0495609_0055399 | 3300046538 | Bacteria | 1759 |
| 400 | Ga0495597_0013284 | 3300046542 | Bacteria | 3950 |
| 401 | Ga0495597_0078691 | 3300046542 | Bacteria | 1412 |
| 402 | Ga0495597_0128829 | 3300046542 | Bacteria | 1050 |
| 403 | Ga0495622_0000130 | 3300046557 | Bacteria | 65123 |
| 404 | Ga0495622_0073679 | 3300046557 | Bacteria | 1575 |
| 405 | Ga0495633_0009805 | 3300046558 | Bacteria | 5264 |
| 406 | Ga0495633_0104408 | 3300046558 | Bacteria | 1315 |
| 407 | Ga0495633_0174480 | 3300046558 | Bacteria | 990 |
| 408 | Ga0495667_0438124 | 3300046559 | Unclassified | 822 |
| 409 | Ga0495668_0020680 | 3300046616 | Bacteria | 3783 |
| 410 | Ga0495668_0262260 | 3300046616 | Bacteria | 946 |
| 411 | Ga0495668_0263606 | 3300046616 | Bacteria | 943 |
| 412 | Ga0495668_0448210 | 3300046616 | Bacteria | 710 |
| 413 | Ga0495625_0740354 | 3300046660 | Bacteria | 577 |
| 414 | Ga0495635_0075144 | 3300046663 | Bacteria | 2315 |
| 415 | Ga0495661_0003080 | 3300046665 | Bacteria | 12539 |
| 416 | Ga0495661_0029100 | 3300046665 | Bacteria | 3529 |
| 417 | Ga0495661_0039611 | 3300046665 | Bacteria | 2927 |
| 418 | Ga0495661_0081270 | 3300046665 | Bacteria | 1868 |
| 419 | Ga0495661_0110697 | 3300046665 | Bacteria | 1531 |
| 420 | Ga0495661_0161181 | 3300046665 | Bacteria | 1204 |
| 421 | Ga0495661_0200824 | 3300046665 | Bacteria | 1044 |
| 422 | Ga0495588_0075157 | 3300046674 | Bacteria | 1760 |
| 423 | Ga0495588_0130709 | 3300046674 | Bacteria | 1324 |
| 424 | Ga0495623_0029070 | 3300046679 | Bacteria | 3558 |
| 425 | Ga0495669_0007914 | 3300046684 | Bacteria | 4464 |
| 426 | Ga0495624_0066566 | 3300046690 | Bacteria | 2249 |
| 427 | Ga0495624_0341158 | 3300046690 | Unclassified | 901 |
| 428 | Ga0495670_0002993 | 3300046691 | Bacteria | 8332 |
| 429 | Ga0495670_0009425 | 3300046691 | Bacteria | 4799 |
| 430 | Ga0495671_0270167 | 3300046692 | Bacteria | 820 |
| 431 | Ga0495671_0302318 | 3300046692 | Bacteria | 769 |
| 432 | Ga0495649_0230538 | 3300046694 | Bacteria | 956 |
| 433 | Ga0495589_0174117 | 3300046794 | Bacteria | 1022 |
| 434 | Ga0495660_0012227 | 3300046810 | Bacteria | 4982 |
| 435 | Ga0495581_0210951 | 3300047315 | Bacteria | 1135 |
| 436 | Ga0495604_0045382 | 3300047317 | Bacteria | 3430 |
| 437 | Ga0495674_0012343 | 3300047319 | Bacteria | 8047 |
| 438 | Ga0495674_0021280 | 3300047319 | Bacteria | 6000 |
| 439 | Ga0495674_0087929 | 3300047319 | Bacteria | 2658 |
| 440 | Ga0495672_0004866 | 3300047320 | Bacteria | 10805 |
| 441 | Ga0495683_0043528 | 3300047323 | Bacteria | 2260 |
| 442 | Ga0495687_046086 | 3300047443 | Bacteria | 1884 |
| 443 | Ga0495687_126340 | 3300047443 | Bacteria | 913 |
| 444 | Ga0495677_0232483 | 3300047445 | Bacteria | 719 |
| 445 | Ga0495677_0244672 | 3300047445 | Bacteria | 701 |
| 446 | Ga0495673_0036297 | 3300047469 | Bacteria | 2263 |
| 447 | Ga0495681_0008321 | 3300047470 | Bacteria | 6515 |
| 448 | Ga0495686_0000044 | 3300047472 | Bacteria | 288079 |
| 449 | Ga0495686_0095131 | 3300047472 | Bacteria | 1804 |
| 450 | Ga0495593_0096522 | 3300047673 | Bacteria | 1519 |
| 451 | Ga0495602_0183668 | 3300048088 | Bacteria | 1610 |
| 452 | Ga0495602_0639680 | 3300048088 | Bacteria | 727 |
| 453 | Ga0495602_0684501 | 3300048088 | Archaea | 697 |
| 454 | Ga0495615_0135107 | 3300048090 | Bacteria | 724 |
| 455 | Ga0495626_0001165 | 3300048091 | Bacteria | 21902 |
| 456 | Ga0495626_0031716 | 3300048091 | Bacteria | 2541 |
| 457 | Ga0496100_0042332 | 3300048903 | Bacteria | 2909 |
| 458 | Ga0496100_1495471 | 3300048903 | Unclassified | 533 |
| 459 | Ga0496100_1551160 | 3300048903 | Bacteria | 523 |
| 460 | Ga0496101_0033584 | 3300048904 | Bacteria | 3619 |
| 461 | Ga0496102_0343506 | 3300048905 | Bacteria | 1405 |
| 462 | Ga0496102_0446447 | 3300048905 | Bacteria | 1213 |
| 463 | Ga0496102_1126488 | 3300048905 | Bacteria | 704 |
| 464 | Ga0496103_0107900 | 3300048906 | Bacteria | 1766 |
| 465 | Ga0496103_0195417 | 3300048906 | Bacteria | 1301 |
| 466 | Ga0496103_0389194 | 3300048906 | Bacteria | 896 |
| 467 | Ga0496104_0826231 | 3300048907 | Bacteria | 832 |
| 468 | Ga0496104_1313029 | 3300048907 | Bacteria | 627 |
| 469 | Ga0496105_0100253 | 3300048908 | Bacteria | 2392 |
| 470 | Ga0496105_0243478 | 3300048908 | Bacteria | 1459 |
| 471 | Ga0496106_0857543 | 3300048909 | Bacteria | 719 |
| 472 | Ga0496108_0074217 | 3300048911 | Bacteria | 2872 |
| 473 | Ga0496109_0407673 | 3300048912 | Bacteria | 1284 |
| 474 | Ga0496109_1044373 | 3300048912 | Unclassified | 754 |
| 475 | Ga0496110_0135222 | 3300048913 | Bacteria | 2227 |
| 476 | Ga0496111_0428571 | 3300048914 | Bacteria | 977 |
| 477 | Ga0496111_0939595 | 3300048914 | Bacteria | 621 |
| 478 | Ga0496114_0148367 | 3300048917 | Bacteria | 2034 |
| 479 | Ga0496115_0127716 | 3300048918 | Bacteria | 2095 |
| 480 | Ga0496115_0180998 | 3300048918 | Bacteria | 1742 |
| 481 | Ga0496116_0120696 | 3300048919 | Bacteria | 1518 |
| 482 | Ga0496117_0173220 | 3300048920 | Bacteria | 1250 |
| 483 | Ga0496118_0000378 | 3300048921 | Bacteria | 74801 |
| 484 | Ga0496118_0225440 | 3300048921 | Bacteria | 1086 |
| 485 | Ga0496118_0461529 | 3300048921 | Bacteria | 642 |
| 486 | Ga0496118_0641646 | 3300048921 | Bacteria | 501 |
| 487 | Ga0496121_0539371 | 3300048924 | Bacteria | 732 |
| 488 | Ga0496122_0000018 | 3300048925 | Bacteria | 426350 |
| 489 | Ga0496122_0121679 | 3300048925 | Bacteria | 1681 |
| 490 | Ga0496123_0000015 | 3300048926 | Bacteria | 426088 |
| 491 | Ga0496123_0020681 | 3300048926 | Bacteria | 5141 |
| 492 | Ga0496124_0100832 | 3300048927 | Bacteria | 2340 |
| 493 | Ga0496125_0002112 | 3300048928 | Bacteria | 26704 |
| 494 | Ga0496125_0007190 | 3300048928 | Bacteria | 11870 |
| 495 | Ga0496125_0017207 | 3300048928 | Bacteria | 6909 |
| 496 | Ga0496126_0004109 | 3300048929 | Bacteria | 17613 |
| 497 | Ga0495678_001831 | 3300049459 | Bacteria | 15626 |
| 498 | Ga0495678_071359 | 3300049459 | Bacteria | 1272 |
| 499 | Ga0501067_0009870 | 3300049583 | Bacteria | 5286 |
| 500 | nmdc:mga0yw44_418407_c1 | 3300050492 | Bacteria | 907 |
| 501 | nmdc:mga0k408_2819_c2 | 3300050493 | Bacteria | 8839 |
| 502 | nmdc:mga0k408_290135_c1 | 3300050493 | Bacteria | 976 |
| 503 | nmdc:mga0k408_44306_c1 | 3300050493 | Bacteria | 2565 |
| 504 | Ga0500618_000096 | 3300053125 | Bacteria | 72003 |
| 505 | Ga0500618_007664 | 3300053125 | Bacteria | 3062 |
| 506 | Ga0500618_009766 | 3300053125 | Bacteria | 2606 |
| 507 | Ga0500622_0064505 | 3300053156 | Bacteria | 1863 |
| 508 | Ga0500624_012022 | 3300053157 | Bacteria | 1273 |
| 509 | Ga0500633_0276124 | 3300053160 | Bacteria | 622 |
| 510 | Ga0500645_011016 | 3300053730 | Bacteria | 2968 |
| 511 | Ga0500645_043691 | 3300053730 | Bacteria | 1319 |
| 512 | Ga0466962_0043183 | 3300061719 | Bacteria | 2157 |
| 513 | Ga0466962_0406816 | 3300061719 | Unclassified | 682 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048090 | Ga0495615_0135107 | Ga0495615_0135107_25_441 | 123 |
| 2 | 3300045836 | Ga0466958_0810564 | Ga0466958_0810564_219_599 | 126 |
| 3 | iso_pu_bacteria | 2501025504 | 2501414402 | 134 |
| 4 | iso_pu_bacteria | 2510917014 | 2511099654 | 134 |
| 5 | iso_pu_bacteria | 2510917015 | 2511106829 | 134 |
| 6 | iso_pu_bacteria | 2511231002 | 2511243646 | 134 |
| 7 | iso_pu_bacteria | 2513237166 | 2514050800 | 134 |
| 8 | iso_pu_bacteria | 2515154189 | 2516022953 | 134 |
| 9 | iso_pu_bacteria | 2596583598 | 2597028048 | 134 |
| 10 | iso_pu_bacteria | 2599185178 | 2599444722 | 134 |
| 11 | iso_pu_bacteria | 2721755763 | 2723875782 | 134 |
| 12 | iso_pu_bacteria | 2791355137 | 2792833653 | 134 |
| 13 | iso_pu_bacteria | 2818991461 | 2819685880 | 134 |
| 14 | iso_pu_bacteria | 2838736955 | 2838739686 | 134 |
| 15 | iso_pu_bacteria | 2841840854 | 2841844190 | 134 |
| 16 | iso_pu_bacteria | 2842140634 | 2842143911 | 134 |
| 17 | iso_pu_bacteria | 2842324504 | 2842332619 | 134 |
| 18 | iso_pu_bacteria | 2842348783 | 2842355950 | 134 |
| 19 | iso_pu_bacteria | 2842454564 | 2842460994 | 134 |
| 20 | iso_pu_bacteria | 2854916844 | 2854918821 | 134 |
| 21 | iso_pu_bacteria | 2883087390 | 2883091492 | 134 |
| 22 | iso_pu_bacteria | 2900577576 | 2900578196 | 134 |
| 23 | iso_pu_bacteria | 2900577576 | 2900578399 | 134 |
| 24 | iso_pu_bacteria | 2904615490 | 2904618568 | 134 |
| 25 | iso_pu_bacteria | 2928058823 | 2928059858 | 134 |
| 26 | iso_pu_bacteria | 8054460903 | 8054461066 | 134 |
| 27 | 3300001915 | JGI24741J21665_1004919 | JGI24741J21665_10049195 | 138 |
| 28 | 3300001979 | JGI24740J21852_10000068 | JGI24740J21852_1000006834 | 138 |
| 29 | 3300001979 | JGI24740J21852_10000165 | JGI24740J21852_1000016521 | 138 |
| 30 | 3300001979 | JGI24740J21852_10001559 | JGI24740J21852_100015598 | 138 |
| 31 | 3300002067 | JGI24735J21928_10032090 | JGI24735J21928_100320902 | 138 |
| 32 | 3300002705 | JGI25156J39149_1018613 | JGI25156J39149_10186132 | 138 |
| 33 | 3300002705 | JGI25156J39149_1019183 | JGI25156J39149_10191832 | 138 |
| 34 | 3300002705 | JGI25156J39149_1035552 | JGI25156J39149_10355521 | 138 |
| 35 | 3300002737 | JGI25162J39368_1000079 | JGI25162J39368_100007977 | 138 |
| 36 | 3300002771 | JGI25163J39215_1005496 | JGI25163J39215_10054962 | 138 |
| 37 | 3300002774 | JGI25150J39212_1004070 | JGI25150J39212_10040702 | 138 |
| 38 | 3300002774 | JGI25150J39212_1006550 | JGI25150J39212_10065504 | 138 |
| 39 | 3300002987 | JGI25159J45721_1000295 | JGI25159J45721_100029518 | 138 |
| 40 | 3300003187 | JGI25151J46595_10005589 | JGI25151J46595_100055894 | 138 |
| 41 | 3300003187 | JGI25151J46595_10006626 | JGI25151J46595_100066267 | 138 |
| 42 | 3300003214 | JGI25165J46597_1000135 | JGI25165J46597_100013583 | 138 |
| 43 | 3300003320 | rootH2_10229482 | rootH2_102294822 | 138 |
| 44 | 3300003323 | rootH1_10324460 | rootH1_103244603 | 138 |
| 45 | 3300003354 | JGI25160J50197_1000223 | JGI25160J50197_100022318 | 138 |
| 46 | 3300003374 | JGI25161J50226_1000013 | JGI25161J50226_1000013145 | 138 |
| 47 | 3300003578 | Ga0006562J51391_1196130 | Ga0006562J51391_11961302 | 138 |
| 48 | 3300003751 | Ga0055538_1000055 | Ga0055538_100005583 | 138 |
| 49 | 3300003751 | Ga0055538_1001015 | Ga0055538_10010151 | 138 |
| 50 | 3300003751 | Ga0055538_1001935 | Ga0055538_10019352 | 138 |
| 51 | 3300003751 | Ga0055538_1003845 | Ga0055538_10038452 | 138 |
| 52 | 3300003751 | Ga0055538_1004025 | Ga0055538_10040252 | 138 |
| 53 | 3300003752 | Ga0055539_1000080 | Ga0055539_100008021 | 138 |
| 54 | 3300003752 | Ga0055539_1000081 | Ga0055539_10000811 | 138 |
| 55 | 3300003752 | Ga0055539_1000201 | Ga0055539_100020126 | 138 |
| 56 | 3300003756 | Ga0055533_1000086 | Ga0055533_100008621 | 138 |
| 57 | 3300003756 | Ga0055533_1004854 | Ga0055533_10048542 | 138 |
| 58 | 3300003756 | Ga0055533_1007168 | Ga0055533_10071682 | 138 |
| 59 | 3300003756 | Ga0055533_1007546 | Ga0055533_10075462 | 138 |
| 60 | 3300003756 | Ga0055533_1008633 | Ga0055533_10086332 | 138 |
| 61 | 3300003758 | Ga0055532_1000048 | Ga0055532_1000048134 | 138 |
| 62 | 3300003758 | Ga0055532_1000073 | Ga0055532_100007311 | 138 |
| 63 | 3300003759 | Ga0055525_1000114 | Ga0055525_100011483 | 138 |
| 64 | 3300003759 | Ga0055525_1000640 | Ga0055525_100064014 | 138 |
| 65 | 3300003759 | Ga0055525_1000820 | Ga0055525_10008203 | 138 |
| 66 | 3300003760 | Ga0055527_1001283 | Ga0055527_10012837 | 138 |
| 67 | 3300003760 | Ga0055527_1001715 | Ga0055527_10017156 | 138 |
| 68 | 3300003761 | Ga0055535_1000035 | Ga0055535_1000035134 | 138 |
| 69 | 3300003761 | Ga0055535_1000055 | Ga0055535_100005511 | 138 |
| 70 | 3300003763 | Ga0055529_1000101 | Ga0055529_100010136 | 138 |
| 71 | 3300003763 | Ga0055529_1000877 | Ga0055529_100087717 | 138 |
| 72 | 3300003771 | Ga0055526_1037248 | Ga0055526_10372481 | 138 |
| 73 | 3300003773 | Ga0055537_1011474 | Ga0055537_10114743 | 138 |
| 74 | 3300003784 | Ga0055534_1030703 | Ga0055534_10307031 | 138 |
| 75 | 3300003791 | Ga0055530_10012725 | Ga0055530_100127253 | 138 |
| 76 | 3300003841 | Ga0055541_1000057 | Ga0055541_100005721 | 138 |
| 77 | 3300003841 | Ga0055541_1000601 | Ga0055541_10006012 | 138 |
| 78 | 3300003841 | Ga0055541_1005563 | Ga0055541_10055632 | 138 |
| 79 | 3300003841 | Ga0055541_1009153 | Ga0055541_10091532 | 138 |
| 80 | 3300003841 | Ga0055541_1011830 | Ga0055541_10118302 | 138 |
| 81 | 3300004625 | Ga0055543_1000211 | Ga0055543_100021131 | 138 |
| 82 | 3300005329 | Ga0070683_100638034 | Ga0070683_1006380341 | 138 |
| 83 | 3300005335 | Ga0070666_10137808 | Ga0070666_101378082 | 138 |
| 84 | 3300005337 | Ga0070682_100076290 | Ga0070682_1000762904 | 138 |
| 85 | 3300005337 | Ga0070682_101165173 | Ga0070682_1011651731 | 138 |
| 86 | 3300005343 | Ga0070687_100042021 | Ga0070687_1000420212 | 138 |
| 87 | 3300005344 | Ga0070661_100000061 | Ga0070661_10000006162 | 138 |
| 88 | 3300005344 | Ga0070661_100000093 | Ga0070661_10000009375 | 138 |
| 89 | 3300005344 | Ga0070661_100176890 | Ga0070661_1001768901 | 138 |
| 90 | 3300005344 | Ga0070661_100214892 | Ga0070661_1002148922 | 138 |
| 91 | 3300005354 | Ga0070675_100934448 | Ga0070675_1009344482 | 138 |
| 92 | 3300005355 | Ga0070671_100153176 | Ga0070671_1001531764 | 138 |
| 93 | 3300005356 | Ga0070674_100660726 | Ga0070674_1006607261 | 138 |
| 94 | 3300005366 | Ga0070659_100740194 | Ga0070659_1007401941 | 138 |
| 95 | 3300005367 | Ga0070667_101043425 | Ga0070667_1010434252 | 138 |
| 96 | 3300005436 | Ga0070713_100098224 | Ga0070713_1000982246 | 138 |
| 97 | 3300005436 | Ga0070713_100503711 | Ga0070713_1005037112 | 138 |
| 98 | 3300005455 | Ga0070663_100000009 | Ga0070663_10000000940 | 138 |
| 99 | 3300005455 | Ga0070663_100000024 | Ga0070663_1000000241 | 138 |
| 100 | 3300005455 | Ga0070663_100147335 | Ga0070663_1001473353 | 138 |
| 101 | 3300005455 | Ga0070663_100247361 | Ga0070663_1002473612 | 138 |
| 102 | 3300005457 | Ga0070662_100620969 | Ga0070662_1006209691 | 138 |
| 103 | 3300005459 | Ga0068867_101446660 | Ga0068867_1014466602 | 138 |
| 104 | 3300005563 | Ga0068855_100460112 | Ga0068855_1004601122 | 138 |
| 105 | 3300005564 | Ga0070664_100000010 | Ga0070664_10000001034 | 138 |
| 106 | 3300005564 | Ga0070664_100000022 | Ga0070664_1000000221 | 138 |
| 107 | 3300005564 | Ga0070664_100106292 | Ga0070664_1001062924 | 138 |
| 108 | 3300005564 | Ga0070664_100163160 | Ga0070664_1001631601 | 138 |
| 109 | 3300005577 | Ga0068857_100011536 | Ga0068857_10001153610 | 138 |
| 110 | 3300005577 | Ga0068857_100039179 | Ga0068857_1000391792 | 138 |
| 111 | 3300005577 | Ga0068857_100833646 | Ga0068857_1008336462 | 138 |
| 112 | 3300005578 | Ga0068854_100000077 | Ga0068854_10000007757 | 138 |
| 113 | 3300005578 | Ga0068854_100000088 | Ga0068854_10000008867 | 138 |
| 114 | 3300005578 | Ga0068854_101788471 | Ga0068854_1017884711 | 138 |
| 115 | 3300005614 | Ga0068856_100000049 | Ga0068856_1000000491 | 138 |
| 116 | 3300005614 | Ga0068856_100000069 | Ga0068856_10000006910 | 138 |
| 117 | 3300005616 | Ga0068852_100091229 | Ga0068852_1000912292 | 138 |
| 118 | 3300005616 | Ga0068852_100505022 | Ga0068852_1005050222 | 138 |
| 119 | 3300005841 | Ga0068863_102396890 | Ga0068863_1023968901 | 138 |
| 120 | 3300005937 | Ga0081455_10311175 | Ga0081455_103111752 | 138 |
| 121 | 3300006028 | Ga0070717_10039890 | Ga0070717_100398904 | 138 |
| 122 | 3300006048 | Ga0075363_100036886 | Ga0075363_1000368863 | 138 |
| 123 | 3300006051 | Ga0075364_10010177 | Ga0075364_100101776 | 138 |
| 124 | 3300006173 | Ga0070716_100316109 | Ga0070716_1003161092 | 138 |
| 125 | 3300006195 | Ga0075366_10003812 | Ga0075366_100038125 | 138 |
| 126 | 3300006195 | Ga0075366_10183672 | Ga0075366_101836722 | 138 |
| 127 | 3300006195 | Ga0075366_10274515 | Ga0075366_102745152 | 138 |
| 128 | 3300006358 | Ga0068871_100112759 | Ga0068871_1001127592 | 138 |
| 129 | 3300006358 | Ga0068871_102129948 | Ga0068871_1021299481 | 138 |
| 130 | 3300006946 | Ga0079104_1000033 | Ga0079104_100003313 | 138 |
| 131 | 3300009036 | Ga0105244_10170616 | Ga0105244_101706162 | 138 |
| 132 | 3300009092 | Ga0105250_10184252 | Ga0105250_101842521 | 138 |
| 133 | 3300009093 | Ga0105240_10059453 | Ga0105240_100594534 | 138 |
| 134 | 3300009093 | Ga0105240_10151469 | Ga0105240_101514693 | 138 |
| 135 | 3300009093 | Ga0105240_10158069 | Ga0105240_101580692 | 138 |
| 136 | 3300009093 | Ga0105240_10392540 | Ga0105240_103925402 | 138 |
| 137 | 3300009093 | Ga0105240_10496802 | Ga0105240_104968022 | 138 |
| 138 | 3300009098 | Ga0105245_10333101 | Ga0105245_103331012 | 138 |
| 139 | 3300009101 | Ga0105247_10173988 | Ga0105247_101739882 | 138 |
| 140 | 3300009174 | Ga0105241_10405089 | Ga0105241_104050891 | 138 |
| 141 | 3300009174 | Ga0105241_10767865 | Ga0105241_107678652 | 138 |
| 142 | 3300009177 | Ga0105248_10025385 | Ga0105248_100253855 | 138 |
| 143 | 3300011119 | Ga0105246_10107305 | Ga0105246_101073052 | 138 |
| 144 | 3300013100 | Ga0157373_10070355 | Ga0157373_100703552 | 138 |
| 145 | 3300013100 | Ga0157373_10166796 | Ga0157373_101667962 | 138 |
| 146 | 3300013102 | Ga0157371_10000088 | Ga0157371_10000088113 | 138 |
| 147 | 3300013102 | Ga0157371_10000089 | Ga0157371_100000891 | 138 |
| 148 | 3300013102 | Ga0157371_10054674 | Ga0157371_100546742 | 138 |
| 149 | 3300013104 | Ga0157370_10000002 | Ga0157370_10000002252 | 138 |
| 150 | 3300013104 | Ga0157370_10000041 | Ga0157370_10000041113 | 138 |
| 151 | 3300013104 | Ga0157370_11254720 | Ga0157370_112547201 | 138 |
| 152 | 3300013105 | Ga0157369_10000138 | Ga0157369_1000013831 | 138 |
| 153 | 3300013105 | Ga0157369_10000233 | Ga0157369_1000023321 | 138 |
| 154 | 3300013105 | Ga0157369_10003845 | Ga0157369_100038457 | 138 |
| 155 | 3300013105 | Ga0157369_10004358 | Ga0157369_1000435810 | 138 |
| 156 | 3300013105 | Ga0157369_10100340 | Ga0157369_101003405 | 138 |
| 157 | 3300013105 | Ga0157369_10348990 | Ga0157369_103489902 | 138 |
| 158 | 3300013296 | Ga0157374_10999331 | Ga0157374_109993312 | 138 |
| 159 | 3300013297 | Ga0157378_10879906 | Ga0157378_108799061 | 138 |
| 160 | 3300013306 | Ga0163162_10011368 | Ga0163162_100113686 | 138 |
| 161 | 3300013307 | Ga0157372_10000363 | Ga0157372_100003631 | 138 |
| 162 | 3300013308 | Ga0157375_10020561 | Ga0157375_100205611 | 138 |
| 163 | 3300015261 | Ga0182006_1000917 | Ga0182006_100091712 | 138 |
| 164 | 3300015261 | Ga0182006_1005883 | Ga0182006_10058835 | 138 |
| 165 | 3300015262 | Ga0182007_10018289 | Ga0182007_100182892 | 138 |
| 166 | 3300015265 | Ga0182005_1065890 | Ga0182005_10658902 | 138 |
| 167 | 3300017792 | Ga0163161_10286938 | Ga0163161_102869382 | 138 |
| 168 | 3300020077 | Ga0206351_10441816 | Ga0206351_104418162 | 138 |
| 169 | 3300020081 | Ga0206354_11129042 | Ga0206354_111290424 | 138 |
| 170 | 3300020082 | Ga0206353_11265201 | Ga0206353_112652012 | 138 |
| 171 | 3300020610 | Ga0154015_1281252 | Ga0154015_12812527 | 138 |
| 172 | 3300020610 | Ga0154015_1319505 | Ga0154015_13195052 | 138 |
| 173 | 3300025207 | Ga0209760_100874 | Ga0209760_1008743 | 138 |
| 174 | 3300025208 | Ga0209436_105523 | Ga0209436_1055233 | 138 |
| 175 | 3300025224 | Ga0209784_100008 | Ga0209784_100008214 | 138 |
| 176 | 3300025224 | Ga0209784_100010 | Ga0209784_10001088 | 138 |
| 177 | 3300025224 | Ga0209784_100024 | Ga0209784_100024226 | 138 |
| 178 | 3300025224 | Ga0209784_102577 | Ga0209784_1025772 | 138 |
| 179 | 3300025225 | Ga0209566_100006 | Ga0209566_100006214 | 138 |
| 180 | 3300025225 | Ga0209566_100008 | Ga0209566_10000888 | 138 |
| 181 | 3300025225 | Ga0209566_100018 | Ga0209566_100018226 | 138 |
| 182 | 3300025225 | Ga0209566_100582 | Ga0209566_10058212 | 138 |
| 183 | 3300025225 | Ga0209566_100612 | Ga0209566_10061211 | 138 |
| 184 | 3300025226 | Ga0209674_100019 | Ga0209674_10001988 | 138 |
| 185 | 3300025226 | Ga0209674_100045 | Ga0209674_10004597 | 138 |
| 186 | 3300025226 | Ga0209674_100046 | Ga0209674_100046137 | 138 |
| 187 | 3300025226 | Ga0209674_100870 | Ga0209674_1008707 | 138 |
| 188 | 3300025226 | Ga0209674_103063 | Ga0209674_1030633 | 138 |
| 189 | 3300025226 | Ga0209674_106797 | Ga0209674_1067973 | 138 |
| 190 | 3300025228 | Ga0209672_100127 | Ga0209672_10012745 | 138 |
| 191 | 3300025228 | Ga0209672_100650 | Ga0209672_10065020 | 138 |
| 192 | 3300025229 | Ga0209147_100005 | Ga0209147_100005208 | 138 |
| 193 | 3300025229 | Ga0209147_100008 | Ga0209147_100008152 | 138 |
| 194 | 3300025230 | Ga0209563_100016 | Ga0209563_100016214 | 138 |
| 195 | 3300025230 | Ga0209563_100021 | Ga0209563_10002188 | 138 |
| 196 | 3300025230 | Ga0209563_100039 | Ga0209563_100039137 | 138 |
| 197 | 3300025230 | Ga0209563_100090 | Ga0209563_100090102 | 138 |
| 198 | 3300025230 | Ga0209563_102848 | Ga0209563_1028482 | 138 |
| 199 | 3300025230 | Ga0209563_105007 | Ga0209563_1050072 | 138 |
| 200 | 3300025230 | Ga0209563_105643 | Ga0209563_1056432 | 138 |
| 201 | 3300025231 | Ga0207427_102464 | Ga0207427_1024643 | 138 |
| 202 | 3300025233 | Ga0209437_100019 | Ga0209437_10001988 | 138 |
| 203 | 3300025242 | Ga0209258_100007 | Ga0209258_100007208 | 138 |
| 204 | 3300025242 | Ga0209258_100013 | Ga0209258_100013152 | 138 |
| 205 | 3300025245 | Ga0207425_1002014 | Ga0207425_10020147 | 138 |
| 206 | 3300025250 | Ga0209026_1035270 | Ga0209026_10352702 | 138 |
| 207 | 3300025253 | Ga0209677_100008 | Ga0209677_100008478 | 138 |
| 208 | 3300025253 | Ga0209677_100011 | Ga0209677_10001188 | 138 |
| 209 | 3300025253 | Ga0209677_100024 | Ga0209677_100024135 | 138 |
| 210 | 3300025254 | Ga0209148_1001888 | Ga0209148_10018882 | 138 |
| 211 | 3300025254 | Ga0209148_1002127 | Ga0209148_10021277 | 138 |
| 212 | 3300025256 | Ga0209759_1002288 | Ga0209759_100228813 | 138 |
| 213 | 3300025256 | Ga0209759_1004083 | Ga0209759_10040835 | 138 |
| 214 | 3300025256 | Ga0209759_1005154 | Ga0209759_10051543 | 138 |
| 215 | 3300025256 | Ga0209759_1018784 | Ga0209759_10187842 | 138 |
| 216 | 3300025256 | Ga0209759_1029053 | Ga0209759_10290531 | 138 |
| 217 | 3300025258 | Ga0209129_1004929 | Ga0209129_10049293 | 138 |
| 218 | 3300025261 | Ga0209233_1000025 | Ga0209233_100002588 | 138 |
| 219 | 3300025263 | Ga0209565_1000768 | Ga0209565_100076814 | 138 |
| 220 | 3300025272 | Ga0209455_1000011 | Ga0209455_1000011133 | 138 |
| 221 | 3300025272 | Ga0209455_1000042 | Ga0209455_1000042152 | 138 |
| 222 | 3300025284 | Ga0209130_1000064 | Ga0209130_1000064137 | 138 |
| 223 | 3300025291 | Ga0209675_1004319 | Ga0209675_10043198 | 138 |
| 224 | 3300025292 | Ga0209676_1001583 | Ga0209676_100158316 | 138 |
| 225 | 3300025294 | Ga0209025_1003115 | Ga0209025_100311512 | 138 |
| 226 | 3300025295 | Ga0209564_1006428 | Ga0209564_10064286 | 138 |
| 227 | 3300025297 | Ga0209758_1013860 | Ga0209758_10138605 | 138 |
| 228 | 3300025297 | Ga0209758_1041073 | Ga0209758_10410733 | 138 |
| 229 | 3300025298 | Ga0209050_1005684 | Ga0209050_10056847 | 138 |
| 230 | 3300025299 | Ga0209256_1026726 | Ga0209256_10267262 | 138 |
| 231 | 3300025302 | Ga0207426_1000116 | Ga0207426_1000116114 | 138 |
| 232 | 3300025303 | Ga0209051_1096316 | Ga0209051_10963161 | 138 |
| 233 | 3300025304 | Ga0209257_1018538 | Ga0209257_10185384 | 138 |
| 234 | 3300025900 | Ga0207710_10295499 | Ga0207710_102954992 | 138 |
| 235 | 3300025903 | Ga0207680_10084147 | Ga0207680_100841472 | 138 |
| 236 | 3300025911 | Ga0207654_10591546 | Ga0207654_105915461 | 138 |
| 237 | 3300025913 | Ga0207695_10000739 | Ga0207695_1000073949 | 138 |
| 238 | 3300025913 | Ga0207695_10005647 | Ga0207695_1000564716 | 138 |
| 239 | 3300025913 | Ga0207695_10193665 | Ga0207695_101936652 | 138 |
| 240 | 3300025913 | Ga0207695_10626388 | Ga0207695_106263881 | 138 |
| 241 | 3300025916 | Ga0207663_11350797 | Ga0207663_113507971 | 138 |
| 242 | 3300025918 | Ga0207662_10066541 | Ga0207662_100665412 | 138 |
| 243 | 3300025920 | Ga0207649_10000588 | Ga0207649_100005881 | 138 |
| 244 | 3300025920 | Ga0207649_10001707 | Ga0207649_100017078 | 138 |
| 245 | 3300025928 | Ga0207700_10802136 | Ga0207700_108021362 | 138 |
| 246 | 3300025932 | Ga0207690_10026235 | Ga0207690_100262353 | 138 |
| 247 | 3300025932 | Ga0207690_10988618 | Ga0207690_109886181 | 138 |
| 248 | 3300025939 | Ga0207665_10205609 | Ga0207665_102056092 | 138 |
| 249 | 3300025941 | Ga0207711_10033590 | Ga0207711_100335905 | 138 |
| 250 | 3300025945 | Ga0207679_10000002 | Ga0207679_10000002505 | 138 |
| 251 | 3300025945 | Ga0207679_10000004 | Ga0207679_10000004411 | 138 |
| 252 | 3300025945 | Ga0207679_10542975 | Ga0207679_105429751 | 138 |
| 253 | 3300025949 | Ga0207667_10005394 | Ga0207667_1000539414 | 138 |
| 254 | 3300025981 | Ga0207640_10000058 | Ga0207640_1000005830 | 138 |
| 255 | 3300025981 | Ga0207640_10000358 | Ga0207640_100003582 | 138 |
| 256 | 3300025986 | Ga0207658_11008787 | Ga0207658_110087872 | 138 |
| 257 | 3300026067 | Ga0207678_10000012 | Ga0207678_100000121 | 138 |
| 258 | 3300026067 | Ga0207678_10000018 | Ga0207678_10000018110 | 138 |
| 259 | 3300026067 | Ga0207678_10061760 | Ga0207678_100617603 | 138 |
| 260 | 3300026067 | Ga0207678_10433218 | Ga0207678_104332182 | 138 |
| 261 | 3300026075 | Ga0207708_10427258 | Ga0207708_104272582 | 138 |
| 262 | 3300026078 | Ga0207702_10000020 | Ga0207702_1000002054 | 138 |
| 263 | 3300026078 | Ga0207702_10000053 | Ga0207702_1000005348 | 138 |
| 264 | 3300026088 | Ga0207641_11512818 | Ga0207641_115128182 | 138 |
| 265 | 3300026089 | Ga0207648_10341686 | Ga0207648_103416863 | 138 |
| 266 | 3300026116 | Ga0207674_10001653 | Ga0207674_1000165324 | 138 |
| 267 | 3300026116 | Ga0207674_10021641 | Ga0207674_100216414 | 138 |
| 268 | 3300026116 | Ga0207674_11528258 | Ga0207674_115282581 | 138 |
| 269 | 3300026121 | Ga0207683_10137905 | Ga0207683_101379052 | 138 |
| 270 | 3300026142 | Ga0207698_10384078 | Ga0207698_103840782 | 138 |
| 271 | 3300026142 | Ga0207698_10602226 | Ga0207698_106022262 | 138 |
| 272 | 3300026142 | Ga0207698_10797583 | Ga0207698_107975832 | 138 |
| 273 | 3300026142 | Ga0207698_12695378 | Ga0207698_126953781 | 138 |
| 274 | 3300027111 | Ga0209281_1000043 | Ga0209281_1000043151 | 138 |
| 275 | 3300028786 | Ga0307517_10321612 | Ga0307517_103216122 | 138 |
| 276 | 3300028800 | Ga0265338_10000092 | Ga0265338_1000009253 | 138 |
| 277 | 3300030742 | Ga0316183_1116527 | Ga0316183_11165271 | 138 |
| 278 | 3300030744 | Ga0316181_1137718 | Ga0316181_11377181 | 138 |
| 279 | 3300031456 | Ga0307513_10000316 | Ga0307513_1000031648 | 138 |
| 280 | 3300031548 | Ga0307408_100035846 | Ga0307408_1000358462 | 138 |
| 281 | 3300031616 | Ga0307508_10022414 | Ga0307508_100224142 | 138 |
| 282 | 3300031730 | Ga0307516_10001925 | Ga0307516_1000192519 | 138 |
| 283 | 3300031730 | Ga0307516_10061874 | Ga0307516_100618743 | 138 |
| 284 | 3300031731 | Ga0307405_10188848 | Ga0307405_101888482 | 138 |
| 285 | 3300031911 | Ga0307412_11485752 | Ga0307412_114857521 | 138 |
| 286 | 3300031995 | Ga0307409_100323670 | Ga0307409_1003236703 | 138 |
| 287 | 3300032005 | Ga0307411_11247640 | Ga0307411_112476401 | 138 |
| 288 | 3300032005 | Ga0307411_11707039 | Ga0307411_117070391 | 138 |
| 289 | 3300033179 | Ga0307507_10201025 | Ga0307507_102010252 | 138 |
| 290 | 3300035089 | Ga0373944_0046347 | Ga0373944_0046347_42_470 | 138 |
| 291 | 3300037312 | Ga0395899_0578009 | Ga0395899_0578009_12_428 | 138 |
| 292 | 3300037312 | Ga0395899_0764734 | Ga0395899_0764734_41_460 | 138 |
| 293 | 3300037418 | Ga0395900_0001682 | Ga0395900_0001682_13437_13856 | 138 |
| 294 | 3300037418 | Ga0395900_0004085 | Ga0395900_0004085_9162_9578 | 138 |
| 295 | 3300037418 | Ga0395900_0332884 | Ga0395900_0332884_442_858 | 138 |
| 296 | 3300037418 | Ga0395900_0436436 | Ga0395900_0436436_98_517 | 138 |
| 297 | 3300037418 | Ga0395900_0636590 | Ga0395900_0636590_47_463 | 138 |
| 298 | 3300037466 | Ga0395898_0006835 | Ga0395898_0006835_5354_5770 | 138 |
| 299 | 3300037466 | Ga0395898_0109504 | Ga0395898_0109504_1448_1864 | 138 |
| 300 | 3300037466 | Ga0395898_0342169 | Ga0395898_0342169_264_680 | 138 |
| 301 | 3300037466 | Ga0395898_0767300 | Ga0395898_0767300_407_826 | 138 |
| 302 | 3300037471 | Ga0395905_0000017 | Ga0395905_0000017_351794_352210 | 138 |
| 303 | 3300037471 | Ga0395905_0407210 | Ga0395905_0407210_114_530 | 138 |
| 304 | 3300038443 | Ga0395901_0000003 | Ga0395901_0000003_312432_312848 | 138 |
| 305 | 3300038443 | Ga0395901_0000576 | Ga0395901_0000576_1712_2128 | 138 |
| 306 | 3300038443 | Ga0395901_0296622 | Ga0395901_0296622_619_1035 | 138 |
| 307 | 3300038443 | Ga0395901_0403792 | Ga0395901_0403792_86_502 | 138 |
| 308 | 3300038443 | Ga0395901_0528219 | Ga0395901_0528219_549_965 | 138 |
| 309 | 3300038443 | Ga0395901_1236963 | Ga0395901_1236963_92_508 | 138 |
| 310 | 3300041451 | Ga0451791_1272617 | Ga0451791_1272617_656_1072 | 138 |
| 311 | 3300041512 | Ga0451853_3666298 | Ga0451853_3666298_136_552 | 138 |
| 312 | 3300042005 | Ga0439448_0004132 | Ga0439448_0004132_29_445 | 138 |
| 313 | 3300042157 | Ga0439458_0051408 | Ga0439458_0051408_572_988 | 138 |
| 314 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_6522_6938 | 138 |
| 315 | 3300042876 | Ga0451577_1279088 | Ga0451577_1279088_17_433 | 138 |
| 316 | 3300044650 | Ga0466986_0035085 | Ga0466986_0035085_2736_3152 | 138 |
| 317 | 3300044650 | Ga0466986_0132431 | Ga0466986_0132431_727_1146 | 138 |
| 318 | 3300044656 | Ga0466969_0052369 | Ga0466969_0052369_283_699 | 138 |
| 319 | 3300044656 | Ga0466969_0070884 | Ga0466969_0070884_1053_1472 | 138 |
| 320 | 3300044656 | Ga0466969_0279018 | Ga0466969_0279018_301_717 | 138 |
| 321 | 3300044656 | Ga0466969_0330735 | Ga0466969_0330735_87_515 | 138 |
| 322 | 3300044658 | Ga0466972_0000525 | Ga0466972_0000525_15360_15779 | 138 |
| 323 | 3300044658 | Ga0466972_0014565 | Ga0466972_0014565_3401_3817 | 138 |
| 324 | 3300044658 | Ga0466972_0204027 | Ga0466972_0204027_69_485 | 138 |
| 325 | 3300044666 | Ga0466977_0538646 | Ga0466977_0538646_205_624 | 138 |
| 326 | 3300044671 | Ga0466978_0040083 | Ga0466978_0040083_178_597 | 138 |
| 327 | 3300044672 | Ga0466982_0020349 | Ga0466982_0020349_2889_3308 | 138 |
| 328 | 3300044673 | Ga0453683_0000003 | Ga0453683_0000003_6522_6938 | 138 |
| 329 | 3300044683 | Ga0466965_0027509 | Ga0466965_0027509_1331_1747 | 138 |
| 330 | 3300044683 | Ga0466965_0195448 | Ga0466965_0195448_283_699 | 138 |
| 331 | 3300044683 | Ga0466965_0350948 | Ga0466965_0350948_250_666 | 138 |
| 332 | 3300044683 | Ga0466965_0854512 | Ga0466965_0854512_84_500 | 138 |
| 333 | 3300044684 | Ga0466966_0001454 | Ga0466966_0001454_5314_5730 | 138 |
| 334 | 3300044684 | Ga0466966_0036383 | Ga0466966_0036383_418_834 | 138 |
| 335 | 3300044684 | Ga0466966_0100654 | Ga0466966_0100654_662_1078 | 138 |
| 336 | 3300044684 | Ga0466966_0101727 | Ga0466966_0101727_1102_1521 | 138 |
| 337 | 3300044684 | Ga0466966_0379324 | Ga0466966_0379324_369_785 | 138 |
| 338 | 3300044684 | Ga0466966_0455114 | Ga0466966_0455114_184_600 | 138 |
| 339 | 3300044693 | Ga0466961_0000200 | Ga0466961_0000200_21206_21625 | 138 |
| 340 | 3300044693 | Ga0466961_0118319 | Ga0466961_0118319_519_935 | 138 |
| 341 | 3300044693 | Ga0466961_0186266 | Ga0466961_0186266_328_744 | 138 |
| 342 | 3300044693 | Ga0466961_0195249 | Ga0466961_0195249_712_1128 | 138 |
| 343 | 3300044693 | Ga0466961_0727271 | Ga0466961_0727271_119_535 | 138 |
| 344 | 3300044694 | Ga0466963_0049837 | Ga0466963_0049837_1018_1434 | 138 |
| 345 | 3300044694 | Ga0466963_0300161 | Ga0466963_0300161_57_473 | 138 |
| 346 | 3300044694 | Ga0466963_1172793 | Ga0466963_1172793_52_471 | 138 |
| 347 | 3300044706 | Ga0466964_0001591 | Ga0466964_0001591_3066_3485 | 138 |
| 348 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_1724438_1724854 | 138 |
| 349 | 3300044712 | Ga0453684_0000077 | Ga0453684_0000077_162506_162922 | 138 |
| 350 | 3300044712 | Ga0453684_0001440 | Ga0453684_0001440_35879_36295 | 138 |
| 351 | 3300044719 | Ga0466971_0007071 | Ga0466971_0007071_2595_3011 | 138 |
| 352 | 3300044719 | Ga0466971_0137877 | Ga0466971_0137877_482_898 | 138 |
| 353 | 3300044719 | Ga0466971_0304906 | Ga0466971_0304906_218_637 | 138 |
| 354 | 3300044735 | Ga0466968_0110146 | Ga0466968_0110146_661_1080 | 138 |
| 355 | 3300044765 | Ga0466970_0001088 | Ga0466970_0001088_4822_5241 | 138 |
| 356 | 3300044765 | Ga0466970_0327377 | Ga0466970_0327377_202_618 | 138 |
| 357 | 3300044765 | Ga0466970_0567180 | Ga0466970_0567180_32_448 | 138 |
| 358 | 3300044842 | Ga0466957_0016078 | Ga0466957_0016078_3617_4033 | 138 |
| 359 | 3300044842 | Ga0466957_0041940 | Ga0466957_0041940_728_1144 | 138 |
| 360 | 3300044842 | Ga0466957_0425080 | Ga0466957_0425080_235_651 | 138 |
| 361 | 3300044842 | Ga0466957_1118551 | Ga0466957_1118551_29_445 | 138 |
| 362 | 3300044901 | Ga0466960_0032649 | Ga0466960_0032649_212_631 | 138 |
| 363 | 3300044901 | Ga0466960_1025507 | Ga0466960_1025507_31_447 | 138 |
| 364 | 3300045049 | Ga0466959_0000415 | Ga0466959_0000415_3649_4068 | 138 |
| 365 | 3300045049 | Ga0466959_0021535 | Ga0466959_0021535_919_1335 | 138 |
| 366 | 3300045049 | Ga0466959_0432286 | Ga0466959_0432286_105_521 | 138 |
| 367 | 3300045049 | Ga0466959_0450501 | Ga0466959_0450501_309_725 | 138 |
| 368 | 3300045049 | Ga0466959_0774644 | Ga0466959_0774644_156_572 | 138 |
| 369 | 3300045051 | Ga0451576_0001215 | Ga0451576_0001215_38957_39373 | 138 |
| 370 | 3300045051 | Ga0451576_2434180 | Ga0451576_2434180_22_438 | 138 |
| 371 | 3300045051 | Ga0451576_2522695 | Ga0451576_2522695_51_467 | 138 |
| 372 | 3300045836 | Ga0466958_0051708 | Ga0466958_0051708_775_1254 | 138 |
| 373 | 3300045836 | Ga0466958_0086822 | Ga0466958_0086822_1318_1737 | 138 |
| 374 | 3300045836 | Ga0466958_1068715 | Ga0466958_1068715_33_449 | 138 |
| 375 | 3300045976 | Ga0466967_0016641 | Ga0466967_0016641_3011_3430 | 138 |
| 376 | 3300045976 | Ga0466967_0262517 | Ga0466967_0262517_287_706 | 138 |
| 377 | 3300045976 | Ga0466967_1093562 | Ga0466967_1093562_55_471 | 138 |
| 378 | 3300046452 | Ga0495617_002536 | Ga0495617_002536_3604_4083 | 138 |
| 379 | 3300046455 | Ga0495603_0062002 | Ga0495603_0062002_553_969 | 138 |
| 380 | 3300046459 | Ga0495629_0001542 | Ga0495629_0001542_12583_12999 | 138 |
| 381 | 3300046460 | Ga0495638_0006093 | Ga0495638_0006093_5123_5539 | 138 |
| 382 | 3300046462 | Ga0495651_0012482 | Ga0495651_0012482_1079_1495 | 138 |
| 383 | 3300046462 | Ga0495651_0780848 | Ga0495651_0780848_152_568 | 138 |
| 384 | 3300046471 | Ga0495650_0000319 | Ga0495650_0000319_63500_63916 | 138 |
| 385 | 3300046471 | Ga0495650_0039410 | Ga0495650_0039410_231_647 | 138 |
| 386 | 3300046471 | Ga0495650_0042257 | Ga0495650_0042257_1394_1810 | 138 |
| 387 | 3300046471 | Ga0495650_0239395 | Ga0495650_0239395_88_504 | 138 |
| 388 | 3300046474 | Ga0495605_0007310 | Ga0495605_0007310_3259_3675 | 138 |
| 389 | 3300046474 | Ga0495605_0291379 | Ga0495605_0291379_179_595 | 138 |
| 390 | 3300046491 | Ga0495584_0007943 | Ga0495584_0007943_752_1168 | 138 |
| 391 | 3300046491 | Ga0495584_0024433 | Ga0495584_0024433_900_1316 | 138 |
| 392 | 3300046491 | Ga0495584_0056337 | Ga0495584_0056337_1359_1775 | 138 |
| 393 | 3300046491 | Ga0495584_0089209 | Ga0495584_0089209_806_1222 | 138 |
| 394 | 3300046492 | Ga0495585_0008776 | Ga0495585_0008776_3098_3514 | 138 |
| 395 | 3300046492 | Ga0495585_0009930 | Ga0495585_0009930_3561_3977 | 138 |
| 396 | 3300046499 | Ga0495594_0045491 | Ga0495594_0045491_1830_2246 | 138 |
| 397 | 3300046500 | Ga0495596_0016190 | Ga0495596_0016190_170_586 | 138 |
| 398 | 3300046501 | Ga0495607_0026334 | Ga0495607_0026334_1531_1947 | 138 |
| 399 | 3300046506 | Ga0495583_0001554 | Ga0495583_0001554_5030_5446 | 138 |
| 400 | 3300046506 | Ga0495583_0017907 | Ga0495583_0017907_306_722 | 138 |
| 401 | 3300046506 | Ga0495583_0369938 | Ga0495583_0369938_125_541 | 138 |
| 402 | 3300046506 | Ga0495583_0371988 | Ga0495583_0371988_127_543 | 138 |
| 403 | 3300046507 | Ga0495606_0000070 | Ga0495606_0000070_156511_156927 | 138 |
| 404 | 3300046507 | Ga0495606_0026978 | Ga0495606_0026978_3077_3493 | 138 |
| 405 | 3300046507 | Ga0495606_0147467 | Ga0495606_0147467_643_1059 | 138 |
| 406 | 3300046512 | Ga0495610_0099714 | Ga0495610_0099714_851_1267 | 138 |
| 407 | 3300046516 | Ga0495628_0000214 | Ga0495628_0000214_49144_49560 | 138 |
| 408 | 3300046516 | Ga0495628_0003096 | Ga0495628_0003096_2576_2992 | 138 |
| 409 | 3300046518 | Ga0495631_0008415 | Ga0495631_0008415_3312_3728 | 138 |
| 410 | 3300046518 | Ga0495631_0038943 | Ga0495631_0038943_1512_1928 | 138 |
| 411 | 3300046518 | Ga0495631_0055638 | Ga0495631_0055638_722_1138 | 138 |
| 412 | 3300046519 | Ga0495632_0090643 | Ga0495632_0090643_411_827 | 138 |
| 413 | 3300046522 | Ga0495643_0068068 | Ga0495643_0068068_20_436 | 138 |
| 414 | 3300046523 | Ga0495644_0161464 | Ga0495644_0161464_183_599 | 138 |
| 415 | 3300046526 | Ga0495666_0252753 | Ga0495666_0252753_120_536 | 138 |
| 416 | 3300046528 | Ga0495642_0106933 | Ga0495642_0106933_447_863 | 138 |
| 417 | 3300046528 | Ga0495642_0120324 | Ga0495642_0120324_116_532 | 138 |
| 418 | 3300046528 | Ga0495642_0195326 | Ga0495642_0195326_383_799 | 138 |
| 419 | 3300046529 | Ga0495652_0078476 | Ga0495652_0078476_2225_2641 | 138 |
| 420 | 3300046529 | Ga0495652_0360170 | Ga0495652_0360170_144_560 | 138 |
| 421 | 3300046530 | Ga0495654_0201605 | Ga0495654_0201605_280_696 | 138 |
| 422 | 3300046535 | Ga0495586_0445556 | Ga0495586_0445556_269_685 | 138 |
| 423 | 3300046538 | Ga0495609_0020470 | Ga0495609_0020470_874_1290 | 138 |
| 424 | 3300046538 | Ga0495609_0055399 | Ga0495609_0055399_142_558 | 138 |
| 425 | 3300046542 | Ga0495597_0013284 | Ga0495597_0013284_1556_1972 | 138 |
| 426 | 3300046542 | Ga0495597_0078691 | Ga0495597_0078691_856_1272 | 138 |
| 427 | 3300046542 | Ga0495597_0128829 | Ga0495597_0128829_44_460 | 138 |
| 428 | 3300046557 | Ga0495622_0000130 | Ga0495622_0000130_37203_37619 | 138 |
| 429 | 3300046557 | Ga0495622_0073679 | Ga0495622_0073679_1104_1520 | 138 |
| 430 | 3300046558 | Ga0495633_0009805 | Ga0495633_0009805_1489_1905 | 138 |
| 431 | 3300046558 | Ga0495633_0104408 | Ga0495633_0104408_320_736 | 138 |
| 432 | 3300046558 | Ga0495633_0174480 | Ga0495633_0174480_292_708 | 138 |
| 433 | 3300046559 | Ga0495667_0438124 | Ga0495667_0438124_302_718 | 138 |
| 434 | 3300046616 | Ga0495668_0020680 | Ga0495668_0020680_1735_2151 | 138 |
| 435 | 3300046616 | Ga0495668_0262260 | Ga0495668_0262260_59_475 | 138 |
| 436 | 3300046616 | Ga0495668_0263606 | Ga0495668_0263606_260_676 | 138 |
| 437 | 3300046616 | Ga0495668_0448210 | Ga0495668_0448210_216_632 | 138 |
| 438 | 3300046660 | Ga0495625_0740354 | Ga0495625_0740354_124_540 | 138 |
| 439 | 3300046663 | Ga0495635_0075144 | Ga0495635_0075144_1794_2210 | 138 |
| 440 | 3300046665 | Ga0495661_0003080 | Ga0495661_0003080_8285_8701 | 138 |
| 441 | 3300046665 | Ga0495661_0029100 | Ga0495661_0029100_2432_2848 | 138 |
| 442 | 3300046665 | Ga0495661_0039611 | Ga0495661_0039611_187_603 | 138 |
| 443 | 3300046665 | Ga0495661_0081270 | Ga0495661_0081270_94_510 | 138 |
| 444 | 3300046665 | Ga0495661_0110697 | Ga0495661_0110697_558_974 | 138 |
| 445 | 3300046665 | Ga0495661_0161181 | Ga0495661_0161181_277_693 | 138 |
| 446 | 3300046665 | Ga0495661_0200824 | Ga0495661_0200824_260_676 | 138 |
| 447 | 3300046674 | Ga0495588_0075157 | Ga0495588_0075157_801_1217 | 138 |
| 448 | 3300046674 | Ga0495588_0130709 | Ga0495588_0130709_380_796 | 138 |
| 449 | 3300046679 | Ga0495623_0029070 | Ga0495623_0029070_244_660 | 138 |
| 450 | 3300046684 | Ga0495669_0007914 | Ga0495669_0007914_827_1243 | 138 |
| 451 | 3300046690 | Ga0495624_0066566 | Ga0495624_0066566_1774_2190 | 138 |
| 452 | 3300046690 | Ga0495624_0341158 | Ga0495624_0341158_64_480 | 138 |
| 453 | 3300046691 | Ga0495670_0002993 | Ga0495670_0002993_25_441 | 138 |
| 454 | 3300046691 | Ga0495670_0009425 | Ga0495670_0009425_3375_3791 | 138 |
| 455 | 3300046692 | Ga0495671_0270167 | Ga0495671_0270167_153_569 | 138 |
| 456 | 3300046692 | Ga0495671_0302318 | Ga0495671_0302318_54_470 | 138 |
| 457 | 3300046694 | Ga0495649_0230538 | Ga0495649_0230538_272_718 | 138 |
| 458 | 3300046794 | Ga0495589_0174117 | Ga0495589_0174117_154_570 | 138 |
| 459 | 3300046810 | Ga0495660_0012227 | Ga0495660_0012227_3016_3432 | 138 |
| 460 | 3300047315 | Ga0495581_0210951 | Ga0495581_0210951_94_510 | 138 |
| 461 | 3300047317 | Ga0495604_0045382 | Ga0495604_0045382_261_677 | 138 |
| 462 | 3300047319 | Ga0495674_0012343 | Ga0495674_0012343_7279_7695 | 138 |
| 463 | 3300047319 | Ga0495674_0021280 | Ga0495674_0021280_2396_2812 | 138 |
| 464 | 3300047319 | Ga0495674_0087929 | Ga0495674_0087929_1849_2265 | 138 |
| 465 | 3300047320 | Ga0495672_0004866 | Ga0495672_0004866_3002_3418 | 138 |
| 466 | 3300047323 | Ga0495683_0043528 | Ga0495683_0043528_938_1354 | 138 |
| 467 | 3300047443 | Ga0495687_046086 | Ga0495687_046086_1043_1459 | 138 |
| 468 | 3300047443 | Ga0495687_126340 | Ga0495687_126340_426_842 | 138 |
| 469 | 3300047445 | Ga0495677_0232483 | Ga0495677_0232483_85_501 | 138 |
| 470 | 3300047445 | Ga0495677_0244672 | Ga0495677_0244672_111_527 | 138 |
| 471 | 3300047469 | Ga0495673_0036297 | Ga0495673_0036297_330_746 | 138 |
| 472 | 3300047470 | Ga0495681_0008321 | Ga0495681_0008321_263_679 | 138 |
| 473 | 3300047472 | Ga0495686_0000044 | Ga0495686_0000044_204412_204828 | 138 |
| 474 | 3300047472 | Ga0495686_0095131 | Ga0495686_0095131_1239_1655 | 138 |
| 475 | 3300047673 | Ga0495593_0096522 | Ga0495593_0096522_169_585 | 138 |
| 476 | 3300048088 | Ga0495602_0183668 | Ga0495602_0183668_932_1348 | 138 |
| 477 | 3300048088 | Ga0495602_0639680 | Ga0495602_0639680_202_618 | 138 |
| 478 | 3300048088 | Ga0495602_0684501 | Ga0495602_0684501_206_622 | 138 |
| 479 | 3300048091 | Ga0495626_0001165 | Ga0495626_0001165_9192_9608 | 138 |
| 480 | 3300048091 | Ga0495626_0031716 | Ga0495626_0031716_452_868 | 138 |
| 481 | 3300048903 | Ga0496100_0042332 | Ga0496100_0042332_1687_2103 | 138 |
| 482 | 3300048903 | Ga0496100_1495471 | Ga0496100_1495471_17_433 | 138 |
| 483 | 3300048903 | Ga0496100_1551160 | Ga0496100_1551160_43_459 | 138 |
| 484 | 3300048904 | Ga0496101_0033584 | Ga0496101_0033584_81_497 | 138 |
| 485 | 3300048905 | Ga0496102_0343506 | Ga0496102_0343506_185_601 | 138 |
| 486 | 3300048905 | Ga0496102_0446447 | Ga0496102_0446447_512_928 | 138 |
| 487 | 3300048905 | Ga0496102_1126488 | Ga0496102_1126488_230_646 | 138 |
| 488 | 3300048906 | Ga0496103_0107900 | Ga0496103_0107900_524_940 | 138 |
| 489 | 3300048906 | Ga0496103_0195417 | Ga0496103_0195417_149_565 | 138 |
| 490 | 3300048906 | Ga0496103_0389194 | Ga0496103_0389194_268_684 | 138 |
| 491 | 3300048907 | Ga0496104_0826231 | Ga0496104_0826231_193_609 | 138 |
| 492 | 3300048907 | Ga0496104_1313029 | Ga0496104_1313029_42_458 | 138 |
| 493 | 3300048908 | Ga0496105_0100253 | Ga0496105_0100253_485_901 | 138 |
| 494 | 3300048908 | Ga0496105_0243478 | Ga0496105_0243478_728_1144 | 138 |
| 495 | 3300048909 | Ga0496106_0857543 | Ga0496106_0857543_241_657 | 138 |
| 496 | 3300048911 | Ga0496108_0074217 | Ga0496108_0074217_1674_2090 | 138 |
| 497 | 3300048912 | Ga0496109_0407673 | Ga0496109_0407673_149_565 | 138 |
| 498 | 3300048912 | Ga0496109_1044373 | Ga0496109_1044373_184_600 | 138 |
| 499 | 3300048913 | Ga0496110_0135222 | Ga0496110_0135222_1149_1565 | 138 |
| 500 | 3300048914 | Ga0496111_0428571 | Ga0496111_0428571_505_921 | 138 |
| 501 | 3300048914 | Ga0496111_0939595 | Ga0496111_0939595_173_589 | 138 |
| 502 | 3300048917 | Ga0496114_0148367 | Ga0496114_0148367_778_1194 | 138 |
| 503 | 3300048918 | Ga0496115_0127716 | Ga0496115_0127716_1257_1673 | 138 |
| 504 | 3300048918 | Ga0496115_0180998 | Ga0496115_0180998_365_781 | 138 |
| 505 | 3300048919 | Ga0496116_0120696 | Ga0496116_0120696_41_460 | 138 |
| 506 | 3300048920 | Ga0496117_0173220 | Ga0496117_0173220_227_646 | 138 |
| 507 | 3300048921 | Ga0496118_0000378 | Ga0496118_0000378_12143_12559 | 138 |
| 508 | 3300048921 | Ga0496118_0225440 | Ga0496118_0225440_561_980 | 138 |
| 509 | 3300048921 | Ga0496118_0461529 | Ga0496118_0461529_61_477 | 138 |
| 510 | 3300048921 | Ga0496118_0641646 | Ga0496118_0641646_57_473 | 138 |
| 511 | 3300048924 | Ga0496121_0539371 | Ga0496121_0539371_242_658 | 138 |
| 512 | 3300048925 | Ga0496122_0000018 | Ga0496122_0000018_227918_228334 | 138 |
| 513 | 3300048925 | Ga0496122_0121679 | Ga0496122_0121679_579_995 | 138 |
| 514 | 3300048926 | Ga0496123_0000015 | Ga0496123_0000015_227918_228334 | 138 |
| 515 | 3300048926 | Ga0496123_0020681 | Ga0496123_0020681_3894_4310 | 138 |
| 516 | 3300048927 | Ga0496124_0100832 | Ga0496124_0100832_731_1147 | 138 |
| 517 | 3300048928 | Ga0496125_0002112 | Ga0496125_0002112_24665_25081 | 138 |
| 518 | 3300048928 | Ga0496125_0007190 | Ga0496125_0007190_7909_8328 | 138 |
| 519 | 3300048928 | Ga0496125_0017207 | Ga0496125_0017207_6292_6708 | 138 |
| 520 | 3300048929 | Ga0496126_0004109 | Ga0496126_0004109_11981_12397 | 138 |
| 521 | 3300049459 | Ga0495678_001831 | Ga0495678_001831_2420_2836 | 138 |
| 522 | 3300049459 | Ga0495678_071359 | Ga0495678_071359_79_495 | 138 |
| 523 | 3300049583 | Ga0501067_0009870 | Ga0501067_0009870_2690_3106 | 138 |
| 524 | 3300050492 | nmdc:mga0yw44_418407_c1 | nmdc:mga0yw44_418407_c1_23_439 | 138 |
| 525 | 3300050493 | nmdc:mga0k408_2819_c2 | nmdc:mga0k408_2819_c2_4037_4453 | 138 |
| 526 | 3300050493 | nmdc:mga0k408_290135_c1 | nmdc:mga0k408_290135_c1_260_676 | 138 |
| 527 | 3300050493 | nmdc:mga0k408_44306_c1 | nmdc:mga0k408_44306_c1_696_1112 | 138 |
| 528 | 3300053125 | Ga0500618_000096 | Ga0500618_000096_19068_19484 | 138 |
| 529 | 3300053125 | Ga0500618_007664 | Ga0500618_007664_1700_2116 | 138 |
| 530 | 3300053125 | Ga0500618_009766 | Ga0500618_009766_355_771 | 138 |
| 531 | 3300053156 | Ga0500622_0064505 | Ga0500622_0064505_1078_1494 | 138 |
| 532 | 3300053157 | Ga0500624_012022 | Ga0500624_012022_562_978 | 138 |
| 533 | 3300053160 | Ga0500633_0276124 | Ga0500633_0276124_43_459 | 138 |
| 534 | 3300053730 | Ga0500645_011016 | Ga0500645_011016_2491_2907 | 138 |
| 535 | 3300053730 | Ga0500645_043691 | Ga0500645_043691_853_1269 | 138 |
| 536 | 3300061719 | Ga0466962_0043183 | Ga0466962_0043183_83_499 | 138 |
| 537 | 3300061719 | Ga0466962_0406816 | Ga0466962_0406816_158_574 | 138 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5duk-assembly1.cif.gz_A | n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 | 0.9559 | 34 | 82 |
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.926 | 47 | 92 |
| 4ija-assembly1.cif.gz_B | structure of s. aureus methicillin resistance factor mecr2 | 0.9111 | 34 | 92 |
| 7el3-assembly1.cif.gz_B | crystal structure of hpar-dna complex from acinetobacter baumannii | 0.9063 | 6 | 135 |
| 4ija-assembly1.cif.gz_A | structure of s. aureus methicillin resistance factor mecr2 | 0.9043 | 34 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9622 | 34 | 94 | 1.10.10.10 |
| af_P15082_1_58_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9401 | 33 | 91 | 1.10.10.10 |
| af_Q4DZU8_467_618_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.9399 | 46 | 92 | 3.30.230.130 |
| 1s3jB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9345 | 30 | 93 | 1.10.10.10 |
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.926 | 47 | 92 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G3ACI8-F1-model_v4 | Transcriptional regulator, MarR family | 0.9957 | 1 | 138 |
GO:0003677
GO:0003700 |
| AF-A0A4Q4X706-F1-model_v4 | Pyroglutamyl-peptidase I (EC 3.4.19.3) | 0.9918 | 1 | 137 |
GO:0003700
GO:0005829 GO:0006508 GO:0016920 |
| AF-A0A1R3TAJ0-F1-model_v4 | Salmolysin | 0.99 | 1 | 138 |
GO:0003677
GO:0003700 |
| AF-G3ACI8-F1-model_v4 | Transcriptional regulator, MarR family | 0.9886 | 1 | 138 |
GO:0003677
GO:0003700 |
| AF-A0A4Q4XIZ4-F1-model_v4 | HTH marR-type domain-containing protein | 0.9875 | 1 | 132 |
GO:0003677
GO:0003700 GO:0016853 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar