F460907

General Info

Members Datasets Scaffolds Average Seq Length
537 235 1074 184

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10407576|Ga0105249_104075762
Length 209
Sequence MACCATAEDKATRPRILSMAASESEPLHQDGIGGPDGLERLWTPYRMAYIRGESKPSDDSEGECPFCRIPREDDDERFLVVRRGRLAYAVLNLYPYAPGHLMVCPYRHIADFTETTDAESVEIAAMTKAALRTLRSVSKAEGFNVGMNQGAAGGAGIAAHLHQHVVPRWVGDQNFMPVIGHTKTLPQLLQETRGLIADAWDEPAGQATG

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
116 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
134 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
137 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
138 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
224 2643221679 Angustibacter sp. Root456 Isolate Unclassified
225 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
226 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
227 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
228 2808606394 Promicromonospora sp. C35 Isolate Unclassified
229 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
230 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
231 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
232 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
233 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
234 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
235 2932398195 Dietzia sp. 2505 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 11.17
Rhizosphere 79.14
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10407576 3300009553 Bacteria 1391
2 JGI24740J21852_10082217 3300001979 Bacteria 842
3 JGI24737J22298_10100807 3300001990 Bacteria 855
4 JGI24735J21928_10020671 3300002067 Bacteria 2015
5 JGI25406J46586_10037567 3300003203 Bacteria 1744
6 Ga0070658_10124374 3300005327 Bacteria 2146
7 Ga0070658_10202272 3300005327 Bacteria 1676
8 Ga0070658_11303750 3300005327 Bacteria 631
9 Ga0070683_100004167 3300005329 Bacteria 11841
10 Ga0070683_100146494 3300005329 Bacteria 2238
11 Ga0070683_100424109 3300005329 Bacteria 1269
12 Ga0070677_10527349 3300005333 Bacteria 644
13 Ga0070682_100015633 3300005337 Bacteria 4400
14 Ga0070682_100021170 3300005337 Bacteria 3832
15 Ga0068868_100204962 3300005338 Bacteria 1646
16 Ga0068868_100303417 3300005338 Bacteria 1357
17 Ga0068868_100474494 3300005338 Bacteria 1092
18 Ga0070660_100005730 3300005339 Bacteria 8602
19 Ga0070660_100084791 3300005339 Bacteria 2491
20 Ga0070689_100808097 3300005340 Bacteria 825
21 Ga0070691_10211470 3300005341 Bacteria 1023
22 Ga0070687_100070259 3300005343 Bacteria 1878
23 Ga0070692_10167961 3300005345 Bacteria 1262
24 Ga0070668_100038354 3300005347 Bacteria 3661
25 Ga0070669_100519814 3300005353 Bacteria 989
26 Ga0070671_101469066 3300005355 Bacteria 603
27 Ga0070674_100372881 3300005356 Bacteria 1159
28 Ga0070674_100660122 3300005356 Bacteria 890
29 Ga0070659_100014011 3300005366 Bacteria 5983
30 Ga0070659_100151301 3300005366 Unclassified 1893
31 Ga0070659_100186222 3300005366 Bacteria 1705
32 Ga0070659_100220864 3300005366 Bacteria 1564
33 Ga0070667_100013554 3300005367 Bacteria 6734
34 Ga0070700_100855050 3300005441 Bacteria 737
35 Ga0070678_100545200 3300005456 Bacteria 1029
36 Ga0070662_100077975 3300005457 Bacteria 2460
37 Ga0070662_100934529 3300005457 Bacteria 741
38 Ga0070681_10170818 3300005458 Bacteria 2096
39 Ga0070681_10319133 3300005458 Bacteria 1463
40 Ga0068867_100585424 3300005459 Bacteria 971
41 Ga0070679_100007194 3300005530 Bacteria 10395
42 Ga0070684_100021693 3300005535 Bacteria 5350
43 Ga0070684_100146426 3300005535 Bacteria 2138
44 Ga0070684_100182623 3300005535 Bacteria 1908
45 Ga0070684_100191932 3300005535 Bacteria 1859
46 Ga0070684_100222488 3300005535 Bacteria 1722
47 Ga0070684_100356386 3300005535 Bacteria 1346
48 Ga0070672_100322308 3300005543 Bacteria 1314
49 Ga0070696_100624587 3300005546 Bacteria 871
50 Ga0070664_100058520 3300005564 Bacteria 3278
51 Ga0068857_100005137 3300005577 Bacteria 11127
52 Ga0068857_100566875 3300005577 Bacteria 1071
53 Ga0068857_100957081 3300005577 Bacteria 823
54 Ga0070702_100371621 3300005615 Bacteria 1014
55 Ga0070702_100513674 3300005615 Bacteria 882
56 Ga0070702_100936790 3300005615 Bacteria 681
57 Ga0068859_101294702 3300005617 Bacteria 803
58 Ga0068864_100056624 3300005618 Bacteria 3387
59 Ga0068866_10187280 3300005718 Unclassified 1227
60 Ga0068866_10552840 3300005718 Bacteria 770
61 Ga0068861_100063324 3300005719 Bacteria 2843
62 Ga0068861_100122199 3300005719 Bacteria 2102
63 Ga0068861_100166954 3300005719 Bacteria 1821
64 Ga0068861_100648335 3300005719 Bacteria 975
65 Ga0068851_10522364 3300005834 Bacteria 714
66 Ga0068870_10072069 3300005840 Bacteria 1887
67 Ga0068860_100182941 3300005843 Bacteria 2026
68 Ga0068862_100874881 3300005844 Unclassified 882
69 Ga0081539_10000127 3300005985 Bacteria 179934
70 Ga0075365_10033077 3300006038 Bacteria 3329
71 Ga0075365_10070173 3300006038 Bacteria 2356
72 Ga0075365_10081115 3300006038 Bacteria 2197
73 Ga0075365_10116088 3300006038 Bacteria 1843
74 Ga0075365_10128106 3300006038 Bacteria 1755
75 Ga0075365_10172013 3300006038 Bacteria 1512
76 Ga0075365_10492899 3300006038 Bacteria 866
77 Ga0075368_10096895 3300006042 Bacteria 1209
78 Ga0075363_100003180 3300006048 Bacteria 6921
79 Ga0075363_100041754 3300006048 Bacteria 2420
80 Ga0075363_100066044 3300006048 Bacteria 1957
81 Ga0075364_10029255 3300006051 Bacteria 3532
82 Ga0075364_10054928 3300006051 Bacteria 2605
83 Ga0075364_10285756 3300006051 Bacteria 1122
84 Ga0075367_10163545 3300006178 Bacteria 1384
85 Ga0075428_100034251 3300006844 Bacteria 5603
86 Ga0075430_100122736 3300006846 Bacteria 2166
87 Ga0075431_100033384 3300006847 Bacteria 5304
88 Ga0075433_10011509 3300006852 Bacteria 7125
89 Ga0075433_10020818 3300006852 Bacteria 5490
90 Ga0075434_100003989 3300006871 Bacteria 13221
91 Ga0075434_100394158 3300006871 Bacteria 1405
92 Ga0075429_100040766 3300006880 Bacteria 4043
93 Ga0075429_101221911 3300006880 Bacteria 656
94 Ga0068865_100039942 3300006881 Bacteria 3186
95 Ga0068865_100093593 3300006881 Bacteria 2185
96 Ga0068865_100158941 3300006881 Bacteria 1722
97 Ga0075436_100003948 3300006914 Bacteria 10166
98 Ga0097620_101294513 3300006931 Bacteria 803
99 Ga0075435_100002516 3300007076 Bacteria 12200
100 Ga0075435_100102388 3300007076 Bacteria 2373
101 Ga0111539_11657968 3300009094 Bacteria 741
102 Ga0105245_10037145 3300009098 Bacteria 4330
103 Ga0105245_10106760 3300009098 Bacteria 2599
104 Ga0105245_10164000 3300009098 Bacteria 2111
105 Ga0105245_10858002 3300009098 Bacteria 948
106 Ga0105245_11106731 3300009098 Bacteria 838
107 Ga0105247_11199498 3300009101 Bacteria 604
108 Ga0105243_10016977 3300009148 Bacteria 5504
109 Ga0105243_10094842 3300009148 Bacteria 2465
110 Ga0105242_10010999 3300009176 Bacteria 6951
111 Ga0105242_10252204 3300009176 Bacteria 1590
112 Ga0105248_10522364 3300009177 Bacteria 1339
113 Ga0105248_10547129 3300009177 Bacteria 1306
114 Ga0105238_10143226 3300009551 Bacteria 2367
115 Ga0105238_10161975 3300009551 Bacteria 2213
116 Ga0105249_10043608 3300009553 Bacteria 4079
117 Ga0105249_10044913 3300009553 Bacteria 4018
118 Ga0105249_10506625 3300009553 Bacteria 1253
119 Ga0105239_10011816 3300010375 Bacteria 9745
120 Ga0105239_10200467 3300010375 Bacteria 2236
121 Ga0105239_11592511 3300010375 Bacteria 755
122 Ga0105246_11002962 3300011119 Bacteria 756
123 Ga0157371_10105206 3300013102 Bacteria 2002
124 Ga0157371_10144228 3300013102 Bacteria 1696
125 Ga0157369_10250356 3300013105 Bacteria 1849
126 Ga0157374_11049549 3300013296 Bacteria 835
127 Ga0157378_10479134 3300013297 Bacteria 1239
128 Ga0163162_10025921 3300013306 Bacteria 5794
129 Ga0163162_10584497 3300013306 Bacteria 1244
130 Ga0157372_10005055 3300013307 Bacteria 14014
131 Ga0157372_10153423 3300013307 Bacteria 2659
132 Ga0157372_10239890 3300013307 Bacteria 2103
133 Ga0157375_10022317 3300013308 Bacteria 5825
134 Ga0157375_10070276 3300013308 Bacteria 3511
135 Ga0157375_10178795 3300013308 Bacteria 2273
136 Ga0157375_10184116 3300013308 Bacteria 2241
137 Ga0157375_11288104 3300013308 Bacteria 859
138 Ga0163163_10025986 3300014325 Bacteria 5591
139 Ga0163163_10709436 3300014325 Bacteria 1069
140 Ga0157380_10203181 3300014326 Bacteria 1759
141 Ga0157380_11196820 3300014326 Bacteria 803
142 Ga0157380_11241815 3300014326 Bacteria 790
143 Ga0157377_10182210 3300014745 Bacteria 1322
144 Ga0157377_10877454 3300014745 Unclassified 668
145 Ga0163161_10137655 3300017792 Bacteria 1847
146 Ga0163161_10261628 3300017792 Bacteria 1351
147 Ga0207656_10357834 3300025321 Bacteria 729
148 Ga0207688_10009974 3300025901 Bacteria 5167
149 Ga0207688_10104875 3300025901 Bacteria 1636
150 Ga0207688_10113802 3300025901 Bacteria 1573
151 Ga0207688_10496920 3300025901 Bacteria 764
152 Ga0207647_10009136 3300025904 Bacteria 7052
153 Ga0207647_10087049 3300025904 Bacteria 1867
154 Ga0207647_10257451 3300025904 Bacteria 1000
155 Ga0207645_10898807 3300025907 Bacteria 601
156 Ga0207643_10052044 3300025908 Bacteria 2325
157 Ga0207643_10299036 3300025908 Bacteria 1001
158 Ga0207705_10121134 3300025909 Bacteria 1941
159 Ga0207705_10320334 3300025909 Bacteria 1191
160 Ga0207707_10081176 3300025912 Bacteria 2831
161 Ga0207707_10203939 3300025912 Bacteria 1724
162 Ga0207662_10454993 3300025918 Bacteria 876
163 Ga0207657_10058676 3300025919 Bacteria 3310
164 Ga0207657_10210956 3300025919 Bacteria 1559
165 Ga0207652_10039890 3300025921 Bacteria 3986
166 Ga0207681_10091553 3300025923 Bacteria 2173
167 Ga0207694_10412217 3300025924 Bacteria 1125
168 Ga0207659_10401898 3300025926 Bacteria 1146
169 Ga0207687_10010253 3300025927 Bacteria 6120
170 Ga0207687_10082718 3300025927 Bacteria 2323
171 Ga0207687_10136195 3300025927 Bacteria 1857
172 Ga0207687_10157060 3300025927 Bacteria 1741
173 Ga0207687_10973287 3300025927 Bacteria 727
174 Ga0207690_10019354 3300025932 Bacteria 4191
175 Ga0207690_10198671 3300025932 Bacteria 1521
176 Ga0207690_10435393 3300025932 Bacteria 1051
177 Ga0207709_10055188 3300025935 Bacteria 2453
178 Ga0207704_10033521 3300025938 Bacteria 2921
179 Ga0207704_10151578 3300025938 Bacteria 1636
180 Ga0207704_10154297 3300025938 Bacteria 1625
181 Ga0207704_10184202 3300025938 Bacteria 1512
182 Ga0207691_10338395 3300025940 Bacteria 1288
183 Ga0207711_10383964 3300025941 Bacteria 1303
184 Ga0207661_10085539 3300025944 Bacteria 2614
185 Ga0207661_10207351 3300025944 Bacteria 1726
186 Ga0207661_10298524 3300025944 Bacteria 1444
187 Ga0207661_10444249 3300025944 Bacteria 1180
188 Ga0207661_10446666 3300025944 Bacteria 1177
189 Ga0207661_11145772 3300025944 Bacteria 716
190 Ga0207679_10042248 3300025945 Bacteria 3275
191 Ga0207667_10157068 3300025949 Bacteria 2340
192 Ga0207667_11164928 3300025949 Bacteria 752
193 Ga0207712_10018134 3300025961 Bacteria 4580
194 Ga0207712_10030760 3300025961 Bacteria 3611
195 Ga0207712_10080238 3300025961 Bacteria 2373
196 Ga0207712_10296892 3300025961 Bacteria 1324
197 Ga0207668_10044522 3300025972 Bacteria 3020
198 Ga0207668_10303735 3300025972 Bacteria 1318
199 Ga0207668_10489347 3300025972 Bacteria 1056
200 Ga0207639_10568765 3300026041 Bacteria 1042
201 Ga0207708_10173670 3300026075 Bacteria 1708
202 Ga0207702_11205919 3300026078 Bacteria 751
203 Ga0207648_10022104 3300026089 Bacteria 5714
204 Ga0207676_10206995 3300026095 Bacteria 1738
205 Ga0207676_10385213 3300026095 Bacteria 1306
206 Ga0207674_10007885 3300026116 Bacteria 12370
207 Ga0207674_10712800 3300026116 Bacteria 968
208 Ga0207675_100009269 3300026118 Bacteria 9229
209 Ga0207675_100011648 3300026118 Bacteria 8223
210 Ga0207675_100108800 3300026118 Bacteria 2614
211 Ga0207683_10050535 3300026121 Bacteria 3642
212 Ga0207698_10219567 3300026142 Bacteria 1717
213 Ga0207698_12045546 3300026142 Bacteria 587
214 Ga0209813_10002147 3300027866 Bacteria 4501
215 Ga0209813_10166573 3300027866 Bacteria 798
216 Ga0207428_10000855 3300027907 Bacteria 34313
217 Ga0207428_10008400 3300027907 Bacteria 9325
218 Ga0268265_11241709 3300028380 Bacteria 744
219 Ga0268264_10000576 3300028381 Bacteria 44482
220 Ga0316181_1019724 3300030744 Bacteria 1596
221 Ga0316182_1384724 3300030745 Bacteria 764
222 Ga0265327_10000062 3300031251 Bacteria 234320
223 Ga0307413_10762144 3300031824 Bacteria 810
224 Ga0307410_10038061 3300031852 Bacteria 3147
225 Ga0307410_10494167 3300031852 Bacteria 1006
226 Ga0307410_10718625 3300031852 Bacteria 843
227 Ga0307406_10026597 3300031901 Bacteria 3477
228 Ga0307406_10457930 3300031901 Bacteria 1025
229 Ga0307406_10649252 3300031901 Bacteria 876
230 Ga0307407_10005801 3300031903 Bacteria 5402
231 Ga0307407_10112694 3300031903 Bacteria 1710
232 Ga0307407_10405024 3300031903 Bacteria 980
233 Ga0307412_10025274 3300031911 Bacteria 3677
234 Ga0307412_10988301 3300031911 Bacteria 743
235 Ga0307409_100089280 3300031995 Bacteria 2519
236 Ga0307409_100112482 3300031995 Bacteria 2286
237 Ga0307409_100182419 3300031995 Bacteria 1859
238 Ga0307409_100371204 3300031995 Bacteria 1357
239 Ga0307409_100685121 3300031995 Bacteria 1023
240 Ga0307416_100020809 3300032002 Bacteria 4692
241 Ga0307416_100249440 3300032002 Bacteria 1726
242 Ga0307416_100599351 3300032002 Bacteria 1181
243 Ga0307416_100692880 3300032002 Bacteria 1107
244 Ga0307411_10018683 3300032005 Bacteria 3984
245 Ga0307411_10126893 3300032005 Bacteria 1857
246 Ga0307411_10249378 3300032005 Bacteria 1395
247 Ga0307415_100003106 3300032126 Bacteria 8400
248 Ga0395900_0027470 3300037418 Bacteria 5830
249 Ga0395900_0208137 3300037418 Bacteria 1976
250 Ga0395898_0009822 3300037466 Bacteria 10031
251 Ga0395898_0033637 3300037466 Bacteria 5114
252 Ga0395898_0185297 3300037466 Bacteria 1989
253 Ga0395905_0030766 3300037471 Bacteria 5056
254 Ga0395901_0052553 3300038443 Bacteria 4234
255 Ga0395901_0090101 3300038443 Bacteria 3210
256 Ga0395901_0111700 3300038443 Bacteria 2870
257 Ga0395901_0260071 3300038443 Bacteria 1807
258 Ga0451787_738908 3300041441 Bacteria 742
259 Ga0451793_1107916 3300041452 Bacteria 3797
260 Ga0451797_0053692 3300041453 Bacteria 1489
261 Ga0451835_0972303 3300041492 Bacteria 618
262 Ga0451837_1114922 3300041494 Bacteria 946
263 Ga0451841_0298374 3300041498 Bacteria 1269
264 Ga0451845_0011386 3300041501 Bacteria 1132
265 Ga0451849_0240205 3300041505 Bacteria 1038
266 Ga0451843_0456137 3300041509 Bacteria 799
267 Ga0451853_2225099 3300041512 Bacteria 978
268 Ga0451853_3478986 3300041512 Bacteria 2019
269 Ga0439463_020975 3300042016 Bacteria 1631
270 Ga0466972_0024035 3300044658 Bacteria 3026
271 Ga0466972_0030451 3300044658 Bacteria 2656
272 Ga0466965_0022651 3300044683 Bacteria 3029
273 Ga0466965_0051804 3300044683 Bacteria 2037
274 Ga0466965_0067095 3300044683 Bacteria 1800
275 Ga0466965_0661178 3300044683 Bacteria 597
276 Ga0466966_0030796 3300044684 Bacteria 3480
277 Ga0466966_0033730 3300044684 Bacteria 3313
278 Ga0466966_0138379 3300044684 Bacteria 1489
279 Ga0466966_0295829 3300044684 Bacteria 973
280 Ga0466961_0016493 3300044693 Bacteria 4746
281 Ga0466961_0017051 3300044693 Bacteria 4664
282 Ga0466961_0020218 3300044693 Bacteria 4284
283 Ga0466961_0095105 3300044693 Bacteria 1879
284 Ga0466961_0171204 3300044693 Bacteria 1350
285 Ga0466963_0009098 3300044694 Bacteria 5970
286 Ga0466963_0041680 3300044694 Bacteria 3012
287 Ga0466963_0254294 3300044694 Bacteria 1233
288 Ga0466963_0305952 3300044694 Bacteria 1118
289 Ga0466964_0023936 3300044706 Bacteria 2377
290 Ga0466971_0050423 3300044719 Bacteria 1873
291 Ga0466971_0093046 3300044719 Bacteria 1381
292 Ga0466970_0006407 3300044765 Bacteria 5887
293 Ga0466970_0008863 3300044765 Bacteria 5072
294 Ga0466970_0115977 3300044765 Bacteria 1465
295 Ga0466970_0207474 3300044765 Bacteria 1091
296 Ga0466970_0294185 3300044765 Bacteria 915
297 Ga0466957_0016137 3300044842 Bacteria 4366
298 Ga0466957_0035939 3300044842 Bacteria 2976
299 Ga0466957_0150234 3300044842 Bacteria 1506
300 Ga0466957_0303068 3300044842 Bacteria 1074
301 Ga0466957_0595387 3300044842 Bacteria 774
302 Ga0466960_0008282 3300044901 Bacteria 4253
303 Ga0466960_0073936 3300044901 Bacteria 1702
304 Ga0466960_0087243 3300044901 Bacteria 1584
305 Ga0466960_0089070 3300044901 Bacteria 1570
306 Ga0466959_0027187 3300045049 Bacteria 4243
307 Ga0466959_0144576 3300045049 Bacteria 1679
308 Ga0466959_0331086 3300045049 Bacteria 1040
309 Ga0466959_0473839 3300045049 Bacteria 848
310 Ga0466958_0063052 3300045836 Bacteria 2260
311 Ga0466958_0076799 3300045836 Bacteria 2051
312 Ga0466958_0138042 3300045836 Bacteria 1534
313 Ga0466958_0248475 3300045836 Bacteria 1137
314 Ga0466967_0023189 3300045976 Bacteria 5082
315 Ga0466967_0045637 3300045976 Bacteria 3808
316 Ga0466967_0096205 3300045976 Bacteria 2700
317 Ga0466967_0104448 3300045976 Bacteria 2594
318 Ga0466967_0164099 3300045976 Bacteria 2087
319 Ga0466967_0170434 3300045976 Bacteria 2048
320 Ga0466967_0363748 3300045976 Bacteria 1402
321 Ga0466967_0393938 3300045976 Bacteria 1346
322 Ga0466967_0398715 3300045976 Bacteria 1338
323 Ga0466967_1072997 3300045976 Bacteria 802
324 Ga0495608_0077615 3300046511 Bacteria 2162
325 Ga0495608_0228118 3300046511 Bacteria 1167
326 Ga0495620_0130358 3300046515 Bacteria 987
327 Ga0495632_0291827 3300046519 Bacteria 725
328 Ga0495635_0259239 3300046663 Bacteria 1171
329 Ga0495658_0377471 3300046683 Bacteria 902
330 Ga0495670_0041459 3300046691 Bacteria 2297
331 Ga0495671_0342723 3300046692 Bacteria 717
332 Ga0495636_0236535 3300047318 Bacteria 841
333 Ga0495674_0843883 3300047319 Bacteria 710
334 Ga0496100_0077880 3300048903 Bacteria 2230
335 Ga0496100_0154912 3300048903 Bacteria 1638
336 Ga0496101_0074891 3300048904 Bacteria 2491
337 Ga0496101_0321452 3300048904 Bacteria 1214
338 Ga0496102_0006010 3300048905 Bacteria 10336
339 Ga0496102_0062692 3300048905 Bacteria 3404
340 Ga0496102_0077546 3300048905 Bacteria 3058
341 Ga0496102_0143205 3300048905 Bacteria 2242
342 Ga0496102_0177192 3300048905 Bacteria 2008
343 Ga0496102_0419110 3300048905 Bacteria 1258
344 Ga0496103_0073461 3300048906 Bacteria 2142
345 Ga0496103_0246221 3300048906 Bacteria 1150
346 Ga0496103_0431274 3300048906 Bacteria 846
347 Ga0496104_0009172 3300048907 Bacteria 8799
348 Ga0496104_0565384 3300048907 Bacteria 1048
349 Ga0496105_0139518 3300048908 Bacteria 1996
350 Ga0496105_0477604 3300048908 Bacteria 981
351 Ga0496105_0534942 3300048908 Bacteria 916
352 Ga0496106_0025998 3300048909 Bacteria 4356
353 Ga0496106_0120268 3300048909 Bacteria 2052
354 Ga0496106_0472994 3300048909 Bacteria 1007
355 Ga0496106_0611233 3300048909 Bacteria 873
356 Ga0496107_0051667 3300048910 Bacteria 2965
357 Ga0496107_0209047 3300048910 Bacteria 1451
358 Ga0496107_0334594 3300048910 Bacteria 1127
359 Ga0496107_0458702 3300048910 Bacteria 946
360 Ga0496108_0028403 3300048911 Bacteria 4628
361 Ga0496108_0029647 3300048911 Bacteria 4533
362 Ga0496108_0069740 3300048911 Bacteria 2966
363 Ga0496108_0232545 3300048911 Bacteria 1603
364 Ga0496109_0004950 3300048912 Bacteria 11126
365 Ga0496109_0068878 3300048912 Bacteria 3244
366 Ga0496109_0071412 3300048912 Bacteria 3187
367 Ga0496109_0137914 3300048912 Bacteria 2280
368 Ga0496109_0342773 3300048912 Bacteria 1411
369 Ga0496109_0399366 3300048912 Bacteria 1299
370 Ga0496109_0592239 3300048912 Bacteria 1045
371 Ga0496110_0033429 3300048913 Bacteria 4448
372 Ga0496110_0035173 3300048913 Bacteria 4344
373 Ga0496110_0230098 3300048913 Bacteria 1686
374 Ga0496110_0467715 3300048913 Bacteria 1149
375 Ga0496111_0102729 3300048914 Bacteria 2102
376 Ga0496111_0189377 3300048914 Bacteria 1529
377 Ga0496111_0387157 3300048914 Bacteria 1034
378 Ga0496113_0012785 3300048916 Bacteria 5656
379 Ga0496114_0004325 3300048917 Bacteria 10993
380 Ga0496114_0015700 3300048917 Bacteria 6093
381 Ga0496114_0073275 3300048917 Bacteria 2882
382 Ga0496114_0159051 3300048917 Bacteria 1963
383 Ga0496114_0268158 3300048917 Bacteria 1504
384 Ga0496114_0434833 3300048917 Bacteria 1162
385 Ga0496114_0452097 3300048917 Bacteria 1138
386 Ga0496114_0481168 3300048917 Bacteria 1098
387 Ga0496114_0537263 3300048917 Bacteria 1033
388 Ga0496114_0809464 3300048917 Bacteria 816
389 Ga0496115_0011541 3300048918 Bacteria 6623
390 Ga0496115_0202424 3300048918 Bacteria 1640
391 Ga0496124_0048904 3300048927 Bacteria 3610
392 Ga0501031_0000074 3300049568 Bacteria 52791
393 Ga0501031_0059948 3300049568 Bacteria 2480
394 Ga0501032_0001064 3300049569 Bacteria 21945
395 Ga0501032_0010169 3300049569 Bacteria 6791
396 Ga0501032_0142509 3300049569 Bacteria 1578
397 Ga0501033_0000637 3300049570 Bacteria 32382
398 Ga0501034_0012497 3300049571 Bacteria 8766
399 Ga0501034_0034458 3300049571 Bacteria 5132
400 Ga0501034_0076745 3300049571 Bacteria 3348
401 Ga0501034_0272343 3300049571 Bacteria 1634
402 Ga0501036_0000629 3300049572 Bacteria 25714
403 Ga0501036_0012142 3300049572 Bacteria 7137
404 Ga0501036_0047151 3300049572 Bacteria 3649
405 Ga0501036_0344928 3300049572 Bacteria 1244
406 Ga0501037_0000235 3300049573 Bacteria 47804
407 Ga0501037_0084923 3300049573 Bacteria 2292
408 Ga0501037_0214751 3300049573 Bacteria 1355
409 Ga0501038_0000196 3300049574 Bacteria 52394
410 Ga0501038_0008938 3300049574 Bacteria 9190
411 Ga0501038_0230606 3300049574 Bacteria 1474
412 Ga0501039_0000124 3300049575 Bacteria 53373
413 Ga0501039_0041251 3300049575 Bacteria 3564
414 Ga0501040_0415423 3300049576 Bacteria 967
415 Ga0501040_0804928 3300049576 Bacteria 680
416 Ga0501041_0021665 3300049577 Bacteria 3850
417 Ga0501041_0239250 3300049577 Bacteria 1141
418 Ga0501042_0019976 3300049578 Bacteria 4659
419 Ga0501042_0164022 3300049578 Bacteria 1603
420 Ga0501042_0365055 3300049578 Bacteria 1045
421 Ga0501043_0000762 3300049579 Bacteria 28608
422 Ga0501043_0583489 3300049579 Bacteria 827
423 Ga0501043_0833815 3300049579 Bacteria 665
424 Ga0501046_0001934 3300049580 Bacteria 19677
425 Ga0501046_0012936 3300049580 Bacteria 7094
426 Ga0501046_0391504 3300049580 Bacteria 1005
427 Ga0501047_0000378 3300049581 Bacteria 50236
428 Ga0501047_0088505 3300049581 Bacteria 2973
429 Ga0501047_0139856 3300049581 Bacteria 2300
430 Ga0501048_0000096 3300049582 Bacteria 47896
431 Ga0501048_0016922 3300049582 Bacteria 5375
432 Ga0501048_0138160 3300049582 Bacteria 1722
433 Ga0501067_0002075 3300049583 Bacteria 11034
434 Ga0501067_0002914 3300049583 Bacteria 9429
435 Ga0501067_0016195 3300049583 Bacteria 4120
436 Ga0501067_0026505 3300049583 Bacteria 3210
437 Ga0501067_0048989 3300049583 Bacteria 2342
438 Ga0501067_0088819 3300049583 Bacteria 1715
439 Ga0501067_0126781 3300049583 Bacteria 1420
440 Ga0501067_0448923 3300049583 Bacteria 720
441 Ga0501068_0012143 3300049584 Bacteria 4871
442 Ga0501068_0015371 3300049584 Bacteria 4394
443 Ga0501068_0036008 3300049584 Bacteria 2957
444 Ga0501068_0075027 3300049584 Bacteria 2068
445 Ga0501069_0000615 3300049585 Bacteria 16460
446 Ga0501069_0091339 3300049585 Bacteria 1722
447 Ga0501069_0134807 3300049585 Bacteria 1415
448 Ga0501069_0243531 3300049585 Bacteria 1048
449 Ga0501069_0261117 3300049585 Bacteria 1011
450 Ga0501069_0604305 3300049585 Bacteria 658
451 Ga0501070_0000216 3300049586 Bacteria 54638
452 Ga0501070_0000763 3300049586 Bacteria 29376
453 Ga0501070_0005725 3300049586 Bacteria 10597
454 Ga0501070_0037832 3300049586 Bacteria 4027
455 Ga0501070_0106948 3300049586 Bacteria 2312
456 Ga0501070_0132232 3300049586 Bacteria 2061
457 Ga0501070_0211075 3300049586 Bacteria 1593
458 Ga0501071_0014469 3300049587 Bacteria 5396
459 Ga0501071_0248729 3300049587 Bacteria 1342
460 Ga0501072_0100650 3300049588 Bacteria 2297
461 Ga0501073_0000629 3300049589 Bacteria 24820
462 Ga0501073_0010094 3300049589 Bacteria 6943
463 Ga0501073_0052092 3300049589 Bacteria 2866
464 Ga0501073_0133820 3300049589 Bacteria 1718
465 Ga0501074_0007116 3300049590 Bacteria 8086
466 Ga0501074_0009232 3300049590 Bacteria 7166
467 Ga0501074_0041234 3300049590 Bacteria 3342
468 Ga0501074_0044876 3300049590 Bacteria 3198
469 Ga0501074_0634896 3300049590 Bacteria 755
470 Ga0501076_0140375 3300049592 Bacteria 1963
471 Ga0501076_0369508 3300049592 Bacteria 1179
472 Ga0501077_0017281 3300049593 Bacteria 4550
473 Ga0501077_0260982 3300049593 Bacteria 1102
474 Ga0501079_0036380 3300049741 Bacteria 3793
475 Ga0501079_0116865 3300049741 Bacteria 2073
476 Ga0501079_0189098 3300049741 Bacteria 1607
477 Ga0501079_0288400 3300049741 Bacteria 1283
478 Ga0501080_0000177 3300049742 Bacteria 46889
479 Ga0501080_0003278 3300049742 Bacteria 14297
480 Ga0501080_0052948 3300049742 Bacteria 3778
481 Ga0501080_0135030 3300049742 Bacteria 2283
482 Ga0501083_0001818 3300049744 Bacteria 14626
483 Ga0501083_0067514 3300049744 Bacteria 2380
484 Ga0501083_0122392 3300049744 Bacteria 1706
485 Ga0501035_0000648 3300049822 Bacteria 38367
486 Ga0501035_0053935 3300049822 Bacteria 3593
487 Ga0501035_0234058 3300049822 Bacteria 1565
488 Ga0501035_0247782 3300049822 Bacteria 1514
489 Ga0501044_0000585 3300049823 Bacteria 44237
490 Ga0501044_0102473 3300049823 Bacteria 2878
491 Ga0501045_0005967 3300049824 Bacteria 8429
492 Ga0501045_0182239 3300049824 Bacteria 1565
493 Ga0501045_0215124 3300049824 Bacteria 1431
494 nmdc:mga03n38_132928_c1 3300050490 Bacteria 1235
495 nmdc:mga03n38_21569_c1 3300050490 Bacteria 2594
496 nmdc:mga03n38_2943_c1 3300050490 Bacteria 5375
497 nmdc:mga00v17_220503_c1 3300050491 Bacteria 1228
498 nmdc:mga00v17_43129_c1 3300050491 Bacteria 2715
499 nmdc:mga0yw44_190499_c1 3300050492 Bacteria 1352
500 nmdc:mga0yw44_20939_c1 3300050492 Bacteria 3640
501 nmdc:mga0yw44_219113_c1 3300050492 Bacteria 1261
502 nmdc:mga0yw44_29165_c1 3300050492 Bacteria 3183
503 nmdc:mga0yw44_326555_c1 3300050492 Bacteria 1031
504 nmdc:mga0yw44_499053_c1 3300050492 Bacteria 826
505 nmdc:mga06z11_1232_c1 3300050494 Bacteria 9453
506 nmdc:mga04h51_11257_c1 3300050495 Bacteria 2479
507 nmdc:mga04h51_186837_c1 3300050495 Bacteria 809
508 nmdc:mga0qj67_114869_c1 3300050509 Bacteria 2174
509 Ga0495601_0060877 3300053077 Bacteria 2396
510 Ga0495601_0658705 3300053077 Bacteria 670
511 Ga0500644_0000129 3300053088 Bacteria 46233
512 Ga0500644_0027017 3300053088 Bacteria 1782
513 Ga0501084_0000922 3300054114 Bacteria 22716
514 Ga0501084_0023992 3300054114 Bacteria 5087
515 Ga0501084_0096568 3300054114 Bacteria 2482
516 Ga0501082_0002096 3300060353 Bacteria 17564
517 Ga0501082_0022251 3300060353 Bacteria 5463
518 Ga0501082_0110036 3300060353 Bacteria 2385
519 Ga0501082_0249741 3300060353 Bacteria 1544
520 Ga0466962_0005346 3300061719 Bacteria 6174
521 Ga0466962_0027080 3300061719 Bacteria 2753
522 Ga0466962_0032527 3300061719 Bacteria 2497
523 Ga0530510_0203278 3300061734 Bacteria 1472
524 Ga0530510_0497816 3300061734 Bacteria 924
525 2515851071 2515154155 Bacteria 7985436
526 2644445301 2643221679 Bacteria 3839507
527 2738696132 2738541272 Bacteria 6848551
528 2739605725 2739367654 Bacteria 6049412
529 2774392242 2773857762 Bacteria 5971770
530 2809028965 2808606394 Bacteria 6248540
531 2809196049 2808606439 Bacteria 5952208
532 2812351816 2811994878 Bacteria 5992952
533 2855386889 2855386786 Bacteria 4752232
534 2857485798 2857481737 Bacteria 4761446
535 2883824499 2883821847 Bacteria 5121194
536 2891970548 2891968417 Bacteria 5821697
537 2932399197 2932398195 Bacteria 3847976
538 Ga0105249_10407576
539 JGI24740J21852_10082217
540 JGI24737J22298_10100807
541 JGI24735J21928_10020671
542 JGI25406J46586_10037567
543 Ga0070658_10124374
544 Ga0070658_10202272
545 Ga0070658_11303750
546 Ga0070683_100004167
547 Ga0070683_100146494
548 Ga0070683_100424109
549 Ga0070677_10527349
550 Ga0070682_100015633
551 Ga0070682_100021170
552 Ga0068868_100204962
553 Ga0068868_100303417
554 Ga0068868_100474494
555 Ga0070660_100005730
556 Ga0070660_100084791
557 Ga0070689_100808097
558 Ga0070691_10211470
559 Ga0070687_100070259
560 Ga0070692_10167961
561 Ga0070668_100038354
562 Ga0070669_100519814
563 Ga0070671_101469066
564 Ga0070674_100372881
565 Ga0070674_100660122
566 Ga0070659_100014011
567 Ga0070659_100151301
568 Ga0070659_100186222
569 Ga0070659_100220864
570 Ga0070667_100013554
571 Ga0070700_100855050
572 Ga0070678_100545200
573 Ga0070662_100077975
574 Ga0070662_100934529
575 Ga0070681_10170818
576 Ga0070681_10319133
577 Ga0068867_100585424
578 Ga0070679_100007194
579 Ga0070684_100021693
580 Ga0070684_100146426
581 Ga0070684_100182623
582 Ga0070684_100191932
583 Ga0070684_100222488
584 Ga0070684_100356386
585 Ga0070672_100322308
586 Ga0070696_100624587
587 Ga0070664_100058520
588 Ga0068857_100005137
589 Ga0068857_100566875
590 Ga0068857_100957081
591 Ga0070702_100371621
592 Ga0070702_100513674
593 Ga0070702_100936790
594 Ga0068859_101294702
595 Ga0068864_100056624
596 Ga0068866_10187280
597 Ga0068866_10552840
598 Ga0068861_100063324
599 Ga0068861_100122199
600 Ga0068861_100166954
601 Ga0068861_100648335
602 Ga0068851_10522364
603 Ga0068870_10072069
604 Ga0068860_100182941
605 Ga0068862_100874881
606 Ga0081539_10000127
607 Ga0075365_10033077
608 Ga0075365_10070173
609 Ga0075365_10081115
610 Ga0075365_10116088
611 Ga0075365_10128106
612 Ga0075365_10172013
613 Ga0075365_10492899
614 Ga0075368_10096895
615 Ga0075363_100003180
616 Ga0075363_100041754
617 Ga0075363_100066044
618 Ga0075364_10029255
619 Ga0075364_10054928
620 Ga0075364_10285756
621 Ga0075367_10163545
622 Ga0075428_100034251
623 Ga0075430_100122736
624 Ga0075431_100033384
625 Ga0075433_10011509
626 Ga0075433_10020818
627 Ga0075434_100003989
628 Ga0075434_100394158
629 Ga0075429_100040766
630 Ga0075429_101221911
631 Ga0068865_100039942
632 Ga0068865_100093593
633 Ga0068865_100158941
634 Ga0075436_100003948
635 Ga0097620_101294513
636 Ga0075435_100002516
637 Ga0075435_100102388
638 Ga0111539_11657968
639 Ga0105245_10037145
640 Ga0105245_10106760
641 Ga0105245_10164000
642 Ga0105245_10858002
643 Ga0105245_11106731
644 Ga0105247_11199498
645 Ga0105243_10016977
646 Ga0105243_10094842
647 Ga0105242_10010999
648 Ga0105242_10252204
649 Ga0105248_10522364
650 Ga0105248_10547129
651 Ga0105238_10143226
652 Ga0105238_10161975
653 Ga0105249_10043608
654 Ga0105249_10044913
655 Ga0105249_10506625
656 Ga0105239_10011816
657 Ga0105239_10200467
658 Ga0105239_11592511
659 Ga0105246_11002962
660 Ga0157371_10105206
661 Ga0157371_10144228
662 Ga0157369_10250356
663 Ga0157374_11049549
664 Ga0157378_10479134
665 Ga0163162_10025921
666 Ga0163162_10584497
667 Ga0157372_10005055
668 Ga0157372_10153423
669 Ga0157372_10239890
670 Ga0157375_10022317
671 Ga0157375_10070276
672 Ga0157375_10178795
673 Ga0157375_10184116
674 Ga0157375_11288104
675 Ga0163163_10025986
676 Ga0163163_10709436
677 Ga0157380_10203181
678 Ga0157380_11196820
679 Ga0157380_11241815
680 Ga0157377_10182210
681 Ga0157377_10877454
682 Ga0163161_10137655
683 Ga0163161_10261628
684 Ga0207656_10357834
685 Ga0207688_10009974
686 Ga0207688_10104875
687 Ga0207688_10113802
688 Ga0207688_10496920
689 Ga0207647_10009136
690 Ga0207647_10087049
691 Ga0207647_10257451
692 Ga0207645_10898807
693 Ga0207643_10052044
694 Ga0207643_10299036
695 Ga0207705_10121134
696 Ga0207705_10320334
697 Ga0207707_10081176
698 Ga0207707_10203939
699 Ga0207662_10454993
700 Ga0207657_10058676
701 Ga0207657_10210956
702 Ga0207652_10039890
703 Ga0207681_10091553
704 Ga0207694_10412217
705 Ga0207659_10401898
706 Ga0207687_10010253
707 Ga0207687_10082718
708 Ga0207687_10136195
709 Ga0207687_10157060
710 Ga0207687_10973287
711 Ga0207690_10019354
712 Ga0207690_10198671
713 Ga0207690_10435393
714 Ga0207709_10055188
715 Ga0207704_10033521
716 Ga0207704_10151578
717 Ga0207704_10154297
718 Ga0207704_10184202
719 Ga0207691_10338395
720 Ga0207711_10383964
721 Ga0207661_10085539
722 Ga0207661_10207351
723 Ga0207661_10298524
724 Ga0207661_10444249
725 Ga0207661_10446666
726 Ga0207661_11145772
727 Ga0207679_10042248
728 Ga0207667_10157068
729 Ga0207667_11164928
730 Ga0207712_10018134
731 Ga0207712_10030760
732 Ga0207712_10080238
733 Ga0207712_10296892
734 Ga0207668_10044522
735 Ga0207668_10303735
736 Ga0207668_10489347
737 Ga0207639_10568765
738 Ga0207708_10173670
739 Ga0207702_11205919
740 Ga0207648_10022104
741 Ga0207676_10206995
742 Ga0207676_10385213
743 Ga0207674_10007885
744 Ga0207674_10712800
745 Ga0207675_100009269
746 Ga0207675_100011648
747 Ga0207675_100108800
748 Ga0207683_10050535
749 Ga0207698_10219567
750 Ga0207698_12045546
751 Ga0209813_10002147
752 Ga0209813_10166573
753 Ga0207428_10000855
754 Ga0207428_10008400
755 Ga0268265_11241709
756 Ga0268264_10000576
757 Ga0316181_1019724
758 Ga0316182_1384724
759 Ga0265327_10000062
760 Ga0307413_10762144
761 Ga0307410_10038061
762 Ga0307410_10494167
763 Ga0307410_10718625
764 Ga0307406_10026597
765 Ga0307406_10457930
766 Ga0307406_10649252
767 Ga0307407_10005801
768 Ga0307407_10112694
769 Ga0307407_10405024
770 Ga0307412_10025274
771 Ga0307412_10988301
772 Ga0307409_100089280
773 Ga0307409_100112482
774 Ga0307409_100182419
775 Ga0307409_100371204
776 Ga0307409_100685121
777 Ga0307416_100020809
778 Ga0307416_100249440
779 Ga0307416_100599351
780 Ga0307416_100692880
781 Ga0307411_10018683
782 Ga0307411_10126893
783 Ga0307411_10249378
784 Ga0307415_100003106
785 Ga0395900_0027470
786 Ga0395900_0208137
787 Ga0395898_0009822
788 Ga0395898_0033637
789 Ga0395898_0185297
790 Ga0395905_0030766
791 Ga0395901_0052553
792 Ga0395901_0090101
793 Ga0395901_0111700
794 Ga0395901_0260071
795 Ga0451787_738908
796 Ga0451793_1107916
797 Ga0451797_0053692
798 Ga0451835_0972303
799 Ga0451837_1114922
800 Ga0451841_0298374
801 Ga0451845_0011386
802 Ga0451849_0240205
803 Ga0451843_0456137
804 Ga0451853_2225099
805 Ga0451853_3478986
806 Ga0439463_020975
807 Ga0466972_0024035
808 Ga0466972_0030451
809 Ga0466965_0022651
810 Ga0466965_0051804
811 Ga0466965_0067095
812 Ga0466965_0661178
813 Ga0466966_0030796
814 Ga0466966_0033730
815 Ga0466966_0138379
816 Ga0466966_0295829
817 Ga0466961_0016493
818 Ga0466961_0017051
819 Ga0466961_0020218
820 Ga0466961_0095105
821 Ga0466961_0171204
822 Ga0466963_0009098
823 Ga0466963_0041680
824 Ga0466963_0254294
825 Ga0466963_0305952
826 Ga0466964_0023936
827 Ga0466971_0050423
828 Ga0466971_0093046
829 Ga0466970_0006407
830 Ga0466970_0008863
831 Ga0466970_0115977
832 Ga0466970_0207474
833 Ga0466970_0294185
834 Ga0466957_0016137
835 Ga0466957_0035939
836 Ga0466957_0150234
837 Ga0466957_0303068
838 Ga0466957_0595387
839 Ga0466960_0008282
840 Ga0466960_0073936
841 Ga0466960_0087243
842 Ga0466960_0089070
843 Ga0466959_0027187
844 Ga0466959_0144576
845 Ga0466959_0331086
846 Ga0466959_0473839
847 Ga0466958_0063052
848 Ga0466958_0076799
849 Ga0466958_0138042
850 Ga0466958_0248475
851 Ga0466967_0023189
852 Ga0466967_0045637
853 Ga0466967_0096205
854 Ga0466967_0104448
855 Ga0466967_0164099
856 Ga0466967_0170434
857 Ga0466967_0363748
858 Ga0466967_0393938
859 Ga0466967_0398715
860 Ga0466967_1072997
861 Ga0495608_0077615
862 Ga0495608_0228118
863 Ga0495620_0130358
864 Ga0495632_0291827
865 Ga0495635_0259239
866 Ga0495658_0377471
867 Ga0495670_0041459
868 Ga0495671_0342723
869 Ga0495636_0236535
870 Ga0495674_0843883
871 Ga0496100_0077880
872 Ga0496100_0154912
873 Ga0496101_0074891
874 Ga0496101_0321452
875 Ga0496102_0006010
876 Ga0496102_0062692
877 Ga0496102_0077546
878 Ga0496102_0143205
879 Ga0496102_0177192
880 Ga0496102_0419110
881 Ga0496103_0073461
882 Ga0496103_0246221
883 Ga0496103_0431274
884 Ga0496104_0009172
885 Ga0496104_0565384
886 Ga0496105_0139518
887 Ga0496105_0477604
888 Ga0496105_0534942
889 Ga0496106_0025998
890 Ga0496106_0120268
891 Ga0496106_0472994
892 Ga0496106_0611233
893 Ga0496107_0051667
894 Ga0496107_0209047
895 Ga0496107_0334594
896 Ga0496107_0458702
897 Ga0496108_0028403
898 Ga0496108_0029647
899 Ga0496108_0069740
900 Ga0496108_0232545
901 Ga0496109_0004950
902 Ga0496109_0068878
903 Ga0496109_0071412
904 Ga0496109_0137914
905 Ga0496109_0342773
906 Ga0496109_0399366
907 Ga0496109_0592239
908 Ga0496110_0033429
909 Ga0496110_0035173
910 Ga0496110_0230098
911 Ga0496110_0467715
912 Ga0496111_0102729
913 Ga0496111_0189377
914 Ga0496111_0387157
915 Ga0496113_0012785
916 Ga0496114_0004325
917 Ga0496114_0015700
918 Ga0496114_0073275
919 Ga0496114_0159051
920 Ga0496114_0268158
921 Ga0496114_0434833
922 Ga0496114_0452097
923 Ga0496114_0481168
924 Ga0496114_0537263
925 Ga0496114_0809464
926 Ga0496115_0011541
927 Ga0496115_0202424
928 Ga0496124_0048904
929 Ga0501031_0000074
930 Ga0501031_0059948
931 Ga0501032_0001064
932 Ga0501032_0010169
933 Ga0501032_0142509
934 Ga0501033_0000637
935 Ga0501034_0012497
936 Ga0501034_0034458
937 Ga0501034_0076745
938 Ga0501034_0272343
939 Ga0501036_0000629
940 Ga0501036_0012142
941 Ga0501036_0047151
942 Ga0501036_0344928
943 Ga0501037_0000235
944 Ga0501037_0084923
945 Ga0501037_0214751
946 Ga0501038_0000196
947 Ga0501038_0008938
948 Ga0501038_0230606
949 Ga0501039_0000124
950 Ga0501039_0041251
951 Ga0501040_0415423
952 Ga0501040_0804928
953 Ga0501041_0021665
954 Ga0501041_0239250
955 Ga0501042_0019976
956 Ga0501042_0164022
957 Ga0501042_0365055
958 Ga0501043_0000762
959 Ga0501043_0583489
960 Ga0501043_0833815
961 Ga0501046_0001934
962 Ga0501046_0012936
963 Ga0501046_0391504
964 Ga0501047_0000378
965 Ga0501047_0088505
966 Ga0501047_0139856
967 Ga0501048_0000096
968 Ga0501048_0016922
969 Ga0501048_0138160
970 Ga0501067_0002075
971 Ga0501067_0002914
972 Ga0501067_0016195
973 Ga0501067_0026505
974 Ga0501067_0048989
975 Ga0501067_0088819
976 Ga0501067_0126781
977 Ga0501067_0448923
978 Ga0501068_0012143
979 Ga0501068_0015371
980 Ga0501068_0036008
981 Ga0501068_0075027
982 Ga0501069_0000615
983 Ga0501069_0091339
984 Ga0501069_0134807
985 Ga0501069_0243531
986 Ga0501069_0261117
987 Ga0501069_0604305
988 Ga0501070_0000216
989 Ga0501070_0000763
990 Ga0501070_0005725
991 Ga0501070_0037832
992 Ga0501070_0106948
993 Ga0501070_0132232
994 Ga0501070_0211075
995 Ga0501071_0014469
996 Ga0501071_0248729
997 Ga0501072_0100650
998 Ga0501073_0000629
999 Ga0501073_0010094
1000 Ga0501073_0052092
1001 Ga0501073_0133820
1002 Ga0501074_0007116
1003 Ga0501074_0009232
1004 Ga0501074_0041234
1005 Ga0501074_0044876
1006 Ga0501074_0634896
1007 Ga0501076_0140375
1008 Ga0501076_0369508
1009 Ga0501077_0017281
1010 Ga0501077_0260982
1011 Ga0501079_0036380
1012 Ga0501079_0116865
1013 Ga0501079_0189098
1014 Ga0501079_0288400
1015 Ga0501080_0000177
1016 Ga0501080_0003278
1017 Ga0501080_0052948
1018 Ga0501080_0135030
1019 Ga0501083_0001818
1020 Ga0501083_0067514
1021 Ga0501083_0122392
1022 Ga0501035_0000648
1023 Ga0501035_0053935
1024 Ga0501035_0234058
1025 Ga0501035_0247782
1026 Ga0501044_0000585
1027 Ga0501044_0102473
1028 Ga0501045_0005967
1029 Ga0501045_0182239
1030 Ga0501045_0215124
1031 nmdc:mga03n38_132928_c1
1032 nmdc:mga03n38_21569_c1
1033 nmdc:mga03n38_2943_c1
1034 nmdc:mga00v17_220503_c1
1035 nmdc:mga00v17_43129_c1
1036 nmdc:mga0yw44_190499_c1
1037 nmdc:mga0yw44_20939_c1
1038 nmdc:mga0yw44_219113_c1
1039 nmdc:mga0yw44_29165_c1
1040 nmdc:mga0yw44_326555_c1
1041 nmdc:mga0yw44_499053_c1
1042 nmdc:mga06z11_1232_c1
1043 nmdc:mga04h51_11257_c1
1044 nmdc:mga04h51_186837_c1
1045 nmdc:mga0qj67_114869_c1
1046 Ga0495601_0060877
1047 Ga0495601_0658705
1048 Ga0500644_0000129
1049 Ga0500644_0027017
1050 Ga0501084_0000922
1051 Ga0501084_0023992
1052 Ga0501084_0096568
1053 Ga0501082_0002096
1054 Ga0501082_0022251
1055 Ga0501082_0110036
1056 Ga0501082_0249741
1057 Ga0466962_0005346
1058 Ga0466962_0027080
1059 Ga0466962_0032527
1060 Ga0530510_0203278
1061 Ga0530510_0497816
1062 2515851071
1063 2644445301
1064 2738696132
1065 2739605725
1066 2774392242
1067 2809028965
1068 2809196049
1069 2812351816
1070 2855386889
1071 2857485798
1072 2883824499
1073 2891970548
1074 2932399197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

76

170

0.94

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

63

172

0.88

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

51

167

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8695 40 174
5cs2-assembly1.cif.gz_A-2 crystal structure of plasmodium falciparum diadenosine triphosphate hydrolase in complex with cyclomarin a 0.8663 55 172
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8646 40 174
1fit-assembly1.cif.gz_A fhit (fragile histidine triad protein) 0.8473 55 175
4fit-assembly1.cif.gz_A-2 fhit-apo 0.8444 55 172
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9116 56 143 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9002 56 146 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8543 77 148 3.30.428.10
1emsB02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8458 54 172 3.30.428.10
2fhiA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.842 55 172 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A2I1PHY7-F1-model_v4 deleted 0.8972 41 146
AF-A0A7X8ZE03-F1-model_v4 HIT domain-containing protein 0.8967 42 174 GO:0000166
GO:0003824
AF-A0A1G2U672-F1-model_v4 HIT domain-containing protein 0.8953 41 146 GO:0003824
GO:0009117
AF-A0A2H9NW59-F1-model_v4 HIT domain-containing protein 0.8893 39 146 GO:0003824
AF-X1E0D2-F1-model_v4 HIT domain-containing protein 0.8868 41 143 GO:0000166
GO:0003824

Map