F460892

General Info

Members Datasets Scaffolds Average Seq Length
537 303 536 108

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_101850118|Ga0068854_1018501181
Length 102
Sequence MDPFEALGDPHRRTILALLGEGDRSVQELADALPISRPAVSRHLRLLKEAGLVSDRPEGTRRLYRLHEEGPEAVRAYLEQVWGDAAARFRLAAENTSGADEP

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
292 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
293 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
296 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
297 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
298 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.96
Nodule 0
Rhizoplane 5.96
Rhizosphere 87.34
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000123 3300003215 Bacteria 86708
2 Ga0070658_10019884 3300005327 Bacteria 5379
3 Ga0070658_10665117 3300005327 Bacteria 904
4 Ga0070683_100270749 3300005329 Bacteria 1615
5 Ga0070670_101206868 3300005331 Bacteria 691
6 Ga0068869_101096404 3300005334 Bacteria 696
7 Ga0070666_10141513 3300005335 Bacteria 1675
8 Ga0070680_100026268 3300005336 Bacteria 4656
9 Ga0070680_101943742 3300005336 Bacteria 510
10 Ga0070682_100051894 3300005337 Bacteria 2564
11 Ga0070660_100095019 3300005339 Bacteria 2355
12 Ga0070660_100438273 3300005339 Bacteria 1083
13 Ga0070660_100943478 3300005339 Unclassified 728
14 Ga0070689_101290719 3300005340 Bacteria 657
15 Ga0070691_10417826 3300005341 Bacteria 759
16 Ga0070687_101278388 3300005343 Bacteria 544
17 Ga0070661_100068950 3300005344 Bacteria 2599
18 Ga0070661_100373965 3300005344 Bacteria 1122
19 Ga0070675_101785043 3300005354 Unclassified 567
20 Ga0070671_100042084 3300005355 Bacteria 3797
21 Ga0070674_100162893 3300005356 Bacteria 1693
22 Ga0070674_101758743 3300005356 Unclassified 561
23 Ga0070673_100112284 3300005364 Bacteria 2262
24 Ga0070673_100192311 3300005364 Bacteria 1753
25 Ga0070673_100730126 3300005364 Bacteria 911
26 Ga0070659_100002582 3300005366 Bacteria 12873
27 Ga0070709_10019667 3300005434 Bacteria 3907
28 Ga0070714_100042303 3300005435 Bacteria 3848
29 Ga0070713_100027078 3300005436 Bacteria 4510
30 Ga0070713_100270925 3300005436 Bacteria 1555
31 Ga0070713_102117585 3300005436 Unclassified 545
32 Ga0070710_10018848 3300005437 Bacteria 3557
33 Ga0070710_10263687 3300005437 Bacteria 1112
34 Ga0070710_10525980 3300005437 Bacteria 813
35 Ga0070711_100107987 3300005439 Bacteria 2038
36 Ga0070711_100127868 3300005439 Unclassified 1888
37 Ga0070711_100295915 3300005439 Bacteria 1285
38 Ga0070711_101100424 3300005439 Unclassified 684
39 Ga0070711_101322623 3300005439 Bacteria 626
40 Ga0070705_101785952 3300005440 Unclassified 521
41 Ga0070705_101786916 3300005440 Unclassified 521
42 Ga0070708_100064734 3300005445 Bacteria 3276
43 Ga0070663_100416525 3300005455 Bacteria 1101
44 Ga0070663_101482806 3300005455 Bacteria 602
45 Ga0070678_100173558 3300005456 Bacteria 1758
46 Ga0070678_100211827 3300005456 Bacteria 1606
47 Ga0070662_100250334 3300005457 Bacteria 1424
48 Ga0070681_10032977 3300005458 Bacteria 5199
49 Ga0068867_100384144 3300005459 Bacteria 1180
50 Ga0070706_100776585 3300005467 Bacteria 887
51 Ga0070707_100851381 3300005468 Bacteria 876
52 Ga0070707_101049572 3300005468 Bacteria 780
53 Ga0070698_100225806 3300005471 Bacteria 1806
54 Ga0070699_100025432 3300005518 Bacteria 5103
55 Ga0070679_100015819 3300005530 Bacteria 7259
56 Ga0068853_100048354 3300005539 Bacteria 3653
57 Ga0068853_100761220 3300005539 Bacteria 926
58 Ga0070695_100432804 3300005545 Bacteria 1004
59 Ga0070696_100178563 3300005546 Bacteria 1574
60 Ga0070696_100268365 3300005546 Unclassified 1297
61 Ga0070704_100803230 3300005549 Bacteria 841
62 Ga0070664_101403208 3300005564 Bacteria 660
63 Ga0070664_101477613 3300005564 Bacteria 643
64 Ga0068854_101850118 3300005578 Unclassified 554
65 Ga0068856_100381562 3300005614 Unclassified 1429
66 Ga0068856_101275672 3300005614 Bacteria 750
67 Ga0068856_102278147 3300005614 Bacteria 550
68 Ga0070702_100331043 3300005615 Bacteria 1065
69 Ga0068852_100142201 3300005616 Bacteria 2222
70 Ga0068852_100362408 3300005616 Bacteria 1418
71 Ga0068864_100004858 3300005618 Bacteria 11004
72 Ga0068866_10790694 3300005718 Bacteria 659
73 Ga0068861_100315917 3300005719 Bacteria 1359
74 Ga0068851_10229268 3300005834 Bacteria 1047
75 Ga0068870_10746821 3300005840 Bacteria 679
76 Ga0068863_100192552 3300005841 Bacteria 1960
77 Ga0068860_101369410 3300005843 Bacteria 729
78 Ga0081455_10004915 3300005937 Bacteria 14806
79 Ga0081455_10016611 3300005937 Bacteria 7097
80 Ga0081455_10249463 3300005937 Bacteria 1299
81 Ga0081455_10942001 3300005937 Bacteria 536
82 Ga0081538_10026390 3300005981 Bacteria 4064
83 Ga0081540_1039382 3300005983 Bacteria 2478
84 Ga0081539_10000059 3300005985 Bacteria 254888
85 Ga0070717_10011591 3300006028 Bacteria 6701
86 Ga0070717_11739286 3300006028 Bacteria 564
87 Ga0075365_10005965 3300006038 Bacteria 6643
88 Ga0075365_10157420 3300006038 Bacteria 1582
89 Ga0075365_10208641 3300006038 Bacteria 1369
90 Ga0075368_10514267 3300006042 Bacteria 535
91 Ga0075364_10121553 3300006051 Bacteria 1748
92 Ga0070715_10037319 3300006163 Unclassified 2010
93 Ga0070715_10853383 3300006163 Bacteria 557
94 Ga0070715_10971977 3300006163 Bacteria 527
95 Ga0070716_100508884 3300006173 Bacteria 890
96 Ga0070712_100000272 3300006175 Bacteria 29104
97 Ga0070712_100004708 3300006175 Bacteria 8437
98 Ga0070712_100077892 3300006175 Bacteria 2391
99 Ga0070712_100292334 3300006175 Bacteria 1316
100 Ga0070712_100447138 3300006175 Bacteria 1075
101 Ga0070712_100886897 3300006175 Bacteria 768
102 Ga0070712_100947271 3300006175 Unclassified 744
103 Ga0070712_101024507 3300006175 Bacteria 715
104 Ga0070712_101126572 3300006175 Unclassified 681
105 Ga0075362_10042856 3300006177 Bacteria 2002
106 Ga0075367_10067238 3300006178 Bacteria 2148
107 Ga0075367_10385935 3300006178 Unclassified 885
108 Ga0097621_100146948 3300006237 Bacteria 2019
109 Ga0068871_100819012 3300006358 Bacteria 859
110 Ga0075428_100086288 3300006844 Bacteria 3423
111 Ga0075428_100168125 3300006844 Bacteria 2378
112 Ga0075428_100225960 3300006844 Bacteria 2020
113 Ga0075428_100569196 3300006844 Bacteria 1211
114 Ga0075428_100999358 3300006844 Bacteria 886
115 Ga0075428_101318767 3300006844 Bacteria 759
116 Ga0075430_100044548 3300006846 Bacteria 3751
117 Ga0075431_100137563 3300006847 Bacteria 2519
118 Ga0075433_10006561 3300006852 Bacteria 9209
119 Ga0075434_100018928 3300006871 Bacteria 6655
120 Ga0075434_100077073 3300006871 Bacteria 3328
121 Ga0075434_100231458 3300006871 Bacteria 1867
122 Ga0075434_100394586 3300006871 Unclassified 1405
123 Ga0075434_100572598 3300006871 Bacteria 1149
124 Ga0075429_100395708 3300006880 Unclassified 1210
125 Ga0068865_100707055 3300006881 Bacteria 862
126 Ga0075436_100107292 3300006914 Bacteria 1948
127 Ga0075436_101058062 3300006914 Bacteria 610
128 Ga0075435_100137784 3300007076 Bacteria 2046
129 Ga0075435_100303019 3300007076 Bacteria 1367
130 Ga0099794_10007825 3300007265 Bacteria 4412
131 Ga0099795_10578423 3300007788 Unclassified 532
132 Ga0105240_10087895 3300009093 Bacteria 3804
133 Ga0105245_10496603 3300009098 Bacteria 1236
134 Ga0105245_10548509 3300009098 Bacteria 1178
135 Ga0114129_10219595 3300009147 Bacteria 2565
136 Ga0114129_10483637 3300009147 Bacteria 1619
137 Ga0114129_10955325 3300009147 Bacteria 1082
138 Ga0114129_10997269 3300009147 Unclassified 1055
139 Ga0105243_10194309 3300009148 Bacteria 1775
140 Ga0105243_10538042 3300009148 Bacteria 1114
141 Ga0105241_10699820 3300009174 Bacteria 925
142 Ga0105242_10052807 3300009176 Bacteria 3318
143 Ga0105248_10036293 3300009177 Bacteria 5513
144 Ga0105238_10044506 3300009551 Bacteria 4486
145 Ga0105238_10383095 3300009551 Bacteria 1398
146 Ga0105238_12575839 3300009551 Bacteria 545
147 Ga0099796_10098897 3300010159 Bacteria 1095
148 Ga0105239_10392152 3300010375 Bacteria 1571
149 Ga0105246_10145785 3300011119 Bacteria 1786
150 Ga0157322_1041503 3300012490 Unclassified 530
151 Ga0157370_10060344 3300013104 Bacteria 3601
152 Ga0157370_11242651 3300013104 Bacteria 672
153 Ga0157369_10441179 3300013105 Bacteria 1348
154 Ga0157374_10048798 3300013296 Bacteria 3929
155 Ga0157378_10102191 3300013297 Bacteria 2618
156 Ga0157378_10242176 3300013297 Bacteria 1723
157 Ga0163162_10177683 3300013306 Bacteria 2255
158 Ga0157372_10089250 3300013307 Bacteria 3502
159 Ga0163163_10216276 3300014325 Bacteria 1965
160 Ga0163163_10951288 3300014325 Unclassified 922
161 Ga0157379_10013561 3300014968 Bacteria 7142
162 Ga0163161_10105666 3300017792 Bacteria 2100
163 Ga0163161_10678597 3300017792 Bacteria 856
164 Ga0163161_11319042 3300017792 Unclassified 628
165 Ga0206353_11679581 3300020082 Bacteria 1190
166 Ga0209148_1019122 3300025254 Bacteria 1141
167 Ga0209758_1000471 3300025297 Bacteria 66374
168 Ga0209257_1042542 3300025304 Bacteria 1339
169 Ga0209257_1111540 3300025304 Unclassified 652
170 Ga0207656_10107730 3300025321 Bacteria 1284
171 Ga0207692_10276456 3300025898 Bacteria 1014
172 Ga0207710_10074321 3300025900 Bacteria 1565
173 Ga0207688_10157548 3300025901 Bacteria 1344
174 Ga0207685_10015207 3300025905 Bacteria 2433
175 Ga0207685_10166677 3300025905 Unclassified 1010
176 Ga0207699_10079930 3300025906 Bacteria 2024
177 Ga0207699_10617224 3300025906 Bacteria 790
178 Ga0207699_11457658 3300025906 Unclassified 506
179 Ga0207643_10182182 3300025908 Bacteria 1272
180 Ga0207705_10007081 3300025909 Bacteria 8272
181 Ga0207684_10289188 3300025910 Bacteria 1413
182 Ga0207684_10311434 3300025910 Bacteria 1357
183 Ga0207707_10006922 3300025912 Bacteria 9894
184 Ga0207707_10032964 3300025912 Bacteria 4535
185 Ga0207693_10000145 3300025915 Bacteria 65383
186 Ga0207693_10004288 3300025915 Bacteria 12087
187 Ga0207693_10028686 3300025915 Bacteria 4398
188 Ga0207693_10129170 3300025915 Bacteria 1986
189 Ga0207693_10239240 3300025915 Bacteria 1425
190 Ga0207693_10345281 3300025915 Unclassified 1165
191 Ga0207693_10415542 3300025915 Bacteria 1051
192 Ga0207663_10010130 3300025916 Bacteria 5003
193 Ga0207663_10042470 3300025916 Bacteria 2778
194 Ga0207663_10046625 3300025916 Bacteria 2671
195 Ga0207663_10094716 3300025916 Bacteria 1990
196 Ga0207660_10003657 3300025917 Bacteria 10023
197 Ga0207657_10000372 3300025919 Bacteria 47410
198 Ga0207657_10039324 3300025919 Bacteria 4205
199 Ga0207657_10163163 3300025919 Bacteria 1809
200 Ga0207649_10234111 3300025920 Unclassified 1315
201 Ga0207649_11276412 3300025920 Unclassified 581
202 Ga0207652_10007908 3300025921 Bacteria 8534
203 Ga0207652_10284929 3300025921 Bacteria 1490
204 Ga0207646_10745423 3300025922 Bacteria 874
205 Ga0207694_10023367 3300025924 Bacteria 4692
206 Ga0207687_10749406 3300025927 Unclassified 831
207 Ga0207687_10895649 3300025927 Bacteria 759
208 Ga0207687_11011748 3300025927 Unclassified 713
209 Ga0207700_10192359 3300025928 Bacteria 1715
210 Ga0207700_10219225 3300025928 Bacteria 1612
211 Ga0207700_10534784 3300025928 Bacteria 1039
212 Ga0207664_10034629 3300025929 Bacteria 3890
213 Ga0207644_10063555 3300025931 Bacteria 2680
214 Ga0207690_10038450 3300025932 Bacteria 3115
215 Ga0207709_10368267 3300025935 Bacteria 1090
216 Ga0207669_10085411 3300025937 Bacteria 2037
217 Ga0207704_10562624 3300025938 Bacteria 928
218 Ga0207665_10015095 3300025939 Bacteria 5072
219 Ga0207665_10156653 3300025939 Bacteria 1635
220 Ga0207665_10528193 3300025939 Bacteria 914
221 Ga0207689_11534810 3300025942 Bacteria 556
222 Ga0207661_10076980 3300025944 Bacteria 2742
223 Ga0207679_10021909 3300025945 Bacteria 4341
224 Ga0207679_10244295 3300025945 Bacteria 1523
225 Ga0207679_11329371 3300025945 Bacteria 659
226 Ga0207667_10021734 3300025949 Bacteria 7108
227 Ga0207651_10592316 3300025960 Bacteria 968
228 Ga0207640_10989534 3300025981 Bacteria 739
229 Ga0207640_11005727 3300025981 Bacteria 734
230 Ga0207677_11309063 3300026023 Unclassified 666
231 Ga0207703_10479312 3300026035 Bacteria 1166
232 Ga0207703_10704164 3300026035 Bacteria 960
233 Ga0207703_12200493 3300026035 Bacteria 527
234 Ga0207639_10012255 3300026041 Bacteria 5969
235 Ga0207678_10559326 3300026067 Bacteria 1001
236 Ga0207702_10398226 3300026078 Bacteria 1327
237 Ga0207702_10590240 3300026078 Bacteria 1089
238 Ga0207702_11151513 3300026078 Bacteria 770
239 Ga0207641_10376592 3300026088 Bacteria 1358
240 Ga0207648_10095091 3300026089 Bacteria 2606
241 Ga0207676_10001883 3300026095 Bacteria 15340
242 Ga0207675_100047882 3300026118 Bacteria 3990
243 Ga0207683_10035429 3300026121 Bacteria 4340
244 Ga0207698_10118201 3300026142 Bacteria 2238
245 Ga0207698_10216024 3300026142 Bacteria 1729
246 Ga0207698_12251330 3300026142 Unclassified 557
247 Ga0209179_1064652 3300027512 Unclassified 797
248 Ga0265327_10006271 3300031251 Bacteria 9580
249 Ga0265314_10006452 3300031711 Bacteria 10384
250 Ga0307410_11227763 3300031852 Bacteria 654
251 Ga0373926_0079270 3300035083 Bacteria 1213
252 Ga0373934_0017176 3300035086 Bacteria 2759
253 Ga0373944_0028122 3300035089 Bacteria 1672
254 Ga0373944_0213437 3300035089 Bacteria 702
255 Ga0373923_0003698 3300035111 Bacteria 4951
256 Ga0373923_0423722 3300035111 Bacteria 643
257 Ga0373923_0439967 3300035111 Bacteria 631
258 Ga0373936_0000419 3300035113 Bacteria 14307
259 Ga0373936_0008941 3300035113 Bacteria 3776
260 Ga0373936_0291528 3300035113 Bacteria 735
261 Ga0373939_0418355 3300035114 Bacteria 558
262 Ga0373941_0267112 3300035115 Bacteria 673
263 Ga0373945_0004359 3300035116 Bacteria 4492
264 Ga0373953_0001453 3300035117 Bacteria 6865
265 Ga0373953_0025521 3300035117 Bacteria 2258
266 Ga0373954_0002992 3300035118 Bacteria 7129
267 Ga0373954_0003881 3300035118 Bacteria 6396
268 Ga0373956_0010700 3300035119 Bacteria 3766
269 Ga0373957_0013775 3300035120 Bacteria 2751
270 Ga0373957_0043499 3300035120 Bacteria 1697
271 Ga0373957_0398698 3300035120 Bacteria 592
272 Ga0373943_0009759 3300035170 Bacteria 4299
273 Ga0373943_0029980 3300035170 Bacteria 2573
274 Ga0373946_0000532 3300035171 Bacteria 12599
275 Ga0373955_0000096 3300035172 Bacteria 34998
276 Ga0373955_0011690 3300035172 Bacteria 4195
277 Ga0373955_0200181 3300035172 Bacteria 1189
278 Ga0373955_0983699 3300035172 Bacteria 519
279 Ga0373924_0023100 3300035410 Bacteria 2435
280 Ga0373931_0332879 3300035691 Bacteria 946
281 Ga0373935_0027732 3300035692 Bacteria 3500
282 Ga0373935_0038879 3300035692 Bacteria 2980
283 Ga0373935_0214500 3300035692 Bacteria 1335
284 Ga0373927_0011579 3300035695 Bacteria 5874
285 Ga0373927_0026791 3300035695 Bacteria 3767
286 Ga0373927_0277091 3300035695 Unclassified 1103
287 Ga0373927_0369551 3300035695 Bacteria 945
288 Ga0373933_0024792 3300035724 Bacteria 3435
289 Ga0373933_0324234 3300035724 Bacteria 999
290 Ga0373947_0002497 3300035725 Bacteria 11058
291 Ga0373947_0019388 3300035725 Bacteria 3922
292 Ga0373947_0245338 3300035725 Bacteria 1183
293 Ga0373947_0621285 3300035725 Unclassified 736
294 Ga0373937_0000009 3300036401 Bacteria 169521
295 Ga0373937_0008468 3300036401 Bacteria 8940
296 Ga0373937_0022046 3300036401 Bacteria 5721
297 Ga0373937_0537860 3300036401 Bacteria 1110
298 Ga0373925_0000036 3300037068 Bacteria 143388
299 Ga0373925_0060488 3300037068 Bacteria 2844
300 Ga0373925_0229404 3300037068 Bacteria 1484
301 Ga0373925_0310667 3300037068 Bacteria 1274
302 Ga0395899_0022899 3300037312 Bacteria 4733
303 Ga0436364_0679113 3300037853 Bacteria 1174
304 Ga0436364_0870732 3300037853 Bacteria 582
305 Ga0436364_1454240 3300037853 Bacteria 523
306 Ga0395901_0662352 3300038443 Bacteria 1046
307 Ga0436365_0511193 3300039437 Bacteria 577
308 Ga0436360_0690213 3300039438 Bacteria 1137
309 Ga0436361_0554078 3300039447 Bacteria 3860
310 Ga0436362_0746501 3300039453 Bacteria 1001
311 Ga0451577_1034530 3300042876 Bacteria 737
312 Ga0466964_0325375 3300044706 Bacteria 782
313 Ga0451576_1450783 3300045051 Bacteria 713
314 Ga0466967_0538064 3300045976 Bacteria 1149
315 Ga0495592_0000018 3300046454 Bacteria 140962
316 Ga0495603_0181258 3300046455 Bacteria 1218
317 Ga0495629_0002014 3300046459 Bacteria 15788
318 Ga0495629_0031581 3300046459 Bacteria 3749
319 Ga0495629_0037751 3300046459 Bacteria 3404
320 Ga0495641_0061897 3300046461 Bacteria 1689
321 Ga0495651_0000322 3300046462 Bacteria 37169
322 Ga0495651_0014021 3300046462 Bacteria 6199
323 Ga0495653_0000032 3300046463 Bacteria 132763
324 Ga0495653_0031563 3300046463 Bacteria 4210
325 Ga0495580_0781041 3300046472 Unclassified 620
326 Ga0495582_0171765 3300046473 Bacteria 1234
327 Ga0495582_0540372 3300046473 Bacteria 674
328 Ga0495639_0580778 3300046475 Bacteria 575
329 Ga0495662_0021767 3300046476 Bacteria 3098
330 Ga0495662_0205682 3300046476 Bacteria 970
331 Ga0495664_0000010 3300046477 Bacteria 268381
332 Ga0495664_0023586 3300046477 Bacteria 3571
333 Ga0495664_0206279 3300046477 Bacteria 1191
334 Ga0495584_0029891 3300046491 Bacteria 2761
335 Ga0495594_0022620 3300046499 Bacteria 3363
336 Ga0495594_0754463 3300046499 Unclassified 549
337 Ga0495608_0000008 3300046511 Bacteria 268629
338 Ga0495608_0096108 3300046511 Bacteria 1913
339 Ga0495618_0000002 3300046514 Bacteria 271353
340 Ga0495618_0007386 3300046514 Bacteria 6648
341 Ga0495618_0230918 3300046514 Bacteria 1165
342 Ga0495628_0000009 3300046516 Bacteria 237611
343 Ga0495628_0064334 3300046516 Bacteria 2872
344 Ga0495628_0087931 3300046516 Bacteria 2408
345 Ga0495628_0375544 3300046516 Bacteria 1042
346 Ga0495628_0600399 3300046516 Bacteria 786
347 Ga0495630_0000450 3300046517 Bacteria 31113
348 Ga0495630_0239442 3300046517 Unclassified 1386
349 Ga0495637_0184613 3300046520 Bacteria 772
350 Ga0495666_0124675 3300046526 Bacteria 1205
351 Ga0495652_0000011 3300046529 Bacteria 255329
352 Ga0495652_0044786 3300046529 Bacteria 3808
353 Ga0495665_0064234 3300046531 Bacteria 1937
354 Ga0495640_0000009 3300046533 Bacteria 217086
355 Ga0495640_0002839 3300046533 Bacteria 13934
356 Ga0495640_0462247 3300046533 Unclassified 774
357 Ga0495640_0507284 3300046533 Bacteria 734
358 Ga0495586_0024112 3300046535 Bacteria 3250
359 Ga0495587_0000006 3300046536 Bacteria 310070
360 Ga0495587_0001257 3300046536 Bacteria 16834
361 Ga0495598_0071703 3300046537 Bacteria 1092
362 Ga0495609_0156175 3300046538 Bacteria 969
363 Ga0495621_0487990 3300046539 Unclassified 530
364 Ga0495645_0000010 3300046543 Bacteria 238337
365 Ga0495645_0030534 3300046543 Bacteria 3924
366 Ga0495633_0564517 3300046558 Unclassified 512
367 Ga0495667_0000005 3300046559 Bacteria 268252
368 Ga0495667_0035829 3300046559 Bacteria 3314
369 Ga0495656_0045670 3300046615 Bacteria 1850
370 Ga0495656_0214812 3300046615 Bacteria 960
371 Ga0495634_0000656 3300046642 Bacteria 33583
372 Ga0495634_0039764 3300046642 Bacteria 3201
373 Ga0495634_0322717 3300046642 Bacteria 929
374 Ga0495611_0181402 3300046648 Bacteria 984
375 Ga0495635_0000008 3300046663 Bacteria 268349
376 Ga0495635_0976908 3300046663 Bacteria 540
377 Ga0495659_0127219 3300046664 Bacteria 1008
378 Ga0495659_0558390 3300046664 Bacteria 505
379 Ga0495657_0000058 3300046675 Bacteria 97827
380 Ga0495657_0006788 3300046675 Bacteria 8918
381 Ga0495599_0000007 3300046678 Bacteria 236638
382 Ga0495599_0037800 3300046678 Bacteria 3032
383 Ga0495623_0000067 3300046679 Bacteria 64348
384 Ga0495646_0000126 3300046680 Bacteria 38196
385 Ga0495646_0074641 3300046680 Bacteria 1989
386 Ga0495646_0423423 3300046680 Bacteria 690
387 Ga0495647_0253172 3300046681 Unclassified 784
388 Ga0495647_0313188 3300046681 Bacteria 709
389 Ga0495658_0025664 3300046683 Bacteria 3152
390 Ga0495658_0075305 3300046683 Bacteria 1969
391 Ga0495658_0506919 3300046683 Bacteria 772
392 Ga0495613_0009636 3300046689 Bacteria 7175
393 Ga0495613_0057451 3300046689 Bacteria 2857
394 Ga0495613_0251025 3300046689 Bacteria 1234
395 Ga0495624_0010482 3300046690 Bacteria 6388
396 Ga0495624_0091186 3300046690 Bacteria 1880
397 Ga0495624_0179292 3300046690 Bacteria 1291
398 Ga0495624_0826163 3300046690 Bacteria 547
399 Ga0495589_0138215 3300046794 Bacteria 1168
400 Ga0495600_0000001 3300046809 Bacteria 214870
401 Ga0495600_0075926 3300046809 Bacteria 2194
402 Ga0495581_0016578 3300047315 Bacteria 4282
403 Ga0495581_0179284 3300047315 Bacteria 1239
404 Ga0495604_0000012 3300047317 Bacteria 268341
405 Ga0495604_0004652 3300047317 Bacteria 10877
406 Ga0495674_0000011 3300047319 Bacteria 270911
407 Ga0495674_0011509 3300047319 Bacteria 8346
408 Ga0495674_0398046 3300047319 Unclassified 1112
409 Ga0495674_0918500 3300047319 Bacteria 675
410 Ga0495676_0447572 3300047321 Bacteria 852
411 Ga0495680_0000045 3300047322 Bacteria 96890
412 Ga0495680_0002786 3300047322 Bacteria 17617
413 Ga0495680_0230564 3300047322 Bacteria 1319
414 Ga0495680_0522252 3300047322 Unclassified 803
415 Ga0495675_0000110 3300047444 Bacteria 59086
416 Ga0495675_0002188 3300047444 Bacteria 11653
417 Ga0495684_0000014 3300047471 Bacteria 172111
418 Ga0495684_0045251 3300047471 Bacteria 3368
419 Ga0495684_0275842 3300047471 Bacteria 1215
420 Ga0495686_0142874 3300047472 Bacteria 1411
421 Ga0495593_0001961 3300047673 Bacteria 12270
422 Ga0495593_0044748 3300047673 Bacteria 2366
423 Ga0495593_0106869 3300047673 Bacteria 1431
424 Ga0495602_0000019 3300048088 Bacteria 170922
425 Ga0495602_0491748 3300048088 Bacteria 859
426 Ga0495615_0034049 3300048090 Bacteria 1238
427 Ga0496100_0078063 3300048903 Bacteria 2228
428 Ga0496100_0101955 3300048903 Bacteria 1979
429 Ga0496100_0442614 3300048903 Unclassified 995
430 Ga0496100_0909949 3300048903 Bacteria 691
431 Ga0496101_0063411 3300048904 Bacteria 2690
432 Ga0496101_0069504 3300048904 Bacteria 2577
433 Ga0496101_0456539 3300048904 Bacteria 1008
434 Ga0496102_0011991 3300048905 Bacteria 7488
435 Ga0496102_0209111 3300048905 Bacteria 1840
436 Ga0496102_0319701 3300048905 Bacteria 1462
437 Ga0496104_0008003 3300048907 Bacteria 9373
438 Ga0496104_1700374 3300048907 Bacteria 533
439 Ga0496105_0047705 3300048908 Bacteria 3535
440 Ga0496106_0094681 3300048909 Bacteria 2309
441 Ga0496106_0190876 3300048909 Bacteria 1629
442 Ga0496106_1021203 3300048909 Bacteria 650
443 Ga0496107_0031413 3300048910 Bacteria 3789
444 Ga0496107_0399674 3300048910 Bacteria 1022
445 Ga0496108_0153902 3300048911 Bacteria 1985
446 Ga0496108_1790732 3300048911 Bacteria 503
447 Ga0496109_0020242 3300048912 Bacteria 5876
448 Ga0496110_0091255 3300048913 Bacteria 2725
449 Ga0496110_0407050 3300048913 Bacteria 1240
450 Ga0496110_0459856 3300048913 Bacteria 1160
451 Ga0496110_0641244 3300048913 Bacteria 962
452 Ga0496112_0237073 3300048915 Bacteria 1778
453 Ga0496112_0312118 3300048915 Bacteria 1517
454 Ga0496112_1095920 3300048915 Bacteria 715
455 Ga0496114_0078590 3300048917 Bacteria 2783
456 Ga0496114_0822822 3300048917 Bacteria 808
457 Ga0496115_0080115 3300048918 Bacteria 2658
458 Ga0496115_0573025 3300048918 Bacteria 900
459 Ga0501033_0496231 3300049570 Bacteria 845
460 Ga0501039_0892317 3300049575 Bacteria 692
461 Ga0501042_0614405 3300049578 Bacteria 790
462 Ga0501043_0637873 3300049579 Bacteria 783
463 Ga0501048_0784702 3300049582 Bacteria 684
464 Ga0501068_1085202 3300049584 Bacteria 529
465 Ga0501070_0629841 3300049586 Bacteria 853
466 Ga0501070_0687391 3300049586 Bacteria 810
467 Ga0501071_0214825 3300049587 Bacteria 1447
468 Ga0501072_0314780 3300049588 Bacteria 1244
469 Ga0501072_0414669 3300049588 Unclassified 1068
470 Ga0501073_0352883 3300049589 Bacteria 1016
471 Ga0501073_0652034 3300049589 Bacteria 727
472 Ga0501073_0818780 3300049589 Bacteria 642
473 Ga0501075_1107822 3300049591 Bacteria 601
474 Ga0501076_0297666 3300049592 Bacteria 1322
475 Ga0501076_0639503 3300049592 Bacteria 878
476 Ga0501077_0082939 3300049593 Unclassified 2031
477 Ga0501077_0234263 3300049593 Unclassified 1167
478 Ga0501079_0157529 3300049741 Bacteria 1770
479 Ga0501079_1409301 3300049741 Bacteria 548
480 Ga0501080_0850173 3300049742 Bacteria 798
481 Ga0501081_0051310 3300049743 Bacteria 2845
482 Ga0501081_1121539 3300049743 Bacteria 595
483 Ga0501083_0230679 3300049744 Bacteria 1206
484 Ga0501035_0920852 3300049822 Bacteria 691
485 Ga0501045_0111471 3300049824 Bacteria 2029
486 nmdc:mga03n38_253529_c1 3300050490 Bacteria 930
487 nmdc:mga00v17_26848_c1 3300050491 Bacteria 3358
488 nmdc:mga0yw44_145313_c1 3300050492 Bacteria 1544
489 nmdc:mga0yw44_1888_c1 3300050492 Bacteria 8625
490 nmdc:mga0yw44_19480_c1 3300050492 Bacteria 3744
491 nmdc:mga06z11_262606_c1 3300050494 Bacteria 1019
492 nmdc:mga05p37_1154729_c1 3300050507 Bacteria 805
493 nmdc:mga05p37_395195_c1 3300050507 Bacteria 1616
494 nmdc:mga05p37_828528_c1 3300050507 Bacteria 1008
495 nmdc:mga09592_222164_c1 3300050508 Bacteria 1636
496 nmdc:mga0qj67_72949_c1 3300050509 Bacteria 2741
497 nmdc:mga06r32_115007_c1 3300050510 Bacteria 2649
498 nmdc:mga06r32_1671280_c1 3300050510 Bacteria 574
499 nmdc:mga0n895_10874_c1 3300050512 Bacteria 8079
500 nmdc:mga0n895_1753463_c1 3300050512 Bacteria 582
501 nmdc:mga0n895_664073_c1 3300050512 Bacteria 1040
502 nmdc:mga0n895_74698_c1 3300050512 Bacteria 3368
503 nmdc:mga0rr50_335476_c1 3300050513 Bacteria 1270
504 nmdc:mga08x19_940544_c1 3300050514 Bacteria 614
505 nmdc:mga0a205_3460_c1 3300050515 Bacteria 14101
506 Ga0495601_0000009 3300053077 Bacteria 270622
507 Ga0495601_0069029 3300053077 Bacteria 2253
508 Ga0495601_1026770 3300053077 Bacteria 518
509 Ga0495612_0000019 3300053078 Bacteria 137844
510 Ga0495612_0007038 3300053078 Bacteria 4600
511 Ga0495612_0065575 3300053078 Bacteria 1508
512 Ga0495595_0000015 3300053084 Bacteria 144946
513 Ga0495595_0010058 3300053084 Bacteria 3924
514 Ga0495595_0141292 3300053084 Bacteria 1181
515 Ga0495619_0000012 3300053085 Bacteria 268349
516 Ga0495619_0010715 3300053085 Bacteria 5772
517 Ga0495619_0011194 3300053085 Bacteria 5642
518 Ga0495619_0012642 3300053085 Bacteria 5314
519 Ga0500583_0405967 3300053092 Bacteria 653
520 Ga0500651_0020746 3300053093 Bacteria 4091
521 Ga0500641_0003283 3300053096 Bacteria 5718
522 Ga0500650_0042468 3300053098 Bacteria 2101
523 Ga0500555_002663 3300053103 Bacteria 5146
524 Ga0500556_0017369 3300053104 Bacteria 2253
525 Ga0500652_220723 3300053131 Bacteria 762
526 Ga0500655_020392 3300053133 Bacteria 1238
527 Ga0500577_0014506 3300053142 Bacteria 2438
528 Ga0500588_0183668 3300053146 Bacteria 769
529 Ga0500616_0000779 3300053153 Bacteria 36584
530 Ga0500622_0041117 3300053156 Bacteria 2407
531 Ga0501084_1074644 3300054114 Bacteria 676
532 Ga0501082_0193717 3300060353 Bacteria 1768
533 Ga0501082_1389919 3300060353 Unclassified 613
534 Ga0530510_0082904 3300061734 Bacteria 2335
535 Ga0530510_0614483 3300061734 Bacteria 827
536 Ga0530510_0659809 3300061734 Bacteria 796

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0652034 Ga0501073_0652034_62_343 93
2 3300005327 Ga0070658_10665117 Ga0070658_106651171 97
3 3300005329 Ga0070683_100270749 Ga0070683_1002707492 97
4 3300005339 Ga0070660_100438273 Ga0070660_1004382732 97
5 3300005356 Ga0070674_100162893 Ga0070674_1001628932 97
6 3300005456 Ga0070678_100211827 Ga0070678_1002118273 97
7 3300005459 Ga0068867_100384144 Ga0068867_1003841443 97
8 3300005549 Ga0070704_100803230 Ga0070704_1008032302 97
9 3300005564 Ga0070664_101403208 Ga0070664_1014032082 97
10 3300005615 Ga0070702_100331043 Ga0070702_1003310432 97
11 3300005719 Ga0068861_100315917 Ga0068861_1003159172 97
12 3300005834 Ga0068851_10229268 Ga0068851_102292681 97
13 3300005840 Ga0068870_10746821 Ga0068870_107468212 97
14 3300009098 Ga0105245_10496603 Ga0105245_104966032 97
15 3300009148 Ga0105243_10194309 Ga0105243_101943093 97
16 3300017792 Ga0163161_10678597 Ga0163161_106785973 97
17 3300025321 Ga0207656_10107730 Ga0207656_101077302 97
18 3300025901 Ga0207688_10157548 Ga0207688_101575482 97
19 3300025908 Ga0207643_10182182 Ga0207643_101821824 97
20 3300025919 Ga0207657_10163163 Ga0207657_101631633 97
21 3300025927 Ga0207687_10895649 Ga0207687_108956492 97
22 3300025935 Ga0207709_10368267 Ga0207709_103682672 97
23 3300025937 Ga0207669_10085411 Ga0207669_100854113 97
24 3300025944 Ga0207661_10076980 Ga0207661_100769804 97
25 3300025945 Ga0207679_11329371 Ga0207679_113293712 97
26 3300025981 Ga0207640_11005727 Ga0207640_110057272 97
27 3300026023 Ga0207677_11309063 Ga0207677_113090631 97
28 3300026089 Ga0207648_10095091 Ga0207648_100950912 97
29 3300026118 Ga0207675_100047882 Ga0207675_1000478825 97
30 3300026142 Ga0207698_12251330 Ga0207698_122513302 97
31 3300048905 Ga0496102_0209111 Ga0496102_0209111_1512_1808 97
32 3300048910 Ga0496107_0399674 Ga0496107_0399674_456_752 97
33 3300048913 Ga0496110_0641244 Ga0496110_0641244_75_371 97
34 3300005436 Ga0070713_102117585 Ga0070713_1021175851 99
35 3300046477 Ga0495664_0206279 Ga0495664_0206279_547_852 99
36 3300046539 Ga0495621_0487990 Ga0495621_0487990_11_313 99
37 3300046663 Ga0495635_0976908 Ga0495635_0976908_11_316 99
38 3300005614 Ga0068856_101275672 Ga0068856_1012756722 100
39 3300013105 Ga0157369_10441179 Ga0157369_104411793 100
40 3300026035 Ga0207703_12200493 Ga0207703_122004931 100
41 3300026078 Ga0207702_11151513 Ga0207702_111515132 100
42 3300035172 Ga0373955_0983699 Ga0373955_0983699_14_316 100
43 3300039447 Ga0436361_0554078 Ga0436361_0554078_1974_2276 100
44 3300048907 Ga0496104_1700374 Ga0496104_1700374_161_472 100
45 3300005578 Ga0068854_101850118 Ga0068854_1018501181 101
46 3300009551 Ga0105238_12575839 Ga0105238_125758392 101
47 3300035115 Ga0373941_0267112 Ga0373941_0267112_53_358 101
48 3300046516 Ga0495628_0064334 Ga0495628_0064334_2554_2862 101
49 3300005616 Ga0068852_100142201 Ga0068852_1001422014 102
50 3300009093 Ga0105240_10087895 Ga0105240_100878953 102
51 3300013104 Ga0157370_10060344 Ga0157370_100603442 102
52 3300013104 Ga0157370_11242651 Ga0157370_112426512 102
53 3300013307 Ga0157372_10089250 Ga0157372_100892502 102
54 3300025254 Ga0209148_1019122 Ga0209148_10191222 102
55 3300025912 Ga0207707_10032964 Ga0207707_100329641 102
56 3300025981 Ga0207640_10989534 Ga0207640_109895342 102
57 3300026142 Ga0207698_10118201 Ga0207698_101182012 102
58 3300035691 Ga0373931_0332879 Ga0373931_0332879_394_702 102
59 3300038443 Ga0395901_0662352 Ga0395901_0662352_194_508 102
60 3300005335 Ga0070666_10141513 Ga0070666_101415133 103
61 3300005355 Ga0070671_100042084 Ga0070671_1000420845 103
62 3300005364 Ga0070673_100192311 Ga0070673_1001923114 103
63 3300005364 Ga0070673_100730126 Ga0070673_1007301262 103
64 3300005440 Ga0070705_101786916 Ga0070705_1017869161 103
65 3300005455 Ga0070663_100416525 Ga0070663_1004165252 103
66 3300005456 Ga0070678_100173558 Ga0070678_1001735583 103
67 3300005457 Ga0070662_100250334 Ga0070662_1002503341 103
68 3300005616 Ga0068852_100362408 Ga0068852_1003624082 103
69 3300005618 Ga0068864_100004858 Ga0068864_10000485812 103
70 3300005841 Ga0068863_100192552 Ga0068863_1001925522 103
71 3300005843 Ga0068860_101369410 Ga0068860_1013694102 103
72 3300006358 Ga0068871_100819012 Ga0068871_1008190122 103
73 3300006852 Ga0075433_10006561 Ga0075433_100065614 103
74 3300006871 Ga0075434_100231458 Ga0075434_1002314583 103
75 3300013297 Ga0157378_10242176 Ga0157378_102421764 103
76 3300013306 Ga0163162_10177683 Ga0163162_101776834 103
77 3300014325 Ga0163163_10216276 Ga0163163_102162763 103
78 3300025931 Ga0207644_10063555 Ga0207644_100635554 103
79 3300025945 Ga0207679_10021909 Ga0207679_100219097 103
80 3300025960 Ga0207651_10592316 Ga0207651_105923162 103
81 3300026035 Ga0207703_10704164 Ga0207703_107041643 103
82 3300026067 Ga0207678_10559326 Ga0207678_105593262 103
83 3300026088 Ga0207641_10376592 Ga0207641_103765922 103
84 3300026095 Ga0207676_10001883 Ga0207676_100018833 103
85 3300026121 Ga0207683_10035429 Ga0207683_100354293 103
86 3300026142 Ga0207698_10216024 Ga0207698_102160242 103
87 3300031711 Ga0265314_10006452 Ga0265314_100064526 103
88 3300031852 Ga0307410_11227763 Ga0307410_112277632 103
89 3300048903 Ga0496100_0078063 Ga0496100_0078063_1283_1606 103
90 3300048904 Ga0496101_0069504 Ga0496101_0069504_1202_1525 103
91 3300048912 Ga0496109_0020242 Ga0496109_0020242_3046_3369 103
92 3300048913 Ga0496110_0091255 Ga0496110_0091255_584_907 103
93 3300049578 Ga0501042_0614405 Ga0501042_0614405_29_352 103
94 3300049591 Ga0501075_1107822 Ga0501075_1107822_181_504 103
95 3300049592 Ga0501076_0639503 Ga0501076_0639503_519_833 103
96 3300050512 nmdc:mga0n895_74698_c1 nmdc:mga0n895_74698_c1_561_887 103
97 3300050515 nmdc:mga0a205_3460_c1 nmdc:mga0a205_3460_c1_14_340 103
98 3300005985 Ga0081539_10000059 Ga0081539_10000059117 104
99 3300006844 Ga0075428_100168125 Ga0075428_1001681252 104
100 3300009147 Ga0114129_10955325 Ga0114129_109553252 104
101 3300035111 Ga0373923_0423722 Ga0373923_0423722_292_615 104
102 3300035120 Ga0373957_0398698 Ga0373957_0398698_254_577 104
103 3300037312 Ga0395899_0022899 Ga0395899_0022899_1898_2215 104
104 3300037853 Ga0436364_0679113 Ga0436364_0679113_700_1077 104
105 3300039437 Ga0436365_0511193 Ga0436365_0511193_203_520 104
106 3300045976 Ga0466967_0538064 Ga0466967_0538064_207_527 104
107 3300046491 Ga0495584_0029891 Ga0495584_0029891_215_541 104
108 3300046516 Ga0495628_0600399 Ga0495628_0600399_355_675 104
109 3300046615 Ga0495656_0045670 Ga0495656_0045670_1368_1694 104
110 3300046664 Ga0495659_0127219 Ga0495659_0127219_34_360 104
111 3300048088 Ga0495602_0491748 Ga0495602_0491748_403_729 104
112 3300049586 Ga0501070_0629841 Ga0501070_0629841_327_641 104
113 3300005614 Ga0068856_102278147 Ga0068856_1022781471 105
114 3300006237 Ga0097621_100146948 Ga0097621_1001469483 105
115 3300006844 Ga0075428_100569196 Ga0075428_1005691961 105
116 3300006871 Ga0075434_100077073 Ga0075434_1000770735 105
117 3300006871 Ga0075434_100572598 Ga0075434_1005725982 105
118 3300006880 Ga0075429_100395708 Ga0075429_1003957082 105
119 3300006914 Ga0075436_100107292 Ga0075436_1001072921 105
120 3300007076 Ga0075435_100137784 Ga0075435_1001377842 105
121 3300007788 Ga0099795_10578423 Ga0099795_105784232 105
122 3300009147 Ga0114129_10483637 Ga0114129_104836372 105
123 3300025304 Ga0209257_1042542 Ga0209257_10425422 105
124 3300035083 Ga0373926_0079270 Ga0373926_0079270_754_1074 105
125 3300035089 Ga0373944_0028122 Ga0373944_0028122_578_898 105
126 3300035113 Ga0373936_0291528 Ga0373936_0291528_52_372 105
127 3300035172 Ga0373955_0200181 Ga0373955_0200181_93_413 105
128 3300035692 Ga0373935_0214500 Ga0373935_0214500_809_1129 105
129 3300035695 Ga0373927_0369551 Ga0373927_0369551_352_672 105
130 3300035725 Ga0373947_0245338 Ga0373947_0245338_159_482 105
131 3300035725 Ga0373947_0621285 Ga0373947_0621285_279_599 105
132 3300037068 Ga0373925_0060488 Ga0373925_0060488_1721_2044 105
133 3300046455 Ga0495603_0181258 Ga0495603_0181258_700_1020 105
134 3300046461 Ga0495641_0061897 Ga0495641_0061897_641_961 105
135 3300046473 Ga0495582_0540372 Ga0495582_0540372_242_562 105
136 3300046475 Ga0495639_0580778 Ga0495639_0580778_29_352 105
137 3300046499 Ga0495594_0022620 Ga0495594_0022620_663_983 105
138 3300046520 Ga0495637_0184613 Ga0495637_0184613_373_693 105
139 3300046526 Ga0495666_0124675 Ga0495666_0124675_667_987 105
140 3300046533 Ga0495640_0507284 Ga0495640_0507284_283_603 105
141 3300046537 Ga0495598_0071703 Ga0495598_0071703_202_522 105
142 3300046538 Ga0495609_0156175 Ga0495609_0156175_12_332 105
143 3300046558 Ga0495633_0564517 Ga0495633_0564517_168_488 105
144 3300046615 Ga0495656_0214812 Ga0495656_0214812_351_671 105
145 3300046648 Ga0495611_0181402 Ga0495611_0181402_221_541 105
146 3300046681 Ga0495647_0253172 Ga0495647_0253172_373_693 105
147 3300046681 Ga0495647_0313188 Ga0495647_0313188_304_627 105
148 3300046683 Ga0495658_0025664 Ga0495658_0025664_2378_2698 105
149 3300046689 Ga0495613_0251025 Ga0495613_0251025_541_861 105
150 3300046690 Ga0495624_0179292 Ga0495624_0179292_331_651 105
151 3300046794 Ga0495589_0138215 Ga0495589_0138215_320_640 105
152 3300047315 Ga0495581_0179284 Ga0495581_0179284_836_1156 105
153 3300047472 Ga0495686_0142874 Ga0495686_0142874_916_1233 105
154 3300048090 Ga0495615_0034049 Ga0495615_0034049_721_1041 105
155 3300048915 Ga0496112_0312118 Ga0496112_0312118_297_617 105
156 3300049589 Ga0501073_0352883 Ga0501073_0352883_483_800 105
157 3300050507 nmdc:mga05p37_395195_c1 nmdc:mga05p37_395195_c1_923_1240 105
158 3300050508 nmdc:mga09592_222164_c1 nmdc:mga09592_222164_c1_97_414 105
159 3300050512 nmdc:mga0n895_664073_c1 nmdc:mga0n895_664073_c1_87_410 105
160 3300050513 nmdc:mga0rr50_335476_c1 nmdc:mga0rr50_335476_c1_336_659 105
161 3300053092 Ga0500583_0405967 Ga0500583_0405967_236_553 105
162 3300053093 Ga0500651_0020746 Ga0500651_0020746_219_536 105
163 3300053096 Ga0500641_0003283 Ga0500641_0003283_5245_5562 105
164 3300053098 Ga0500650_0042468 Ga0500650_0042468_1605_1922 105
165 3300053103 Ga0500555_002663 Ga0500555_002663_2000_2317 105
166 3300053104 Ga0500556_0017369 Ga0500556_0017369_153_470 105
167 3300053131 Ga0500652_220723 Ga0500652_220723_118_435 105
168 3300053133 Ga0500655_020392 Ga0500655_020392_195_512 105
169 3300053142 Ga0500577_0014506 Ga0500577_0014506_398_715 105
170 3300053146 Ga0500588_0183668 Ga0500588_0183668_56_373 105
171 3300053156 Ga0500622_0041117 Ga0500622_0041117_1921_2238 105
172 3300005343 Ga0070687_101278388 Ga0070687_1012783881 106
173 3300005436 Ga0070713_100270925 Ga0070713_1002709253 106
174 3300005439 Ga0070711_100127868 Ga0070711_1001278683 106
175 3300005440 Ga0070705_101785952 Ga0070705_1017859521 106
176 3300005445 Ga0070708_100064734 Ga0070708_1000647345 106
177 3300005468 Ga0070707_101049572 Ga0070707_1010495722 106
178 3300005518 Ga0070699_100025432 Ga0070699_1000254325 106
179 3300006163 Ga0070715_10853383 Ga0070715_108533832 106
180 3300006173 Ga0070716_100508884 Ga0070716_1005088842 106
181 3300006175 Ga0070712_100000272 Ga0070712_10000027226 106
182 3300006175 Ga0070712_100947271 Ga0070712_1009472711 106
183 3300006914 Ga0075436_101058062 Ga0075436_1010580622 106
184 3300007265 Ga0099794_10007825 Ga0099794_100078252 106
185 3300009147 Ga0114129_10219595 Ga0114129_102195954 106
186 3300014968 Ga0157379_10013561 Ga0157379_1001356110 106
187 3300025910 Ga0207684_10289188 Ga0207684_102891881 106
188 3300025910 Ga0207684_10311434 Ga0207684_103114342 106
189 3300025915 Ga0207693_10000145 Ga0207693_1000014544 106
190 3300025915 Ga0207693_10028686 Ga0207693_100286864 106
191 3300025916 Ga0207663_10010130 Ga0207663_100101304 106
192 3300025922 Ga0207646_10745423 Ga0207646_107454232 106
193 3300025928 Ga0207700_10192359 Ga0207700_101923593 106
194 3300025939 Ga0207665_10015095 Ga0207665_100150956 106
195 3300025939 Ga0207665_10528193 Ga0207665_105281931 106
196 3300026078 Ga0207702_10590240 Ga0207702_105902402 106
197 3300031251 Ga0265327_10006271 Ga0265327_100062717 106
198 3300035695 Ga0373927_0026791 Ga0373927_0026791_715_1035 106
199 3300036401 Ga0373937_0008468 Ga0373937_0008468_1538_1858 106
200 3300037068 Ga0373925_0229404 Ga0373925_0229404_456_776 106
201 3300037853 Ga0436364_0870732 Ga0436364_0870732_33_353 106
202 3300039438 Ga0436360_0690213 Ga0436360_0690213_26_346 106
203 3300046472 Ga0495580_0781041 Ga0495580_0781041_118_438 106
204 3300048909 Ga0496106_1021203 Ga0496106_1021203_58_378 106
205 3300048911 Ga0496108_1790732 Ga0496108_1790732_162_482 106
206 3300048913 Ga0496110_0407050 Ga0496110_0407050_589_909 106
207 3300048915 Ga0496112_1095920 Ga0496112_1095920_328_648 106
208 3300050507 nmdc:mga05p37_1154729_c1 nmdc:mga05p37_1154729_c1_219_539 106
209 3300050510 nmdc:mga06r32_1671280_c1 nmdc:mga06r32_1671280_c1_228_548 106
210 3300050514 nmdc:mga08x19_940544_c1 nmdc:mga08x19_940544_c1_127_447 106
211 3300053153 Ga0500616_0000779 Ga0500616_0000779_27127_27447 106
212 3300061734 Ga0530510_0614483 Ga0530510_0614483_437_760 106
213 3300005331 Ga0070670_101206868 Ga0070670_1012068682 107
214 3300005334 Ga0068869_101096404 Ga0068869_1010964042 107
215 3300005336 Ga0070680_101943742 Ga0070680_1019437421 107
216 3300005337 Ga0070682_100051894 Ga0070682_1000518941 107
217 3300005339 Ga0070660_100943478 Ga0070660_1009434781 107
218 3300005340 Ga0070689_101290719 Ga0070689_1012907191 107
219 3300005344 Ga0070661_100068950 Ga0070661_1000689504 107
220 3300005354 Ga0070675_101785043 Ga0070675_1017850431 107
221 3300005356 Ga0070674_101758743 Ga0070674_1017587432 107
222 3300005364 Ga0070673_100112284 Ga0070673_1001122844 107
223 3300005434 Ga0070709_10019667 Ga0070709_100196673 107
224 3300005435 Ga0070714_100042303 Ga0070714_1000423034 107
225 3300005436 Ga0070713_100027078 Ga0070713_1000270783 107
226 3300005437 Ga0070710_10018848 Ga0070710_100188481 107
227 3300005437 Ga0070710_10525980 Ga0070710_105259802 107
228 3300005439 Ga0070711_100107987 Ga0070711_1001079873 107
229 3300005439 Ga0070711_100295915 Ga0070711_1002959152 107
230 3300005439 Ga0070711_101100424 Ga0070711_1011004241 107
231 3300005439 Ga0070711_101322623 Ga0070711_1013226232 107
232 3300005455 Ga0070663_101482806 Ga0070663_1014828061 107
233 3300005467 Ga0070706_100776585 Ga0070706_1007765851 107
234 3300005468 Ga0070707_100851381 Ga0070707_1008513812 107
235 3300005471 Ga0070698_100225806 Ga0070698_1002258062 107
236 3300005545 Ga0070695_100432804 Ga0070695_1004328043 107
237 3300005546 Ga0070696_100178563 Ga0070696_1001785634 107
238 3300005546 Ga0070696_100268365 Ga0070696_1002683653 107
239 3300005564 Ga0070664_101477613 Ga0070664_1014776131 107
240 3300005614 Ga0068856_100381562 Ga0068856_1003815622 107
241 3300005718 Ga0068866_10790694 Ga0068866_107906942 107
242 3300005981 Ga0081538_10026390 Ga0081538_100263906 107
243 3300006028 Ga0070717_10011591 Ga0070717_100115916 107
244 3300006028 Ga0070717_11739286 Ga0070717_117392862 107
245 3300006042 Ga0075368_10514267 Ga0075368_105142672 107
246 3300006163 Ga0070715_10037319 Ga0070715_100373191 107
247 3300006163 Ga0070715_10971977 Ga0070715_109719771 107
248 3300006175 Ga0070712_100004708 Ga0070712_1000047085 107
249 3300006175 Ga0070712_100447138 Ga0070712_1004471382 107
250 3300006175 Ga0070712_100886897 Ga0070712_1008868972 107
251 3300006175 Ga0070712_101024507 Ga0070712_1010245072 107
252 3300006175 Ga0070712_101126572 Ga0070712_1011265722 107
253 3300006178 Ga0075367_10385935 Ga0075367_103859352 107
254 3300006844 Ga0075428_101318767 Ga0075428_1013187672 107
255 3300006871 Ga0075434_100018928 Ga0075434_1000189287 107
256 3300006871 Ga0075434_100394586 Ga0075434_1003945861 107
257 3300006881 Ga0068865_100707055 Ga0068865_1007070551 107
258 3300007076 Ga0075435_100303019 Ga0075435_1003030192 107
259 3300009098 Ga0105245_10548509 Ga0105245_105485092 107
260 3300009147 Ga0114129_10997269 Ga0114129_109972691 107
261 3300009148 Ga0105243_10538042 Ga0105243_105380423 107
262 3300009174 Ga0105241_10699820 Ga0105241_106998202 107
263 3300009176 Ga0105242_10052807 Ga0105242_100528075 107
264 3300009177 Ga0105248_10036293 Ga0105248_100362935 107
265 3300010375 Ga0105239_10392152 Ga0105239_103921523 107
266 3300011119 Ga0105246_10145785 Ga0105246_101457855 107
267 3300012490 Ga0157322_1041503 Ga0157322_10415032 107
268 3300013296 Ga0157374_10048798 Ga0157374_100487985 107
269 3300013297 Ga0157378_10102191 Ga0157378_101021912 107
270 3300014325 Ga0163163_10951288 Ga0163163_109512882 107
271 3300017792 Ga0163161_10105666 Ga0163161_101056664 107
272 3300017792 Ga0163161_11319042 Ga0163161_113190422 107
273 3300020082 Ga0206353_11679581 Ga0206353_116795812 107
274 3300025900 Ga0207710_10074321 Ga0207710_100743214 107
275 3300025905 Ga0207685_10015207 Ga0207685_100152073 107
276 3300025906 Ga0207699_10079930 Ga0207699_100799302 107
277 3300025915 Ga0207693_10004288 Ga0207693_100042888 107
278 3300025915 Ga0207693_10129170 Ga0207693_101291703 107
279 3300025915 Ga0207693_10239240 Ga0207693_102392402 107
280 3300025916 Ga0207663_10042470 Ga0207663_100424704 107
281 3300025916 Ga0207663_10046625 Ga0207663_100466254 107
282 3300025916 Ga0207663_10094716 Ga0207663_100947163 107
283 3300025920 Ga0207649_11276412 Ga0207649_112764122 107
284 3300025921 Ga0207652_10284929 Ga0207652_102849293 107
285 3300025927 Ga0207687_10749406 Ga0207687_107494061 107
286 3300025927 Ga0207687_11011748 Ga0207687_110117482 107
287 3300025928 Ga0207700_10534784 Ga0207700_105347841 107
288 3300025929 Ga0207664_10034629 Ga0207664_100346292 107
289 3300025938 Ga0207704_10562624 Ga0207704_105626242 107
290 3300025942 Ga0207689_11534810 Ga0207689_115348101 107
291 3300025945 Ga0207679_10244295 Ga0207679_102442952 107
292 3300026035 Ga0207703_10479312 Ga0207703_104793122 107
293 3300026078 Ga0207702_10398226 Ga0207702_103982262 107
294 3300035086 Ga0373934_0017176 Ga0373934_0017176_2312_2638 107
295 3300035111 Ga0373923_0439967 Ga0373923_0439967_67_390 107
296 3300035117 Ga0373953_0001453 Ga0373953_0001453_5060_5386 107
297 3300035118 Ga0373954_0003881 Ga0373954_0003881_753_1079 107
298 3300035120 Ga0373957_0043499 Ga0373957_0043499_1068_1394 107
299 3300035170 Ga0373943_0029980 Ga0373943_0029980_1861_2184 107
300 3300035172 Ga0373955_0011690 Ga0373955_0011690_1074_1400 107
301 3300035692 Ga0373935_0027732 Ga0373935_0027732_1416_1739 107
302 3300035695 Ga0373927_0277091 Ga0373927_0277091_344_670 107
303 3300035725 Ga0373947_0019388 Ga0373947_0019388_109_432 107
304 3300036401 Ga0373937_0022046 Ga0373937_0022046_2873_3199 107
305 3300036401 Ga0373937_0537860 Ga0373937_0537860_333_659 107
306 3300037068 Ga0373925_0310667 Ga0373925_0310667_670_993 107
307 3300037853 Ga0436364_1454240 Ga0436364_1454240_64_390 107
308 3300039453 Ga0436362_0746501 Ga0436362_0746501_12_383 107
309 3300044706 Ga0466964_0325375 Ga0466964_0325375_326_652 107
310 3300046459 Ga0495629_0031581 Ga0495629_0031581_2732_3058 107
311 3300046462 Ga0495651_0014021 Ga0495651_0014021_3796_4122 107
312 3300046463 Ga0495653_0031563 Ga0495653_0031563_1105_1431 107
313 3300046476 Ga0495662_0205682 Ga0495662_0205682_600_923 107
314 3300046477 Ga0495664_0023586 Ga0495664_0023586_1199_1525 107
315 3300046511 Ga0495608_0096108 Ga0495608_0096108_1561_1887 107
316 3300046514 Ga0495618_0007386 Ga0495618_0007386_5002_5328 107
317 3300046516 Ga0495628_0087931 Ga0495628_0087931_1393_1719 107
318 3300046516 Ga0495628_0375544 Ga0495628_0375544_696_1022 107
319 3300046517 Ga0495630_0239442 Ga0495630_0239442_397_723 107
320 3300046529 Ga0495652_0044786 Ga0495652_0044786_2498_2824 107
321 3300046533 Ga0495640_0002839 Ga0495640_0002839_1398_1724 107
322 3300046536 Ga0495587_0001257 Ga0495587_0001257_41_367 107
323 3300046543 Ga0495645_0030534 Ga0495645_0030534_2206_2532 107
324 3300046559 Ga0495667_0035829 Ga0495667_0035829_1828_2154 107
325 3300046642 Ga0495634_0039764 Ga0495634_0039764_1799_2125 107
326 3300046642 Ga0495634_0322717 Ga0495634_0322717_261_584 107
327 3300046675 Ga0495657_0006788 Ga0495657_0006788_1781_2107 107
328 3300046678 Ga0495599_0037800 Ga0495599_0037800_1870_2196 107
329 3300046680 Ga0495646_0074641 Ga0495646_0074641_229_555 107
330 3300046680 Ga0495646_0423423 Ga0495646_0423423_293_619 107
331 3300046683 Ga0495658_0506919 Ga0495658_0506919_97_420 107
332 3300046689 Ga0495613_0057451 Ga0495613_0057451_643_969 107
333 3300046690 Ga0495624_0091186 Ga0495624_0091186_312_638 107
334 3300046690 Ga0495624_0826163 Ga0495624_0826163_81_404 107
335 3300046809 Ga0495600_0075926 Ga0495600_0075926_1606_1932 107
336 3300047317 Ga0495604_0004652 Ga0495604_0004652_8554_8880 107
337 3300047319 Ga0495674_0011509 Ga0495674_0011509_5374_5700 107
338 3300047319 Ga0495674_0918500 Ga0495674_0918500_207_530 107
339 3300047322 Ga0495680_0002786 Ga0495680_0002786_10276_10602 107
340 3300047322 Ga0495680_0522252 Ga0495680_0522252_135_458 107
341 3300047444 Ga0495675_0002188 Ga0495675_0002188_9798_10124 107
342 3300047471 Ga0495684_0045251 Ga0495684_0045251_1570_1896 107
343 3300047673 Ga0495593_0044748 Ga0495593_0044748_411_737 107
344 3300048903 Ga0496100_0101955 Ga0496100_0101955_203_529 107
345 3300048903 Ga0496100_0909949 Ga0496100_0909949_297_623 107
346 3300048904 Ga0496101_0063411 Ga0496101_0063411_1502_1828 107
347 3300048904 Ga0496101_0456539 Ga0496101_0456539_12_338 107
348 3300048905 Ga0496102_0011991 Ga0496102_0011991_3351_3677 107
349 3300048905 Ga0496102_0319701 Ga0496102_0319701_30_407 107
350 3300048907 Ga0496104_0008003 Ga0496104_0008003_7153_7479 107
351 3300048908 Ga0496105_0047705 Ga0496105_0047705_1194_1520 107
352 3300048909 Ga0496106_0094681 Ga0496106_0094681_1418_1744 107
353 3300048909 Ga0496106_0190876 Ga0496106_0190876_766_1092 107
354 3300048910 Ga0496107_0031413 Ga0496107_0031413_272_598 107
355 3300048911 Ga0496108_0153902 Ga0496108_0153902_1308_1634 107
356 3300048913 Ga0496110_0459856 Ga0496110_0459856_70_396 107
357 3300048915 Ga0496112_0237073 Ga0496112_0237073_430_756 107
358 3300048917 Ga0496114_0078590 Ga0496114_0078590_629_955 107
359 3300048917 Ga0496114_0822822 Ga0496114_0822822_389_712 107
360 3300048918 Ga0496115_0080115 Ga0496115_0080115_1451_1777 107
361 3300048918 Ga0496115_0573025 Ga0496115_0573025_258_584 107
362 3300049570 Ga0501033_0496231 Ga0501033_0496231_399_725 107
363 3300049575 Ga0501039_0892317 Ga0501039_0892317_101_427 107
364 3300049579 Ga0501043_0637873 Ga0501043_0637873_144_470 107
365 3300049582 Ga0501048_0784702 Ga0501048_0784702_137_463 107
366 3300049584 Ga0501068_1085202 Ga0501068_1085202_130_456 107
367 3300049587 Ga0501071_0214825 Ga0501071_0214825_574_900 107
368 3300049588 Ga0501072_0314780 Ga0501072_0314780_451_777 107
369 3300049588 Ga0501072_0414669 Ga0501072_0414669_465_791 107
370 3300049592 Ga0501076_0297666 Ga0501076_0297666_887_1213 107
371 3300049593 Ga0501077_0082939 Ga0501077_0082939_414_740 107
372 3300049593 Ga0501077_0234263 Ga0501077_0234263_114_440 107
373 3300049741 Ga0501079_0157529 Ga0501079_0157529_1300_1626 107
374 3300049741 Ga0501079_1409301 Ga0501079_1409301_129_455 107
375 3300049742 Ga0501080_0850173 Ga0501080_0850173_124_450 107
376 3300049743 Ga0501081_0051310 Ga0501081_0051310_1774_2100 107
377 3300049743 Ga0501081_1121539 Ga0501081_1121539_257_583 107
378 3300049744 Ga0501083_0230679 Ga0501083_0230679_104_430 107
379 3300049822 Ga0501035_0920852 Ga0501035_0920852_308_634 107
380 3300049824 Ga0501045_0111471 Ga0501045_0111471_1017_1343 107
381 3300050492 nmdc:mga0yw44_19480_c1 nmdc:mga0yw44_19480_c1_182_508 107
382 3300050492 nmdc:mga0yw44_19480_c1 nmdc:mga0yw44_19480_c1_3237_3563 107
383 3300050494 nmdc:mga06z11_262606_c1 nmdc:mga06z11_262606_c1_487_813 107
384 3300050512 nmdc:mga0n895_10874_c1 nmdc:mga0n895_10874_c1_5323_5655 107
385 3300050512 nmdc:mga0n895_1753463_c1 nmdc:mga0n895_1753463_c1_118_444 107
386 3300053077 Ga0495601_0069029 Ga0495601_0069029_321_647 107
387 3300053077 Ga0495601_1026770 Ga0495601_1026770_65_388 107
388 3300053078 Ga0495612_0007038 Ga0495612_0007038_3184_3510 107
389 3300053078 Ga0495612_0065575 Ga0495612_0065575_902_1228 107
390 3300053084 Ga0495595_0010058 Ga0495595_0010058_2206_2532 107
391 3300053084 Ga0495595_0141292 Ga0495595_0141292_817_1143 107
392 3300053085 Ga0495619_0010715 Ga0495619_0010715_3338_3664 107
393 3300053085 Ga0495619_0012642 Ga0495619_0012642_2280_2606 107
394 3300054114 Ga0501084_1074644 Ga0501084_1074644_102_428 107
395 3300060353 Ga0501082_0193717 Ga0501082_0193717_1243_1569 107
396 3300060353 Ga0501082_1389919 Ga0501082_1389919_138_464 107
397 3300061734 Ga0530510_0082904 Ga0530510_0082904_1180_1506 107
398 3300061734 Ga0530510_0659809 Ga0530510_0659809_399_725 107
399 3300003215 JGI25153J46596_10000123 JGI25153J46596_1000012316 108
400 3300005327 Ga0070658_10019884 Ga0070658_100198843 108
401 3300005336 Ga0070680_100026268 Ga0070680_1000262684 108
402 3300005339 Ga0070660_100095019 Ga0070660_1000950192 108
403 3300005341 Ga0070691_10417826 Ga0070691_104178262 108
404 3300005344 Ga0070661_100373965 Ga0070661_1003739653 108
405 3300005366 Ga0070659_100002582 Ga0070659_10000258210 108
406 3300005437 Ga0070710_10263687 Ga0070710_102636872 108
407 3300005458 Ga0070681_10032977 Ga0070681_100329777 108
408 3300005530 Ga0070679_100015819 Ga0070679_1000158193 108
409 3300005539 Ga0068853_100048354 Ga0068853_1000483543 108
410 3300005539 Ga0068853_100761220 Ga0068853_1007612201 108
411 3300005937 Ga0081455_10004915 Ga0081455_1000491512 108
412 3300005937 Ga0081455_10016611 Ga0081455_100166116 108
413 3300005937 Ga0081455_10249463 Ga0081455_102494632 108
414 3300005937 Ga0081455_10942001 Ga0081455_109420011 108
415 3300005983 Ga0081540_1039382 Ga0081540_10393826 108
416 3300006038 Ga0075365_10005965 Ga0075365_100059651 108
417 3300006038 Ga0075365_10157420 Ga0075365_101574203 108
418 3300006038 Ga0075365_10208641 Ga0075365_102086412 108
419 3300006051 Ga0075364_10121553 Ga0075364_101215532 108
420 3300006175 Ga0070712_100077892 Ga0070712_1000778924 108
421 3300006175 Ga0070712_100292334 Ga0070712_1002923342 108
422 3300006177 Ga0075362_10042856 Ga0075362_100428565 108
423 3300006178 Ga0075367_10067238 Ga0075367_100672384 108
424 3300006844 Ga0075428_100086288 Ga0075428_1000862882 108
425 3300006844 Ga0075428_100225960 Ga0075428_1002259602 108
426 3300006844 Ga0075428_100999358 Ga0075428_1009993582 108
427 3300006846 Ga0075430_100044548 Ga0075430_1000445484 108
428 3300006847 Ga0075431_100137563 Ga0075431_1001375633 108
429 3300009551 Ga0105238_10044506 Ga0105238_100445062 108
430 3300009551 Ga0105238_10383095 Ga0105238_103830953 108
431 3300010159 Ga0099796_10098897 Ga0099796_100988972 108
432 3300025297 Ga0209758_1000471 Ga0209758_100047157 108
433 3300025304 Ga0209257_1111540 Ga0209257_11115401 108
434 3300025898 Ga0207692_10276456 Ga0207692_102764561 108
435 3300025905 Ga0207685_10166677 Ga0207685_101666773 108
436 3300025906 Ga0207699_10617224 Ga0207699_106172242 108
437 3300025906 Ga0207699_11457658 Ga0207699_114576582 108
438 3300025909 Ga0207705_10007081 Ga0207705_100070815 108
439 3300025912 Ga0207707_10006922 Ga0207707_100069228 108
440 3300025915 Ga0207693_10345281 Ga0207693_103452811 108
441 3300025915 Ga0207693_10415542 Ga0207693_104155421 108
442 3300025917 Ga0207660_10003657 Ga0207660_100036572 108
443 3300025919 Ga0207657_10000372 Ga0207657_1000037223 108
444 3300025919 Ga0207657_10039324 Ga0207657_100393243 108
445 3300025920 Ga0207649_10234111 Ga0207649_102341113 108
446 3300025921 Ga0207652_10007908 Ga0207652_100079086 108
447 3300025924 Ga0207694_10023367 Ga0207694_100233672 108
448 3300025928 Ga0207700_10219225 Ga0207700_102192253 108
449 3300025932 Ga0207690_10038450 Ga0207690_100384504 108
450 3300025939 Ga0207665_10156653 Ga0207665_101566533 108
451 3300025949 Ga0207667_10021734 Ga0207667_100217345 108
452 3300026041 Ga0207639_10012255 Ga0207639_100122554 108
453 3300027512 Ga0209179_1064652 Ga0209179_10646522 108
454 3300035089 Ga0373944_0213437 Ga0373944_0213437_25_366 108
455 3300035111 Ga0373923_0003698 Ga0373923_0003698_3794_4135 108
456 3300035113 Ga0373936_0000419 Ga0373936_0000419_1298_1639 108
457 3300035113 Ga0373936_0008941 Ga0373936_0008941_2365_2703 108
458 3300035114 Ga0373939_0418355 Ga0373939_0418355_48_389 108
459 3300035116 Ga0373945_0004359 Ga0373945_0004359_3580_3921 108
460 3300035117 Ga0373953_0025521 Ga0373953_0025521_280_621 108
461 3300035118 Ga0373954_0002992 Ga0373954_0002992_1441_1782 108
462 3300035119 Ga0373956_0010700 Ga0373956_0010700_2989_3330 108
463 3300035120 Ga0373957_0013775 Ga0373957_0013775_1486_1827 108
464 3300035170 Ga0373943_0009759 Ga0373943_0009759_1073_1414 108
465 3300035171 Ga0373946_0000532 Ga0373946_0000532_12066_12407 108
466 3300035172 Ga0373955_0000096 Ga0373955_0000096_24265_24606 108
467 3300035410 Ga0373924_0023100 Ga0373924_0023100_537_878 108
468 3300035692 Ga0373935_0038879 Ga0373935_0038879_1860_2201 108
469 3300035695 Ga0373927_0011579 Ga0373927_0011579_2754_3095 108
470 3300035724 Ga0373933_0024792 Ga0373933_0024792_2674_3015 108
471 3300035724 Ga0373933_0324234 Ga0373933_0324234_517_858 108
472 3300035725 Ga0373947_0002497 Ga0373947_0002497_62_403 108
473 3300036401 Ga0373937_0000009 Ga0373937_0000009_128555_128896 108
474 3300037068 Ga0373925_0000036 Ga0373925_0000036_126664_127005 108
475 3300042876 Ga0451577_1034530 Ga0451577_1034530_26_436 108
476 3300045051 Ga0451576_1450783 Ga0451576_1450783_275_685 108
477 3300046454 Ga0495592_0000018 Ga0495592_0000018_65646_65987 108
478 3300046459 Ga0495629_0002014 Ga0495629_0002014_8763_9104 108
479 3300046459 Ga0495629_0037751 Ga0495629_0037751_1537_1878 108
480 3300046462 Ga0495651_0000322 Ga0495651_0000322_21164_21505 108
481 3300046463 Ga0495653_0000032 Ga0495653_0000032_97756_98097 108
482 3300046473 Ga0495582_0171765 Ga0495582_0171765_258_599 108
483 3300046476 Ga0495662_0021767 Ga0495662_0021767_1901_2242 108
484 3300046477 Ga0495664_0000010 Ga0495664_0000010_139615_139956 108
485 3300046499 Ga0495594_0754463 Ga0495594_0754463_47_388 108
486 3300046511 Ga0495608_0000008 Ga0495608_0000008_128693_129034 108
487 3300046514 Ga0495618_0000002 Ga0495618_0000002_141888_142229 108
488 3300046514 Ga0495618_0230918 Ga0495618_0230918_744_1085 108
489 3300046516 Ga0495628_0000009 Ga0495628_0000009_139643_139984 108
490 3300046517 Ga0495630_0000450 Ga0495630_0000450_28869_29210 108
491 3300046529 Ga0495652_0000011 Ga0495652_0000011_128383_128724 108
492 3300046531 Ga0495665_0064234 Ga0495665_0064234_1166_1507 108
493 3300046533 Ga0495640_0000009 Ga0495640_0000009_77135_77476 108
494 3300046533 Ga0495640_0462247 Ga0495640_0462247_135_476 108
495 3300046535 Ga0495586_0024112 Ga0495586_0024112_330_671 108
496 3300046536 Ga0495587_0000006 Ga0495587_0000006_253361_253702 108
497 3300046543 Ga0495645_0000010 Ga0495645_0000010_97756_98097 108
498 3300046559 Ga0495667_0000005 Ga0495667_0000005_139643_139984 108
499 3300046642 Ga0495634_0000656 Ga0495634_0000656_1218_1559 108
500 3300046663 Ga0495635_0000008 Ga0495635_0000008_128366_128707 108
501 3300046664 Ga0495659_0558390 Ga0495659_0558390_37_444 108
502 3300046675 Ga0495657_0000058 Ga0495657_0000058_83119_83460 108
503 3300046678 Ga0495599_0000007 Ga0495599_0000007_128383_128724 108
504 3300046679 Ga0495623_0000067 Ga0495623_0000067_33035_33376 108
505 3300046680 Ga0495646_0000126 Ga0495646_0000126_24875_25216 108
506 3300046683 Ga0495658_0075305 Ga0495658_0075305_551_892 108
507 3300046689 Ga0495613_0009636 Ga0495613_0009636_2416_2757 108
508 3300046690 Ga0495624_0010482 Ga0495624_0010482_5528_5869 108
509 3300046809 Ga0495600_0000001 Ga0495600_0000001_128383_128724 108
510 3300047315 Ga0495581_0016578 Ga0495581_0016578_1155_1496 108
511 3300047317 Ga0495604_0000012 Ga0495604_0000012_139630_139971 108
512 3300047319 Ga0495674_0000011 Ga0495674_0000011_141916_142257 108
513 3300047319 Ga0495674_0398046 Ga0495674_0398046_628_969 108
514 3300047321 Ga0495676_0447572 Ga0495676_0447572_440_781 108
515 3300047322 Ga0495680_0000045 Ga0495680_0000045_28912_29253 108
516 3300047322 Ga0495680_0230564 Ga0495680_0230564_163_504 108
517 3300047444 Ga0495675_0000110 Ga0495675_0000110_45193_45534 108
518 3300047471 Ga0495684_0000014 Ga0495684_0000014_139632_139973 108
519 3300047471 Ga0495684_0275842 Ga0495684_0275842_714_1055 108
520 3300047673 Ga0495593_0001961 Ga0495593_0001961_485_826 108
521 3300047673 Ga0495593_0106869 Ga0495593_0106869_565_906 108
522 3300048088 Ga0495602_0000019 Ga0495602_0000019_139607_139948 108
523 3300048903 Ga0496100_0442614 Ga0496100_0442614_309_647 108
524 3300049586 Ga0501070_0687391 Ga0501070_0687391_15_341 108
525 3300049589 Ga0501073_0818780 Ga0501073_0818780_282_623 108
526 3300050490 nmdc:mga03n38_253529_c1 nmdc:mga03n38_253529_c1_522_851 108
527 3300050491 nmdc:mga00v17_26848_c1 nmdc:mga00v17_26848_c1_788_1132 108
528 3300050492 nmdc:mga0yw44_145313_c1 nmdc:mga0yw44_145313_c1_1188_1517 108
529 3300050492 nmdc:mga0yw44_1888_c1 nmdc:mga0yw44_1888_c1_2139_2483 108
530 3300050507 nmdc:mga05p37_828528_c1 nmdc:mga05p37_828528_c1_434_778 108
531 3300050509 nmdc:mga0qj67_72949_c1 nmdc:mga0qj67_72949_c1_539_883 108
532 3300050510 nmdc:mga06r32_115007_c1 nmdc:mga06r32_115007_c1_985_1329 108
533 3300053077 Ga0495601_0000009 Ga0495601_0000009_128366_128707 108
534 3300053078 Ga0495612_0000019 Ga0495612_0000019_9121_9462 108
535 3300053084 Ga0495595_0000015 Ga0495595_0000015_109621_109962 108
536 3300053085 Ga0495619_0000012 Ga0495619_0000012_128366_128707 108
537 3300053085 Ga0495619_0011194 Ga0495619_0011194_5226_5567 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

9

55

0.98

PF12840

HTH_20

Helix-turn-helix domain

7

56

0.97

PF09339

HTH_IclR

IclR helix-turn-helix domain

14

57

0.94

PF01978

TrmB

Sugar-specific transcriptional regulator TrmB

12

68

0.9

PF08279

HTH_11

HTH domain

11

62

0.88

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

9

54

0.85

PF12802

MarR_2

MarR family

7

63

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9263 12 69
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9238 14 69
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9193 2 81
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.914 26 70
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.912 2 81
ID Description Score Start End Superfamily
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9758 3 100 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9365 15 69 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9333 2 77 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9294 6 71 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9238 14 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538JLE8-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9907 2 100 GO:0003700
AF-A0A1W6ZPW3-F1-model_v4 Transcriptional regulator 0.9844 1 100 GO:0003700
AF-A0A2S7K9D7-F1-model_v4 Transcriptional regulator 0.9823 1 101 GO:0003700
AF-A4EDA4-F1-model_v4 Putative transcription regulator protein 0.9786 1 100 GO:0003700
AF-A0A2S7K9D7-F1-model_v4 Transcriptional regulator 0.9728 1 101 GO:0003700

Feature Viewer

pLDDT pTM Quality
91.81 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map