F460892
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 537 | 303 | 536 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_101850118|Ga0068854_1018501181 |
| Length | 102 |
| Sequence | MDPFEALGDPHRRTILALLGEGDRSVQELADALPISRPAVSRHLRLLKEAGLVSDRPEGTRRLYRLHEEGPEAVRAYLEQVWGDAAARFRLAAENTSGADEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 152 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 179 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 274 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 290 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 291 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 292 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 293 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 296 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 297 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 298 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 299 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.96 |
| Nodule | 0 |
| Rhizoplane | 5.96 |
| Rhizosphere | 87.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000123 | 3300003215 | Bacteria | 86708 |
| 2 | Ga0070658_10019884 | 3300005327 | Bacteria | 5379 |
| 3 | Ga0070658_10665117 | 3300005327 | Bacteria | 904 |
| 4 | Ga0070683_100270749 | 3300005329 | Bacteria | 1615 |
| 5 | Ga0070670_101206868 | 3300005331 | Bacteria | 691 |
| 6 | Ga0068869_101096404 | 3300005334 | Bacteria | 696 |
| 7 | Ga0070666_10141513 | 3300005335 | Bacteria | 1675 |
| 8 | Ga0070680_100026268 | 3300005336 | Bacteria | 4656 |
| 9 | Ga0070680_101943742 | 3300005336 | Bacteria | 510 |
| 10 | Ga0070682_100051894 | 3300005337 | Bacteria | 2564 |
| 11 | Ga0070660_100095019 | 3300005339 | Bacteria | 2355 |
| 12 | Ga0070660_100438273 | 3300005339 | Bacteria | 1083 |
| 13 | Ga0070660_100943478 | 3300005339 | Unclassified | 728 |
| 14 | Ga0070689_101290719 | 3300005340 | Bacteria | 657 |
| 15 | Ga0070691_10417826 | 3300005341 | Bacteria | 759 |
| 16 | Ga0070687_101278388 | 3300005343 | Bacteria | 544 |
| 17 | Ga0070661_100068950 | 3300005344 | Bacteria | 2599 |
| 18 | Ga0070661_100373965 | 3300005344 | Bacteria | 1122 |
| 19 | Ga0070675_101785043 | 3300005354 | Unclassified | 567 |
| 20 | Ga0070671_100042084 | 3300005355 | Bacteria | 3797 |
| 21 | Ga0070674_100162893 | 3300005356 | Bacteria | 1693 |
| 22 | Ga0070674_101758743 | 3300005356 | Unclassified | 561 |
| 23 | Ga0070673_100112284 | 3300005364 | Bacteria | 2262 |
| 24 | Ga0070673_100192311 | 3300005364 | Bacteria | 1753 |
| 25 | Ga0070673_100730126 | 3300005364 | Bacteria | 911 |
| 26 | Ga0070659_100002582 | 3300005366 | Bacteria | 12873 |
| 27 | Ga0070709_10019667 | 3300005434 | Bacteria | 3907 |
| 28 | Ga0070714_100042303 | 3300005435 | Bacteria | 3848 |
| 29 | Ga0070713_100027078 | 3300005436 | Bacteria | 4510 |
| 30 | Ga0070713_100270925 | 3300005436 | Bacteria | 1555 |
| 31 | Ga0070713_102117585 | 3300005436 | Unclassified | 545 |
| 32 | Ga0070710_10018848 | 3300005437 | Bacteria | 3557 |
| 33 | Ga0070710_10263687 | 3300005437 | Bacteria | 1112 |
| 34 | Ga0070710_10525980 | 3300005437 | Bacteria | 813 |
| 35 | Ga0070711_100107987 | 3300005439 | Bacteria | 2038 |
| 36 | Ga0070711_100127868 | 3300005439 | Unclassified | 1888 |
| 37 | Ga0070711_100295915 | 3300005439 | Bacteria | 1285 |
| 38 | Ga0070711_101100424 | 3300005439 | Unclassified | 684 |
| 39 | Ga0070711_101322623 | 3300005439 | Bacteria | 626 |
| 40 | Ga0070705_101785952 | 3300005440 | Unclassified | 521 |
| 41 | Ga0070705_101786916 | 3300005440 | Unclassified | 521 |
| 42 | Ga0070708_100064734 | 3300005445 | Bacteria | 3276 |
| 43 | Ga0070663_100416525 | 3300005455 | Bacteria | 1101 |
| 44 | Ga0070663_101482806 | 3300005455 | Bacteria | 602 |
| 45 | Ga0070678_100173558 | 3300005456 | Bacteria | 1758 |
| 46 | Ga0070678_100211827 | 3300005456 | Bacteria | 1606 |
| 47 | Ga0070662_100250334 | 3300005457 | Bacteria | 1424 |
| 48 | Ga0070681_10032977 | 3300005458 | Bacteria | 5199 |
| 49 | Ga0068867_100384144 | 3300005459 | Bacteria | 1180 |
| 50 | Ga0070706_100776585 | 3300005467 | Bacteria | 887 |
| 51 | Ga0070707_100851381 | 3300005468 | Bacteria | 876 |
| 52 | Ga0070707_101049572 | 3300005468 | Bacteria | 780 |
| 53 | Ga0070698_100225806 | 3300005471 | Bacteria | 1806 |
| 54 | Ga0070699_100025432 | 3300005518 | Bacteria | 5103 |
| 55 | Ga0070679_100015819 | 3300005530 | Bacteria | 7259 |
| 56 | Ga0068853_100048354 | 3300005539 | Bacteria | 3653 |
| 57 | Ga0068853_100761220 | 3300005539 | Bacteria | 926 |
| 58 | Ga0070695_100432804 | 3300005545 | Bacteria | 1004 |
| 59 | Ga0070696_100178563 | 3300005546 | Bacteria | 1574 |
| 60 | Ga0070696_100268365 | 3300005546 | Unclassified | 1297 |
| 61 | Ga0070704_100803230 | 3300005549 | Bacteria | 841 |
| 62 | Ga0070664_101403208 | 3300005564 | Bacteria | 660 |
| 63 | Ga0070664_101477613 | 3300005564 | Bacteria | 643 |
| 64 | Ga0068854_101850118 | 3300005578 | Unclassified | 554 |
| 65 | Ga0068856_100381562 | 3300005614 | Unclassified | 1429 |
| 66 | Ga0068856_101275672 | 3300005614 | Bacteria | 750 |
| 67 | Ga0068856_102278147 | 3300005614 | Bacteria | 550 |
| 68 | Ga0070702_100331043 | 3300005615 | Bacteria | 1065 |
| 69 | Ga0068852_100142201 | 3300005616 | Bacteria | 2222 |
| 70 | Ga0068852_100362408 | 3300005616 | Bacteria | 1418 |
| 71 | Ga0068864_100004858 | 3300005618 | Bacteria | 11004 |
| 72 | Ga0068866_10790694 | 3300005718 | Bacteria | 659 |
| 73 | Ga0068861_100315917 | 3300005719 | Bacteria | 1359 |
| 74 | Ga0068851_10229268 | 3300005834 | Bacteria | 1047 |
| 75 | Ga0068870_10746821 | 3300005840 | Bacteria | 679 |
| 76 | Ga0068863_100192552 | 3300005841 | Bacteria | 1960 |
| 77 | Ga0068860_101369410 | 3300005843 | Bacteria | 729 |
| 78 | Ga0081455_10004915 | 3300005937 | Bacteria | 14806 |
| 79 | Ga0081455_10016611 | 3300005937 | Bacteria | 7097 |
| 80 | Ga0081455_10249463 | 3300005937 | Bacteria | 1299 |
| 81 | Ga0081455_10942001 | 3300005937 | Bacteria | 536 |
| 82 | Ga0081538_10026390 | 3300005981 | Bacteria | 4064 |
| 83 | Ga0081540_1039382 | 3300005983 | Bacteria | 2478 |
| 84 | Ga0081539_10000059 | 3300005985 | Bacteria | 254888 |
| 85 | Ga0070717_10011591 | 3300006028 | Bacteria | 6701 |
| 86 | Ga0070717_11739286 | 3300006028 | Bacteria | 564 |
| 87 | Ga0075365_10005965 | 3300006038 | Bacteria | 6643 |
| 88 | Ga0075365_10157420 | 3300006038 | Bacteria | 1582 |
| 89 | Ga0075365_10208641 | 3300006038 | Bacteria | 1369 |
| 90 | Ga0075368_10514267 | 3300006042 | Bacteria | 535 |
| 91 | Ga0075364_10121553 | 3300006051 | Bacteria | 1748 |
| 92 | Ga0070715_10037319 | 3300006163 | Unclassified | 2010 |
| 93 | Ga0070715_10853383 | 3300006163 | Bacteria | 557 |
| 94 | Ga0070715_10971977 | 3300006163 | Bacteria | 527 |
| 95 | Ga0070716_100508884 | 3300006173 | Bacteria | 890 |
| 96 | Ga0070712_100000272 | 3300006175 | Bacteria | 29104 |
| 97 | Ga0070712_100004708 | 3300006175 | Bacteria | 8437 |
| 98 | Ga0070712_100077892 | 3300006175 | Bacteria | 2391 |
| 99 | Ga0070712_100292334 | 3300006175 | Bacteria | 1316 |
| 100 | Ga0070712_100447138 | 3300006175 | Bacteria | 1075 |
| 101 | Ga0070712_100886897 | 3300006175 | Bacteria | 768 |
| 102 | Ga0070712_100947271 | 3300006175 | Unclassified | 744 |
| 103 | Ga0070712_101024507 | 3300006175 | Bacteria | 715 |
| 104 | Ga0070712_101126572 | 3300006175 | Unclassified | 681 |
| 105 | Ga0075362_10042856 | 3300006177 | Bacteria | 2002 |
| 106 | Ga0075367_10067238 | 3300006178 | Bacteria | 2148 |
| 107 | Ga0075367_10385935 | 3300006178 | Unclassified | 885 |
| 108 | Ga0097621_100146948 | 3300006237 | Bacteria | 2019 |
| 109 | Ga0068871_100819012 | 3300006358 | Bacteria | 859 |
| 110 | Ga0075428_100086288 | 3300006844 | Bacteria | 3423 |
| 111 | Ga0075428_100168125 | 3300006844 | Bacteria | 2378 |
| 112 | Ga0075428_100225960 | 3300006844 | Bacteria | 2020 |
| 113 | Ga0075428_100569196 | 3300006844 | Bacteria | 1211 |
| 114 | Ga0075428_100999358 | 3300006844 | Bacteria | 886 |
| 115 | Ga0075428_101318767 | 3300006844 | Bacteria | 759 |
| 116 | Ga0075430_100044548 | 3300006846 | Bacteria | 3751 |
| 117 | Ga0075431_100137563 | 3300006847 | Bacteria | 2519 |
| 118 | Ga0075433_10006561 | 3300006852 | Bacteria | 9209 |
| 119 | Ga0075434_100018928 | 3300006871 | Bacteria | 6655 |
| 120 | Ga0075434_100077073 | 3300006871 | Bacteria | 3328 |
| 121 | Ga0075434_100231458 | 3300006871 | Bacteria | 1867 |
| 122 | Ga0075434_100394586 | 3300006871 | Unclassified | 1405 |
| 123 | Ga0075434_100572598 | 3300006871 | Bacteria | 1149 |
| 124 | Ga0075429_100395708 | 3300006880 | Unclassified | 1210 |
| 125 | Ga0068865_100707055 | 3300006881 | Bacteria | 862 |
| 126 | Ga0075436_100107292 | 3300006914 | Bacteria | 1948 |
| 127 | Ga0075436_101058062 | 3300006914 | Bacteria | 610 |
| 128 | Ga0075435_100137784 | 3300007076 | Bacteria | 2046 |
| 129 | Ga0075435_100303019 | 3300007076 | Bacteria | 1367 |
| 130 | Ga0099794_10007825 | 3300007265 | Bacteria | 4412 |
| 131 | Ga0099795_10578423 | 3300007788 | Unclassified | 532 |
| 132 | Ga0105240_10087895 | 3300009093 | Bacteria | 3804 |
| 133 | Ga0105245_10496603 | 3300009098 | Bacteria | 1236 |
| 134 | Ga0105245_10548509 | 3300009098 | Bacteria | 1178 |
| 135 | Ga0114129_10219595 | 3300009147 | Bacteria | 2565 |
| 136 | Ga0114129_10483637 | 3300009147 | Bacteria | 1619 |
| 137 | Ga0114129_10955325 | 3300009147 | Bacteria | 1082 |
| 138 | Ga0114129_10997269 | 3300009147 | Unclassified | 1055 |
| 139 | Ga0105243_10194309 | 3300009148 | Bacteria | 1775 |
| 140 | Ga0105243_10538042 | 3300009148 | Bacteria | 1114 |
| 141 | Ga0105241_10699820 | 3300009174 | Bacteria | 925 |
| 142 | Ga0105242_10052807 | 3300009176 | Bacteria | 3318 |
| 143 | Ga0105248_10036293 | 3300009177 | Bacteria | 5513 |
| 144 | Ga0105238_10044506 | 3300009551 | Bacteria | 4486 |
| 145 | Ga0105238_10383095 | 3300009551 | Bacteria | 1398 |
| 146 | Ga0105238_12575839 | 3300009551 | Bacteria | 545 |
| 147 | Ga0099796_10098897 | 3300010159 | Bacteria | 1095 |
| 148 | Ga0105239_10392152 | 3300010375 | Bacteria | 1571 |
| 149 | Ga0105246_10145785 | 3300011119 | Bacteria | 1786 |
| 150 | Ga0157322_1041503 | 3300012490 | Unclassified | 530 |
| 151 | Ga0157370_10060344 | 3300013104 | Bacteria | 3601 |
| 152 | Ga0157370_11242651 | 3300013104 | Bacteria | 672 |
| 153 | Ga0157369_10441179 | 3300013105 | Bacteria | 1348 |
| 154 | Ga0157374_10048798 | 3300013296 | Bacteria | 3929 |
| 155 | Ga0157378_10102191 | 3300013297 | Bacteria | 2618 |
| 156 | Ga0157378_10242176 | 3300013297 | Bacteria | 1723 |
| 157 | Ga0163162_10177683 | 3300013306 | Bacteria | 2255 |
| 158 | Ga0157372_10089250 | 3300013307 | Bacteria | 3502 |
| 159 | Ga0163163_10216276 | 3300014325 | Bacteria | 1965 |
| 160 | Ga0163163_10951288 | 3300014325 | Unclassified | 922 |
| 161 | Ga0157379_10013561 | 3300014968 | Bacteria | 7142 |
| 162 | Ga0163161_10105666 | 3300017792 | Bacteria | 2100 |
| 163 | Ga0163161_10678597 | 3300017792 | Bacteria | 856 |
| 164 | Ga0163161_11319042 | 3300017792 | Unclassified | 628 |
| 165 | Ga0206353_11679581 | 3300020082 | Bacteria | 1190 |
| 166 | Ga0209148_1019122 | 3300025254 | Bacteria | 1141 |
| 167 | Ga0209758_1000471 | 3300025297 | Bacteria | 66374 |
| 168 | Ga0209257_1042542 | 3300025304 | Bacteria | 1339 |
| 169 | Ga0209257_1111540 | 3300025304 | Unclassified | 652 |
| 170 | Ga0207656_10107730 | 3300025321 | Bacteria | 1284 |
| 171 | Ga0207692_10276456 | 3300025898 | Bacteria | 1014 |
| 172 | Ga0207710_10074321 | 3300025900 | Bacteria | 1565 |
| 173 | Ga0207688_10157548 | 3300025901 | Bacteria | 1344 |
| 174 | Ga0207685_10015207 | 3300025905 | Bacteria | 2433 |
| 175 | Ga0207685_10166677 | 3300025905 | Unclassified | 1010 |
| 176 | Ga0207699_10079930 | 3300025906 | Bacteria | 2024 |
| 177 | Ga0207699_10617224 | 3300025906 | Bacteria | 790 |
| 178 | Ga0207699_11457658 | 3300025906 | Unclassified | 506 |
| 179 | Ga0207643_10182182 | 3300025908 | Bacteria | 1272 |
| 180 | Ga0207705_10007081 | 3300025909 | Bacteria | 8272 |
| 181 | Ga0207684_10289188 | 3300025910 | Bacteria | 1413 |
| 182 | Ga0207684_10311434 | 3300025910 | Bacteria | 1357 |
| 183 | Ga0207707_10006922 | 3300025912 | Bacteria | 9894 |
| 184 | Ga0207707_10032964 | 3300025912 | Bacteria | 4535 |
| 185 | Ga0207693_10000145 | 3300025915 | Bacteria | 65383 |
| 186 | Ga0207693_10004288 | 3300025915 | Bacteria | 12087 |
| 187 | Ga0207693_10028686 | 3300025915 | Bacteria | 4398 |
| 188 | Ga0207693_10129170 | 3300025915 | Bacteria | 1986 |
| 189 | Ga0207693_10239240 | 3300025915 | Bacteria | 1425 |
| 190 | Ga0207693_10345281 | 3300025915 | Unclassified | 1165 |
| 191 | Ga0207693_10415542 | 3300025915 | Bacteria | 1051 |
| 192 | Ga0207663_10010130 | 3300025916 | Bacteria | 5003 |
| 193 | Ga0207663_10042470 | 3300025916 | Bacteria | 2778 |
| 194 | Ga0207663_10046625 | 3300025916 | Bacteria | 2671 |
| 195 | Ga0207663_10094716 | 3300025916 | Bacteria | 1990 |
| 196 | Ga0207660_10003657 | 3300025917 | Bacteria | 10023 |
| 197 | Ga0207657_10000372 | 3300025919 | Bacteria | 47410 |
| 198 | Ga0207657_10039324 | 3300025919 | Bacteria | 4205 |
| 199 | Ga0207657_10163163 | 3300025919 | Bacteria | 1809 |
| 200 | Ga0207649_10234111 | 3300025920 | Unclassified | 1315 |
| 201 | Ga0207649_11276412 | 3300025920 | Unclassified | 581 |
| 202 | Ga0207652_10007908 | 3300025921 | Bacteria | 8534 |
| 203 | Ga0207652_10284929 | 3300025921 | Bacteria | 1490 |
| 204 | Ga0207646_10745423 | 3300025922 | Bacteria | 874 |
| 205 | Ga0207694_10023367 | 3300025924 | Bacteria | 4692 |
| 206 | Ga0207687_10749406 | 3300025927 | Unclassified | 831 |
| 207 | Ga0207687_10895649 | 3300025927 | Bacteria | 759 |
| 208 | Ga0207687_11011748 | 3300025927 | Unclassified | 713 |
| 209 | Ga0207700_10192359 | 3300025928 | Bacteria | 1715 |
| 210 | Ga0207700_10219225 | 3300025928 | Bacteria | 1612 |
| 211 | Ga0207700_10534784 | 3300025928 | Bacteria | 1039 |
| 212 | Ga0207664_10034629 | 3300025929 | Bacteria | 3890 |
| 213 | Ga0207644_10063555 | 3300025931 | Bacteria | 2680 |
| 214 | Ga0207690_10038450 | 3300025932 | Bacteria | 3115 |
| 215 | Ga0207709_10368267 | 3300025935 | Bacteria | 1090 |
| 216 | Ga0207669_10085411 | 3300025937 | Bacteria | 2037 |
| 217 | Ga0207704_10562624 | 3300025938 | Bacteria | 928 |
| 218 | Ga0207665_10015095 | 3300025939 | Bacteria | 5072 |
| 219 | Ga0207665_10156653 | 3300025939 | Bacteria | 1635 |
| 220 | Ga0207665_10528193 | 3300025939 | Bacteria | 914 |
| 221 | Ga0207689_11534810 | 3300025942 | Bacteria | 556 |
| 222 | Ga0207661_10076980 | 3300025944 | Bacteria | 2742 |
| 223 | Ga0207679_10021909 | 3300025945 | Bacteria | 4341 |
| 224 | Ga0207679_10244295 | 3300025945 | Bacteria | 1523 |
| 225 | Ga0207679_11329371 | 3300025945 | Bacteria | 659 |
| 226 | Ga0207667_10021734 | 3300025949 | Bacteria | 7108 |
| 227 | Ga0207651_10592316 | 3300025960 | Bacteria | 968 |
| 228 | Ga0207640_10989534 | 3300025981 | Bacteria | 739 |
| 229 | Ga0207640_11005727 | 3300025981 | Bacteria | 734 |
| 230 | Ga0207677_11309063 | 3300026023 | Unclassified | 666 |
| 231 | Ga0207703_10479312 | 3300026035 | Bacteria | 1166 |
| 232 | Ga0207703_10704164 | 3300026035 | Bacteria | 960 |
| 233 | Ga0207703_12200493 | 3300026035 | Bacteria | 527 |
| 234 | Ga0207639_10012255 | 3300026041 | Bacteria | 5969 |
| 235 | Ga0207678_10559326 | 3300026067 | Bacteria | 1001 |
| 236 | Ga0207702_10398226 | 3300026078 | Bacteria | 1327 |
| 237 | Ga0207702_10590240 | 3300026078 | Bacteria | 1089 |
| 238 | Ga0207702_11151513 | 3300026078 | Bacteria | 770 |
| 239 | Ga0207641_10376592 | 3300026088 | Bacteria | 1358 |
| 240 | Ga0207648_10095091 | 3300026089 | Bacteria | 2606 |
| 241 | Ga0207676_10001883 | 3300026095 | Bacteria | 15340 |
| 242 | Ga0207675_100047882 | 3300026118 | Bacteria | 3990 |
| 243 | Ga0207683_10035429 | 3300026121 | Bacteria | 4340 |
| 244 | Ga0207698_10118201 | 3300026142 | Bacteria | 2238 |
| 245 | Ga0207698_10216024 | 3300026142 | Bacteria | 1729 |
| 246 | Ga0207698_12251330 | 3300026142 | Unclassified | 557 |
| 247 | Ga0209179_1064652 | 3300027512 | Unclassified | 797 |
| 248 | Ga0265327_10006271 | 3300031251 | Bacteria | 9580 |
| 249 | Ga0265314_10006452 | 3300031711 | Bacteria | 10384 |
| 250 | Ga0307410_11227763 | 3300031852 | Bacteria | 654 |
| 251 | Ga0373926_0079270 | 3300035083 | Bacteria | 1213 |
| 252 | Ga0373934_0017176 | 3300035086 | Bacteria | 2759 |
| 253 | Ga0373944_0028122 | 3300035089 | Bacteria | 1672 |
| 254 | Ga0373944_0213437 | 3300035089 | Bacteria | 702 |
| 255 | Ga0373923_0003698 | 3300035111 | Bacteria | 4951 |
| 256 | Ga0373923_0423722 | 3300035111 | Bacteria | 643 |
| 257 | Ga0373923_0439967 | 3300035111 | Bacteria | 631 |
| 258 | Ga0373936_0000419 | 3300035113 | Bacteria | 14307 |
| 259 | Ga0373936_0008941 | 3300035113 | Bacteria | 3776 |
| 260 | Ga0373936_0291528 | 3300035113 | Bacteria | 735 |
| 261 | Ga0373939_0418355 | 3300035114 | Bacteria | 558 |
| 262 | Ga0373941_0267112 | 3300035115 | Bacteria | 673 |
| 263 | Ga0373945_0004359 | 3300035116 | Bacteria | 4492 |
| 264 | Ga0373953_0001453 | 3300035117 | Bacteria | 6865 |
| 265 | Ga0373953_0025521 | 3300035117 | Bacteria | 2258 |
| 266 | Ga0373954_0002992 | 3300035118 | Bacteria | 7129 |
| 267 | Ga0373954_0003881 | 3300035118 | Bacteria | 6396 |
| 268 | Ga0373956_0010700 | 3300035119 | Bacteria | 3766 |
| 269 | Ga0373957_0013775 | 3300035120 | Bacteria | 2751 |
| 270 | Ga0373957_0043499 | 3300035120 | Bacteria | 1697 |
| 271 | Ga0373957_0398698 | 3300035120 | Bacteria | 592 |
| 272 | Ga0373943_0009759 | 3300035170 | Bacteria | 4299 |
| 273 | Ga0373943_0029980 | 3300035170 | Bacteria | 2573 |
| 274 | Ga0373946_0000532 | 3300035171 | Bacteria | 12599 |
| 275 | Ga0373955_0000096 | 3300035172 | Bacteria | 34998 |
| 276 | Ga0373955_0011690 | 3300035172 | Bacteria | 4195 |
| 277 | Ga0373955_0200181 | 3300035172 | Bacteria | 1189 |
| 278 | Ga0373955_0983699 | 3300035172 | Bacteria | 519 |
| 279 | Ga0373924_0023100 | 3300035410 | Bacteria | 2435 |
| 280 | Ga0373931_0332879 | 3300035691 | Bacteria | 946 |
| 281 | Ga0373935_0027732 | 3300035692 | Bacteria | 3500 |
| 282 | Ga0373935_0038879 | 3300035692 | Bacteria | 2980 |
| 283 | Ga0373935_0214500 | 3300035692 | Bacteria | 1335 |
| 284 | Ga0373927_0011579 | 3300035695 | Bacteria | 5874 |
| 285 | Ga0373927_0026791 | 3300035695 | Bacteria | 3767 |
| 286 | Ga0373927_0277091 | 3300035695 | Unclassified | 1103 |
| 287 | Ga0373927_0369551 | 3300035695 | Bacteria | 945 |
| 288 | Ga0373933_0024792 | 3300035724 | Bacteria | 3435 |
| 289 | Ga0373933_0324234 | 3300035724 | Bacteria | 999 |
| 290 | Ga0373947_0002497 | 3300035725 | Bacteria | 11058 |
| 291 | Ga0373947_0019388 | 3300035725 | Bacteria | 3922 |
| 292 | Ga0373947_0245338 | 3300035725 | Bacteria | 1183 |
| 293 | Ga0373947_0621285 | 3300035725 | Unclassified | 736 |
| 294 | Ga0373937_0000009 | 3300036401 | Bacteria | 169521 |
| 295 | Ga0373937_0008468 | 3300036401 | Bacteria | 8940 |
| 296 | Ga0373937_0022046 | 3300036401 | Bacteria | 5721 |
| 297 | Ga0373937_0537860 | 3300036401 | Bacteria | 1110 |
| 298 | Ga0373925_0000036 | 3300037068 | Bacteria | 143388 |
| 299 | Ga0373925_0060488 | 3300037068 | Bacteria | 2844 |
| 300 | Ga0373925_0229404 | 3300037068 | Bacteria | 1484 |
| 301 | Ga0373925_0310667 | 3300037068 | Bacteria | 1274 |
| 302 | Ga0395899_0022899 | 3300037312 | Bacteria | 4733 |
| 303 | Ga0436364_0679113 | 3300037853 | Bacteria | 1174 |
| 304 | Ga0436364_0870732 | 3300037853 | Bacteria | 582 |
| 305 | Ga0436364_1454240 | 3300037853 | Bacteria | 523 |
| 306 | Ga0395901_0662352 | 3300038443 | Bacteria | 1046 |
| 307 | Ga0436365_0511193 | 3300039437 | Bacteria | 577 |
| 308 | Ga0436360_0690213 | 3300039438 | Bacteria | 1137 |
| 309 | Ga0436361_0554078 | 3300039447 | Bacteria | 3860 |
| 310 | Ga0436362_0746501 | 3300039453 | Bacteria | 1001 |
| 311 | Ga0451577_1034530 | 3300042876 | Bacteria | 737 |
| 312 | Ga0466964_0325375 | 3300044706 | Bacteria | 782 |
| 313 | Ga0451576_1450783 | 3300045051 | Bacteria | 713 |
| 314 | Ga0466967_0538064 | 3300045976 | Bacteria | 1149 |
| 315 | Ga0495592_0000018 | 3300046454 | Bacteria | 140962 |
| 316 | Ga0495603_0181258 | 3300046455 | Bacteria | 1218 |
| 317 | Ga0495629_0002014 | 3300046459 | Bacteria | 15788 |
| 318 | Ga0495629_0031581 | 3300046459 | Bacteria | 3749 |
| 319 | Ga0495629_0037751 | 3300046459 | Bacteria | 3404 |
| 320 | Ga0495641_0061897 | 3300046461 | Bacteria | 1689 |
| 321 | Ga0495651_0000322 | 3300046462 | Bacteria | 37169 |
| 322 | Ga0495651_0014021 | 3300046462 | Bacteria | 6199 |
| 323 | Ga0495653_0000032 | 3300046463 | Bacteria | 132763 |
| 324 | Ga0495653_0031563 | 3300046463 | Bacteria | 4210 |
| 325 | Ga0495580_0781041 | 3300046472 | Unclassified | 620 |
| 326 | Ga0495582_0171765 | 3300046473 | Bacteria | 1234 |
| 327 | Ga0495582_0540372 | 3300046473 | Bacteria | 674 |
| 328 | Ga0495639_0580778 | 3300046475 | Bacteria | 575 |
| 329 | Ga0495662_0021767 | 3300046476 | Bacteria | 3098 |
| 330 | Ga0495662_0205682 | 3300046476 | Bacteria | 970 |
| 331 | Ga0495664_0000010 | 3300046477 | Bacteria | 268381 |
| 332 | Ga0495664_0023586 | 3300046477 | Bacteria | 3571 |
| 333 | Ga0495664_0206279 | 3300046477 | Bacteria | 1191 |
| 334 | Ga0495584_0029891 | 3300046491 | Bacteria | 2761 |
| 335 | Ga0495594_0022620 | 3300046499 | Bacteria | 3363 |
| 336 | Ga0495594_0754463 | 3300046499 | Unclassified | 549 |
| 337 | Ga0495608_0000008 | 3300046511 | Bacteria | 268629 |
| 338 | Ga0495608_0096108 | 3300046511 | Bacteria | 1913 |
| 339 | Ga0495618_0000002 | 3300046514 | Bacteria | 271353 |
| 340 | Ga0495618_0007386 | 3300046514 | Bacteria | 6648 |
| 341 | Ga0495618_0230918 | 3300046514 | Bacteria | 1165 |
| 342 | Ga0495628_0000009 | 3300046516 | Bacteria | 237611 |
| 343 | Ga0495628_0064334 | 3300046516 | Bacteria | 2872 |
| 344 | Ga0495628_0087931 | 3300046516 | Bacteria | 2408 |
| 345 | Ga0495628_0375544 | 3300046516 | Bacteria | 1042 |
| 346 | Ga0495628_0600399 | 3300046516 | Bacteria | 786 |
| 347 | Ga0495630_0000450 | 3300046517 | Bacteria | 31113 |
| 348 | Ga0495630_0239442 | 3300046517 | Unclassified | 1386 |
| 349 | Ga0495637_0184613 | 3300046520 | Bacteria | 772 |
| 350 | Ga0495666_0124675 | 3300046526 | Bacteria | 1205 |
| 351 | Ga0495652_0000011 | 3300046529 | Bacteria | 255329 |
| 352 | Ga0495652_0044786 | 3300046529 | Bacteria | 3808 |
| 353 | Ga0495665_0064234 | 3300046531 | Bacteria | 1937 |
| 354 | Ga0495640_0000009 | 3300046533 | Bacteria | 217086 |
| 355 | Ga0495640_0002839 | 3300046533 | Bacteria | 13934 |
| 356 | Ga0495640_0462247 | 3300046533 | Unclassified | 774 |
| 357 | Ga0495640_0507284 | 3300046533 | Bacteria | 734 |
| 358 | Ga0495586_0024112 | 3300046535 | Bacteria | 3250 |
| 359 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 360 | Ga0495587_0001257 | 3300046536 | Bacteria | 16834 |
| 361 | Ga0495598_0071703 | 3300046537 | Bacteria | 1092 |
| 362 | Ga0495609_0156175 | 3300046538 | Bacteria | 969 |
| 363 | Ga0495621_0487990 | 3300046539 | Unclassified | 530 |
| 364 | Ga0495645_0000010 | 3300046543 | Bacteria | 238337 |
| 365 | Ga0495645_0030534 | 3300046543 | Bacteria | 3924 |
| 366 | Ga0495633_0564517 | 3300046558 | Unclassified | 512 |
| 367 | Ga0495667_0000005 | 3300046559 | Bacteria | 268252 |
| 368 | Ga0495667_0035829 | 3300046559 | Bacteria | 3314 |
| 369 | Ga0495656_0045670 | 3300046615 | Bacteria | 1850 |
| 370 | Ga0495656_0214812 | 3300046615 | Bacteria | 960 |
| 371 | Ga0495634_0000656 | 3300046642 | Bacteria | 33583 |
| 372 | Ga0495634_0039764 | 3300046642 | Bacteria | 3201 |
| 373 | Ga0495634_0322717 | 3300046642 | Bacteria | 929 |
| 374 | Ga0495611_0181402 | 3300046648 | Bacteria | 984 |
| 375 | Ga0495635_0000008 | 3300046663 | Bacteria | 268349 |
| 376 | Ga0495635_0976908 | 3300046663 | Bacteria | 540 |
| 377 | Ga0495659_0127219 | 3300046664 | Bacteria | 1008 |
| 378 | Ga0495659_0558390 | 3300046664 | Bacteria | 505 |
| 379 | Ga0495657_0000058 | 3300046675 | Bacteria | 97827 |
| 380 | Ga0495657_0006788 | 3300046675 | Bacteria | 8918 |
| 381 | Ga0495599_0000007 | 3300046678 | Bacteria | 236638 |
| 382 | Ga0495599_0037800 | 3300046678 | Bacteria | 3032 |
| 383 | Ga0495623_0000067 | 3300046679 | Bacteria | 64348 |
| 384 | Ga0495646_0000126 | 3300046680 | Bacteria | 38196 |
| 385 | Ga0495646_0074641 | 3300046680 | Bacteria | 1989 |
| 386 | Ga0495646_0423423 | 3300046680 | Bacteria | 690 |
| 387 | Ga0495647_0253172 | 3300046681 | Unclassified | 784 |
| 388 | Ga0495647_0313188 | 3300046681 | Bacteria | 709 |
| 389 | Ga0495658_0025664 | 3300046683 | Bacteria | 3152 |
| 390 | Ga0495658_0075305 | 3300046683 | Bacteria | 1969 |
| 391 | Ga0495658_0506919 | 3300046683 | Bacteria | 772 |
| 392 | Ga0495613_0009636 | 3300046689 | Bacteria | 7175 |
| 393 | Ga0495613_0057451 | 3300046689 | Bacteria | 2857 |
| 394 | Ga0495613_0251025 | 3300046689 | Bacteria | 1234 |
| 395 | Ga0495624_0010482 | 3300046690 | Bacteria | 6388 |
| 396 | Ga0495624_0091186 | 3300046690 | Bacteria | 1880 |
| 397 | Ga0495624_0179292 | 3300046690 | Bacteria | 1291 |
| 398 | Ga0495624_0826163 | 3300046690 | Bacteria | 547 |
| 399 | Ga0495589_0138215 | 3300046794 | Bacteria | 1168 |
| 400 | Ga0495600_0000001 | 3300046809 | Bacteria | 214870 |
| 401 | Ga0495600_0075926 | 3300046809 | Bacteria | 2194 |
| 402 | Ga0495581_0016578 | 3300047315 | Bacteria | 4282 |
| 403 | Ga0495581_0179284 | 3300047315 | Bacteria | 1239 |
| 404 | Ga0495604_0000012 | 3300047317 | Bacteria | 268341 |
| 405 | Ga0495604_0004652 | 3300047317 | Bacteria | 10877 |
| 406 | Ga0495674_0000011 | 3300047319 | Bacteria | 270911 |
| 407 | Ga0495674_0011509 | 3300047319 | Bacteria | 8346 |
| 408 | Ga0495674_0398046 | 3300047319 | Unclassified | 1112 |
| 409 | Ga0495674_0918500 | 3300047319 | Bacteria | 675 |
| 410 | Ga0495676_0447572 | 3300047321 | Bacteria | 852 |
| 411 | Ga0495680_0000045 | 3300047322 | Bacteria | 96890 |
| 412 | Ga0495680_0002786 | 3300047322 | Bacteria | 17617 |
| 413 | Ga0495680_0230564 | 3300047322 | Bacteria | 1319 |
| 414 | Ga0495680_0522252 | 3300047322 | Unclassified | 803 |
| 415 | Ga0495675_0000110 | 3300047444 | Bacteria | 59086 |
| 416 | Ga0495675_0002188 | 3300047444 | Bacteria | 11653 |
| 417 | Ga0495684_0000014 | 3300047471 | Bacteria | 172111 |
| 418 | Ga0495684_0045251 | 3300047471 | Bacteria | 3368 |
| 419 | Ga0495684_0275842 | 3300047471 | Bacteria | 1215 |
| 420 | Ga0495686_0142874 | 3300047472 | Bacteria | 1411 |
| 421 | Ga0495593_0001961 | 3300047673 | Bacteria | 12270 |
| 422 | Ga0495593_0044748 | 3300047673 | Bacteria | 2366 |
| 423 | Ga0495593_0106869 | 3300047673 | Bacteria | 1431 |
| 424 | Ga0495602_0000019 | 3300048088 | Bacteria | 170922 |
| 425 | Ga0495602_0491748 | 3300048088 | Bacteria | 859 |
| 426 | Ga0495615_0034049 | 3300048090 | Bacteria | 1238 |
| 427 | Ga0496100_0078063 | 3300048903 | Bacteria | 2228 |
| 428 | Ga0496100_0101955 | 3300048903 | Bacteria | 1979 |
| 429 | Ga0496100_0442614 | 3300048903 | Unclassified | 995 |
| 430 | Ga0496100_0909949 | 3300048903 | Bacteria | 691 |
| 431 | Ga0496101_0063411 | 3300048904 | Bacteria | 2690 |
| 432 | Ga0496101_0069504 | 3300048904 | Bacteria | 2577 |
| 433 | Ga0496101_0456539 | 3300048904 | Bacteria | 1008 |
| 434 | Ga0496102_0011991 | 3300048905 | Bacteria | 7488 |
| 435 | Ga0496102_0209111 | 3300048905 | Bacteria | 1840 |
| 436 | Ga0496102_0319701 | 3300048905 | Bacteria | 1462 |
| 437 | Ga0496104_0008003 | 3300048907 | Bacteria | 9373 |
| 438 | Ga0496104_1700374 | 3300048907 | Bacteria | 533 |
| 439 | Ga0496105_0047705 | 3300048908 | Bacteria | 3535 |
| 440 | Ga0496106_0094681 | 3300048909 | Bacteria | 2309 |
| 441 | Ga0496106_0190876 | 3300048909 | Bacteria | 1629 |
| 442 | Ga0496106_1021203 | 3300048909 | Bacteria | 650 |
| 443 | Ga0496107_0031413 | 3300048910 | Bacteria | 3789 |
| 444 | Ga0496107_0399674 | 3300048910 | Bacteria | 1022 |
| 445 | Ga0496108_0153902 | 3300048911 | Bacteria | 1985 |
| 446 | Ga0496108_1790732 | 3300048911 | Bacteria | 503 |
| 447 | Ga0496109_0020242 | 3300048912 | Bacteria | 5876 |
| 448 | Ga0496110_0091255 | 3300048913 | Bacteria | 2725 |
| 449 | Ga0496110_0407050 | 3300048913 | Bacteria | 1240 |
| 450 | Ga0496110_0459856 | 3300048913 | Bacteria | 1160 |
| 451 | Ga0496110_0641244 | 3300048913 | Bacteria | 962 |
| 452 | Ga0496112_0237073 | 3300048915 | Bacteria | 1778 |
| 453 | Ga0496112_0312118 | 3300048915 | Bacteria | 1517 |
| 454 | Ga0496112_1095920 | 3300048915 | Bacteria | 715 |
| 455 | Ga0496114_0078590 | 3300048917 | Bacteria | 2783 |
| 456 | Ga0496114_0822822 | 3300048917 | Bacteria | 808 |
| 457 | Ga0496115_0080115 | 3300048918 | Bacteria | 2658 |
| 458 | Ga0496115_0573025 | 3300048918 | Bacteria | 900 |
| 459 | Ga0501033_0496231 | 3300049570 | Bacteria | 845 |
| 460 | Ga0501039_0892317 | 3300049575 | Bacteria | 692 |
| 461 | Ga0501042_0614405 | 3300049578 | Bacteria | 790 |
| 462 | Ga0501043_0637873 | 3300049579 | Bacteria | 783 |
| 463 | Ga0501048_0784702 | 3300049582 | Bacteria | 684 |
| 464 | Ga0501068_1085202 | 3300049584 | Bacteria | 529 |
| 465 | Ga0501070_0629841 | 3300049586 | Bacteria | 853 |
| 466 | Ga0501070_0687391 | 3300049586 | Bacteria | 810 |
| 467 | Ga0501071_0214825 | 3300049587 | Bacteria | 1447 |
| 468 | Ga0501072_0314780 | 3300049588 | Bacteria | 1244 |
| 469 | Ga0501072_0414669 | 3300049588 | Unclassified | 1068 |
| 470 | Ga0501073_0352883 | 3300049589 | Bacteria | 1016 |
| 471 | Ga0501073_0652034 | 3300049589 | Bacteria | 727 |
| 472 | Ga0501073_0818780 | 3300049589 | Bacteria | 642 |
| 473 | Ga0501075_1107822 | 3300049591 | Bacteria | 601 |
| 474 | Ga0501076_0297666 | 3300049592 | Bacteria | 1322 |
| 475 | Ga0501076_0639503 | 3300049592 | Bacteria | 878 |
| 476 | Ga0501077_0082939 | 3300049593 | Unclassified | 2031 |
| 477 | Ga0501077_0234263 | 3300049593 | Unclassified | 1167 |
| 478 | Ga0501079_0157529 | 3300049741 | Bacteria | 1770 |
| 479 | Ga0501079_1409301 | 3300049741 | Bacteria | 548 |
| 480 | Ga0501080_0850173 | 3300049742 | Bacteria | 798 |
| 481 | Ga0501081_0051310 | 3300049743 | Bacteria | 2845 |
| 482 | Ga0501081_1121539 | 3300049743 | Bacteria | 595 |
| 483 | Ga0501083_0230679 | 3300049744 | Bacteria | 1206 |
| 484 | Ga0501035_0920852 | 3300049822 | Bacteria | 691 |
| 485 | Ga0501045_0111471 | 3300049824 | Bacteria | 2029 |
| 486 | nmdc:mga03n38_253529_c1 | 3300050490 | Bacteria | 930 |
| 487 | nmdc:mga00v17_26848_c1 | 3300050491 | Bacteria | 3358 |
| 488 | nmdc:mga0yw44_145313_c1 | 3300050492 | Bacteria | 1544 |
| 489 | nmdc:mga0yw44_1888_c1 | 3300050492 | Bacteria | 8625 |
| 490 | nmdc:mga0yw44_19480_c1 | 3300050492 | Bacteria | 3744 |
| 491 | nmdc:mga06z11_262606_c1 | 3300050494 | Bacteria | 1019 |
| 492 | nmdc:mga05p37_1154729_c1 | 3300050507 | Bacteria | 805 |
| 493 | nmdc:mga05p37_395195_c1 | 3300050507 | Bacteria | 1616 |
| 494 | nmdc:mga05p37_828528_c1 | 3300050507 | Bacteria | 1008 |
| 495 | nmdc:mga09592_222164_c1 | 3300050508 | Bacteria | 1636 |
| 496 | nmdc:mga0qj67_72949_c1 | 3300050509 | Bacteria | 2741 |
| 497 | nmdc:mga06r32_115007_c1 | 3300050510 | Bacteria | 2649 |
| 498 | nmdc:mga06r32_1671280_c1 | 3300050510 | Bacteria | 574 |
| 499 | nmdc:mga0n895_10874_c1 | 3300050512 | Bacteria | 8079 |
| 500 | nmdc:mga0n895_1753463_c1 | 3300050512 | Bacteria | 582 |
| 501 | nmdc:mga0n895_664073_c1 | 3300050512 | Bacteria | 1040 |
| 502 | nmdc:mga0n895_74698_c1 | 3300050512 | Bacteria | 3368 |
| 503 | nmdc:mga0rr50_335476_c1 | 3300050513 | Bacteria | 1270 |
| 504 | nmdc:mga08x19_940544_c1 | 3300050514 | Bacteria | 614 |
| 505 | nmdc:mga0a205_3460_c1 | 3300050515 | Bacteria | 14101 |
| 506 | Ga0495601_0000009 | 3300053077 | Bacteria | 270622 |
| 507 | Ga0495601_0069029 | 3300053077 | Bacteria | 2253 |
| 508 | Ga0495601_1026770 | 3300053077 | Bacteria | 518 |
| 509 | Ga0495612_0000019 | 3300053078 | Bacteria | 137844 |
| 510 | Ga0495612_0007038 | 3300053078 | Bacteria | 4600 |
| 511 | Ga0495612_0065575 | 3300053078 | Bacteria | 1508 |
| 512 | Ga0495595_0000015 | 3300053084 | Bacteria | 144946 |
| 513 | Ga0495595_0010058 | 3300053084 | Bacteria | 3924 |
| 514 | Ga0495595_0141292 | 3300053084 | Bacteria | 1181 |
| 515 | Ga0495619_0000012 | 3300053085 | Bacteria | 268349 |
| 516 | Ga0495619_0010715 | 3300053085 | Bacteria | 5772 |
| 517 | Ga0495619_0011194 | 3300053085 | Bacteria | 5642 |
| 518 | Ga0495619_0012642 | 3300053085 | Bacteria | 5314 |
| 519 | Ga0500583_0405967 | 3300053092 | Bacteria | 653 |
| 520 | Ga0500651_0020746 | 3300053093 | Bacteria | 4091 |
| 521 | Ga0500641_0003283 | 3300053096 | Bacteria | 5718 |
| 522 | Ga0500650_0042468 | 3300053098 | Bacteria | 2101 |
| 523 | Ga0500555_002663 | 3300053103 | Bacteria | 5146 |
| 524 | Ga0500556_0017369 | 3300053104 | Bacteria | 2253 |
| 525 | Ga0500652_220723 | 3300053131 | Bacteria | 762 |
| 526 | Ga0500655_020392 | 3300053133 | Bacteria | 1238 |
| 527 | Ga0500577_0014506 | 3300053142 | Bacteria | 2438 |
| 528 | Ga0500588_0183668 | 3300053146 | Bacteria | 769 |
| 529 | Ga0500616_0000779 | 3300053153 | Bacteria | 36584 |
| 530 | Ga0500622_0041117 | 3300053156 | Bacteria | 2407 |
| 531 | Ga0501084_1074644 | 3300054114 | Bacteria | 676 |
| 532 | Ga0501082_0193717 | 3300060353 | Bacteria | 1768 |
| 533 | Ga0501082_1389919 | 3300060353 | Unclassified | 613 |
| 534 | Ga0530510_0082904 | 3300061734 | Bacteria | 2335 |
| 535 | Ga0530510_0614483 | 3300061734 | Bacteria | 827 |
| 536 | Ga0530510_0659809 | 3300061734 | Bacteria | 796 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049589 | Ga0501073_0652034 | Ga0501073_0652034_62_343 | 93 |
| 2 | 3300005327 | Ga0070658_10665117 | Ga0070658_106651171 | 97 |
| 3 | 3300005329 | Ga0070683_100270749 | Ga0070683_1002707492 | 97 |
| 4 | 3300005339 | Ga0070660_100438273 | Ga0070660_1004382732 | 97 |
| 5 | 3300005356 | Ga0070674_100162893 | Ga0070674_1001628932 | 97 |
| 6 | 3300005456 | Ga0070678_100211827 | Ga0070678_1002118273 | 97 |
| 7 | 3300005459 | Ga0068867_100384144 | Ga0068867_1003841443 | 97 |
| 8 | 3300005549 | Ga0070704_100803230 | Ga0070704_1008032302 | 97 |
| 9 | 3300005564 | Ga0070664_101403208 | Ga0070664_1014032082 | 97 |
| 10 | 3300005615 | Ga0070702_100331043 | Ga0070702_1003310432 | 97 |
| 11 | 3300005719 | Ga0068861_100315917 | Ga0068861_1003159172 | 97 |
| 12 | 3300005834 | Ga0068851_10229268 | Ga0068851_102292681 | 97 |
| 13 | 3300005840 | Ga0068870_10746821 | Ga0068870_107468212 | 97 |
| 14 | 3300009098 | Ga0105245_10496603 | Ga0105245_104966032 | 97 |
| 15 | 3300009148 | Ga0105243_10194309 | Ga0105243_101943093 | 97 |
| 16 | 3300017792 | Ga0163161_10678597 | Ga0163161_106785973 | 97 |
| 17 | 3300025321 | Ga0207656_10107730 | Ga0207656_101077302 | 97 |
| 18 | 3300025901 | Ga0207688_10157548 | Ga0207688_101575482 | 97 |
| 19 | 3300025908 | Ga0207643_10182182 | Ga0207643_101821824 | 97 |
| 20 | 3300025919 | Ga0207657_10163163 | Ga0207657_101631633 | 97 |
| 21 | 3300025927 | Ga0207687_10895649 | Ga0207687_108956492 | 97 |
| 22 | 3300025935 | Ga0207709_10368267 | Ga0207709_103682672 | 97 |
| 23 | 3300025937 | Ga0207669_10085411 | Ga0207669_100854113 | 97 |
| 24 | 3300025944 | Ga0207661_10076980 | Ga0207661_100769804 | 97 |
| 25 | 3300025945 | Ga0207679_11329371 | Ga0207679_113293712 | 97 |
| 26 | 3300025981 | Ga0207640_11005727 | Ga0207640_110057272 | 97 |
| 27 | 3300026023 | Ga0207677_11309063 | Ga0207677_113090631 | 97 |
| 28 | 3300026089 | Ga0207648_10095091 | Ga0207648_100950912 | 97 |
| 29 | 3300026118 | Ga0207675_100047882 | Ga0207675_1000478825 | 97 |
| 30 | 3300026142 | Ga0207698_12251330 | Ga0207698_122513302 | 97 |
| 31 | 3300048905 | Ga0496102_0209111 | Ga0496102_0209111_1512_1808 | 97 |
| 32 | 3300048910 | Ga0496107_0399674 | Ga0496107_0399674_456_752 | 97 |
| 33 | 3300048913 | Ga0496110_0641244 | Ga0496110_0641244_75_371 | 97 |
| 34 | 3300005436 | Ga0070713_102117585 | Ga0070713_1021175851 | 99 |
| 35 | 3300046477 | Ga0495664_0206279 | Ga0495664_0206279_547_852 | 99 |
| 36 | 3300046539 | Ga0495621_0487990 | Ga0495621_0487990_11_313 | 99 |
| 37 | 3300046663 | Ga0495635_0976908 | Ga0495635_0976908_11_316 | 99 |
| 38 | 3300005614 | Ga0068856_101275672 | Ga0068856_1012756722 | 100 |
| 39 | 3300013105 | Ga0157369_10441179 | Ga0157369_104411793 | 100 |
| 40 | 3300026035 | Ga0207703_12200493 | Ga0207703_122004931 | 100 |
| 41 | 3300026078 | Ga0207702_11151513 | Ga0207702_111515132 | 100 |
| 42 | 3300035172 | Ga0373955_0983699 | Ga0373955_0983699_14_316 | 100 |
| 43 | 3300039447 | Ga0436361_0554078 | Ga0436361_0554078_1974_2276 | 100 |
| 44 | 3300048907 | Ga0496104_1700374 | Ga0496104_1700374_161_472 | 100 |
| 45 | 3300005578 | Ga0068854_101850118 | Ga0068854_1018501181 | 101 |
| 46 | 3300009551 | Ga0105238_12575839 | Ga0105238_125758392 | 101 |
| 47 | 3300035115 | Ga0373941_0267112 | Ga0373941_0267112_53_358 | 101 |
| 48 | 3300046516 | Ga0495628_0064334 | Ga0495628_0064334_2554_2862 | 101 |
| 49 | 3300005616 | Ga0068852_100142201 | Ga0068852_1001422014 | 102 |
| 50 | 3300009093 | Ga0105240_10087895 | Ga0105240_100878953 | 102 |
| 51 | 3300013104 | Ga0157370_10060344 | Ga0157370_100603442 | 102 |
| 52 | 3300013104 | Ga0157370_11242651 | Ga0157370_112426512 | 102 |
| 53 | 3300013307 | Ga0157372_10089250 | Ga0157372_100892502 | 102 |
| 54 | 3300025254 | Ga0209148_1019122 | Ga0209148_10191222 | 102 |
| 55 | 3300025912 | Ga0207707_10032964 | Ga0207707_100329641 | 102 |
| 56 | 3300025981 | Ga0207640_10989534 | Ga0207640_109895342 | 102 |
| 57 | 3300026142 | Ga0207698_10118201 | Ga0207698_101182012 | 102 |
| 58 | 3300035691 | Ga0373931_0332879 | Ga0373931_0332879_394_702 | 102 |
| 59 | 3300038443 | Ga0395901_0662352 | Ga0395901_0662352_194_508 | 102 |
| 60 | 3300005335 | Ga0070666_10141513 | Ga0070666_101415133 | 103 |
| 61 | 3300005355 | Ga0070671_100042084 | Ga0070671_1000420845 | 103 |
| 62 | 3300005364 | Ga0070673_100192311 | Ga0070673_1001923114 | 103 |
| 63 | 3300005364 | Ga0070673_100730126 | Ga0070673_1007301262 | 103 |
| 64 | 3300005440 | Ga0070705_101786916 | Ga0070705_1017869161 | 103 |
| 65 | 3300005455 | Ga0070663_100416525 | Ga0070663_1004165252 | 103 |
| 66 | 3300005456 | Ga0070678_100173558 | Ga0070678_1001735583 | 103 |
| 67 | 3300005457 | Ga0070662_100250334 | Ga0070662_1002503341 | 103 |
| 68 | 3300005616 | Ga0068852_100362408 | Ga0068852_1003624082 | 103 |
| 69 | 3300005618 | Ga0068864_100004858 | Ga0068864_10000485812 | 103 |
| 70 | 3300005841 | Ga0068863_100192552 | Ga0068863_1001925522 | 103 |
| 71 | 3300005843 | Ga0068860_101369410 | Ga0068860_1013694102 | 103 |
| 72 | 3300006358 | Ga0068871_100819012 | Ga0068871_1008190122 | 103 |
| 73 | 3300006852 | Ga0075433_10006561 | Ga0075433_100065614 | 103 |
| 74 | 3300006871 | Ga0075434_100231458 | Ga0075434_1002314583 | 103 |
| 75 | 3300013297 | Ga0157378_10242176 | Ga0157378_102421764 | 103 |
| 76 | 3300013306 | Ga0163162_10177683 | Ga0163162_101776834 | 103 |
| 77 | 3300014325 | Ga0163163_10216276 | Ga0163163_102162763 | 103 |
| 78 | 3300025931 | Ga0207644_10063555 | Ga0207644_100635554 | 103 |
| 79 | 3300025945 | Ga0207679_10021909 | Ga0207679_100219097 | 103 |
| 80 | 3300025960 | Ga0207651_10592316 | Ga0207651_105923162 | 103 |
| 81 | 3300026035 | Ga0207703_10704164 | Ga0207703_107041643 | 103 |
| 82 | 3300026067 | Ga0207678_10559326 | Ga0207678_105593262 | 103 |
| 83 | 3300026088 | Ga0207641_10376592 | Ga0207641_103765922 | 103 |
| 84 | 3300026095 | Ga0207676_10001883 | Ga0207676_100018833 | 103 |
| 85 | 3300026121 | Ga0207683_10035429 | Ga0207683_100354293 | 103 |
| 86 | 3300026142 | Ga0207698_10216024 | Ga0207698_102160242 | 103 |
| 87 | 3300031711 | Ga0265314_10006452 | Ga0265314_100064526 | 103 |
| 88 | 3300031852 | Ga0307410_11227763 | Ga0307410_112277632 | 103 |
| 89 | 3300048903 | Ga0496100_0078063 | Ga0496100_0078063_1283_1606 | 103 |
| 90 | 3300048904 | Ga0496101_0069504 | Ga0496101_0069504_1202_1525 | 103 |
| 91 | 3300048912 | Ga0496109_0020242 | Ga0496109_0020242_3046_3369 | 103 |
| 92 | 3300048913 | Ga0496110_0091255 | Ga0496110_0091255_584_907 | 103 |
| 93 | 3300049578 | Ga0501042_0614405 | Ga0501042_0614405_29_352 | 103 |
| 94 | 3300049591 | Ga0501075_1107822 | Ga0501075_1107822_181_504 | 103 |
| 95 | 3300049592 | Ga0501076_0639503 | Ga0501076_0639503_519_833 | 103 |
| 96 | 3300050512 | nmdc:mga0n895_74698_c1 | nmdc:mga0n895_74698_c1_561_887 | 103 |
| 97 | 3300050515 | nmdc:mga0a205_3460_c1 | nmdc:mga0a205_3460_c1_14_340 | 103 |
| 98 | 3300005985 | Ga0081539_10000059 | Ga0081539_10000059117 | 104 |
| 99 | 3300006844 | Ga0075428_100168125 | Ga0075428_1001681252 | 104 |
| 100 | 3300009147 | Ga0114129_10955325 | Ga0114129_109553252 | 104 |
| 101 | 3300035111 | Ga0373923_0423722 | Ga0373923_0423722_292_615 | 104 |
| 102 | 3300035120 | Ga0373957_0398698 | Ga0373957_0398698_254_577 | 104 |
| 103 | 3300037312 | Ga0395899_0022899 | Ga0395899_0022899_1898_2215 | 104 |
| 104 | 3300037853 | Ga0436364_0679113 | Ga0436364_0679113_700_1077 | 104 |
| 105 | 3300039437 | Ga0436365_0511193 | Ga0436365_0511193_203_520 | 104 |
| 106 | 3300045976 | Ga0466967_0538064 | Ga0466967_0538064_207_527 | 104 |
| 107 | 3300046491 | Ga0495584_0029891 | Ga0495584_0029891_215_541 | 104 |
| 108 | 3300046516 | Ga0495628_0600399 | Ga0495628_0600399_355_675 | 104 |
| 109 | 3300046615 | Ga0495656_0045670 | Ga0495656_0045670_1368_1694 | 104 |
| 110 | 3300046664 | Ga0495659_0127219 | Ga0495659_0127219_34_360 | 104 |
| 111 | 3300048088 | Ga0495602_0491748 | Ga0495602_0491748_403_729 | 104 |
| 112 | 3300049586 | Ga0501070_0629841 | Ga0501070_0629841_327_641 | 104 |
| 113 | 3300005614 | Ga0068856_102278147 | Ga0068856_1022781471 | 105 |
| 114 | 3300006237 | Ga0097621_100146948 | Ga0097621_1001469483 | 105 |
| 115 | 3300006844 | Ga0075428_100569196 | Ga0075428_1005691961 | 105 |
| 116 | 3300006871 | Ga0075434_100077073 | Ga0075434_1000770735 | 105 |
| 117 | 3300006871 | Ga0075434_100572598 | Ga0075434_1005725982 | 105 |
| 118 | 3300006880 | Ga0075429_100395708 | Ga0075429_1003957082 | 105 |
| 119 | 3300006914 | Ga0075436_100107292 | Ga0075436_1001072921 | 105 |
| 120 | 3300007076 | Ga0075435_100137784 | Ga0075435_1001377842 | 105 |
| 121 | 3300007788 | Ga0099795_10578423 | Ga0099795_105784232 | 105 |
| 122 | 3300009147 | Ga0114129_10483637 | Ga0114129_104836372 | 105 |
| 123 | 3300025304 | Ga0209257_1042542 | Ga0209257_10425422 | 105 |
| 124 | 3300035083 | Ga0373926_0079270 | Ga0373926_0079270_754_1074 | 105 |
| 125 | 3300035089 | Ga0373944_0028122 | Ga0373944_0028122_578_898 | 105 |
| 126 | 3300035113 | Ga0373936_0291528 | Ga0373936_0291528_52_372 | 105 |
| 127 | 3300035172 | Ga0373955_0200181 | Ga0373955_0200181_93_413 | 105 |
| 128 | 3300035692 | Ga0373935_0214500 | Ga0373935_0214500_809_1129 | 105 |
| 129 | 3300035695 | Ga0373927_0369551 | Ga0373927_0369551_352_672 | 105 |
| 130 | 3300035725 | Ga0373947_0245338 | Ga0373947_0245338_159_482 | 105 |
| 131 | 3300035725 | Ga0373947_0621285 | Ga0373947_0621285_279_599 | 105 |
| 132 | 3300037068 | Ga0373925_0060488 | Ga0373925_0060488_1721_2044 | 105 |
| 133 | 3300046455 | Ga0495603_0181258 | Ga0495603_0181258_700_1020 | 105 |
| 134 | 3300046461 | Ga0495641_0061897 | Ga0495641_0061897_641_961 | 105 |
| 135 | 3300046473 | Ga0495582_0540372 | Ga0495582_0540372_242_562 | 105 |
| 136 | 3300046475 | Ga0495639_0580778 | Ga0495639_0580778_29_352 | 105 |
| 137 | 3300046499 | Ga0495594_0022620 | Ga0495594_0022620_663_983 | 105 |
| 138 | 3300046520 | Ga0495637_0184613 | Ga0495637_0184613_373_693 | 105 |
| 139 | 3300046526 | Ga0495666_0124675 | Ga0495666_0124675_667_987 | 105 |
| 140 | 3300046533 | Ga0495640_0507284 | Ga0495640_0507284_283_603 | 105 |
| 141 | 3300046537 | Ga0495598_0071703 | Ga0495598_0071703_202_522 | 105 |
| 142 | 3300046538 | Ga0495609_0156175 | Ga0495609_0156175_12_332 | 105 |
| 143 | 3300046558 | Ga0495633_0564517 | Ga0495633_0564517_168_488 | 105 |
| 144 | 3300046615 | Ga0495656_0214812 | Ga0495656_0214812_351_671 | 105 |
| 145 | 3300046648 | Ga0495611_0181402 | Ga0495611_0181402_221_541 | 105 |
| 146 | 3300046681 | Ga0495647_0253172 | Ga0495647_0253172_373_693 | 105 |
| 147 | 3300046681 | Ga0495647_0313188 | Ga0495647_0313188_304_627 | 105 |
| 148 | 3300046683 | Ga0495658_0025664 | Ga0495658_0025664_2378_2698 | 105 |
| 149 | 3300046689 | Ga0495613_0251025 | Ga0495613_0251025_541_861 | 105 |
| 150 | 3300046690 | Ga0495624_0179292 | Ga0495624_0179292_331_651 | 105 |
| 151 | 3300046794 | Ga0495589_0138215 | Ga0495589_0138215_320_640 | 105 |
| 152 | 3300047315 | Ga0495581_0179284 | Ga0495581_0179284_836_1156 | 105 |
| 153 | 3300047472 | Ga0495686_0142874 | Ga0495686_0142874_916_1233 | 105 |
| 154 | 3300048090 | Ga0495615_0034049 | Ga0495615_0034049_721_1041 | 105 |
| 155 | 3300048915 | Ga0496112_0312118 | Ga0496112_0312118_297_617 | 105 |
| 156 | 3300049589 | Ga0501073_0352883 | Ga0501073_0352883_483_800 | 105 |
| 157 | 3300050507 | nmdc:mga05p37_395195_c1 | nmdc:mga05p37_395195_c1_923_1240 | 105 |
| 158 | 3300050508 | nmdc:mga09592_222164_c1 | nmdc:mga09592_222164_c1_97_414 | 105 |
| 159 | 3300050512 | nmdc:mga0n895_664073_c1 | nmdc:mga0n895_664073_c1_87_410 | 105 |
| 160 | 3300050513 | nmdc:mga0rr50_335476_c1 | nmdc:mga0rr50_335476_c1_336_659 | 105 |
| 161 | 3300053092 | Ga0500583_0405967 | Ga0500583_0405967_236_553 | 105 |
| 162 | 3300053093 | Ga0500651_0020746 | Ga0500651_0020746_219_536 | 105 |
| 163 | 3300053096 | Ga0500641_0003283 | Ga0500641_0003283_5245_5562 | 105 |
| 164 | 3300053098 | Ga0500650_0042468 | Ga0500650_0042468_1605_1922 | 105 |
| 165 | 3300053103 | Ga0500555_002663 | Ga0500555_002663_2000_2317 | 105 |
| 166 | 3300053104 | Ga0500556_0017369 | Ga0500556_0017369_153_470 | 105 |
| 167 | 3300053131 | Ga0500652_220723 | Ga0500652_220723_118_435 | 105 |
| 168 | 3300053133 | Ga0500655_020392 | Ga0500655_020392_195_512 | 105 |
| 169 | 3300053142 | Ga0500577_0014506 | Ga0500577_0014506_398_715 | 105 |
| 170 | 3300053146 | Ga0500588_0183668 | Ga0500588_0183668_56_373 | 105 |
| 171 | 3300053156 | Ga0500622_0041117 | Ga0500622_0041117_1921_2238 | 105 |
| 172 | 3300005343 | Ga0070687_101278388 | Ga0070687_1012783881 | 106 |
| 173 | 3300005436 | Ga0070713_100270925 | Ga0070713_1002709253 | 106 |
| 174 | 3300005439 | Ga0070711_100127868 | Ga0070711_1001278683 | 106 |
| 175 | 3300005440 | Ga0070705_101785952 | Ga0070705_1017859521 | 106 |
| 176 | 3300005445 | Ga0070708_100064734 | Ga0070708_1000647345 | 106 |
| 177 | 3300005468 | Ga0070707_101049572 | Ga0070707_1010495722 | 106 |
| 178 | 3300005518 | Ga0070699_100025432 | Ga0070699_1000254325 | 106 |
| 179 | 3300006163 | Ga0070715_10853383 | Ga0070715_108533832 | 106 |
| 180 | 3300006173 | Ga0070716_100508884 | Ga0070716_1005088842 | 106 |
| 181 | 3300006175 | Ga0070712_100000272 | Ga0070712_10000027226 | 106 |
| 182 | 3300006175 | Ga0070712_100947271 | Ga0070712_1009472711 | 106 |
| 183 | 3300006914 | Ga0075436_101058062 | Ga0075436_1010580622 | 106 |
| 184 | 3300007265 | Ga0099794_10007825 | Ga0099794_100078252 | 106 |
| 185 | 3300009147 | Ga0114129_10219595 | Ga0114129_102195954 | 106 |
| 186 | 3300014968 | Ga0157379_10013561 | Ga0157379_1001356110 | 106 |
| 187 | 3300025910 | Ga0207684_10289188 | Ga0207684_102891881 | 106 |
| 188 | 3300025910 | Ga0207684_10311434 | Ga0207684_103114342 | 106 |
| 189 | 3300025915 | Ga0207693_10000145 | Ga0207693_1000014544 | 106 |
| 190 | 3300025915 | Ga0207693_10028686 | Ga0207693_100286864 | 106 |
| 191 | 3300025916 | Ga0207663_10010130 | Ga0207663_100101304 | 106 |
| 192 | 3300025922 | Ga0207646_10745423 | Ga0207646_107454232 | 106 |
| 193 | 3300025928 | Ga0207700_10192359 | Ga0207700_101923593 | 106 |
| 194 | 3300025939 | Ga0207665_10015095 | Ga0207665_100150956 | 106 |
| 195 | 3300025939 | Ga0207665_10528193 | Ga0207665_105281931 | 106 |
| 196 | 3300026078 | Ga0207702_10590240 | Ga0207702_105902402 | 106 |
| 197 | 3300031251 | Ga0265327_10006271 | Ga0265327_100062717 | 106 |
| 198 | 3300035695 | Ga0373927_0026791 | Ga0373927_0026791_715_1035 | 106 |
| 199 | 3300036401 | Ga0373937_0008468 | Ga0373937_0008468_1538_1858 | 106 |
| 200 | 3300037068 | Ga0373925_0229404 | Ga0373925_0229404_456_776 | 106 |
| 201 | 3300037853 | Ga0436364_0870732 | Ga0436364_0870732_33_353 | 106 |
| 202 | 3300039438 | Ga0436360_0690213 | Ga0436360_0690213_26_346 | 106 |
| 203 | 3300046472 | Ga0495580_0781041 | Ga0495580_0781041_118_438 | 106 |
| 204 | 3300048909 | Ga0496106_1021203 | Ga0496106_1021203_58_378 | 106 |
| 205 | 3300048911 | Ga0496108_1790732 | Ga0496108_1790732_162_482 | 106 |
| 206 | 3300048913 | Ga0496110_0407050 | Ga0496110_0407050_589_909 | 106 |
| 207 | 3300048915 | Ga0496112_1095920 | Ga0496112_1095920_328_648 | 106 |
| 208 | 3300050507 | nmdc:mga05p37_1154729_c1 | nmdc:mga05p37_1154729_c1_219_539 | 106 |
| 209 | 3300050510 | nmdc:mga06r32_1671280_c1 | nmdc:mga06r32_1671280_c1_228_548 | 106 |
| 210 | 3300050514 | nmdc:mga08x19_940544_c1 | nmdc:mga08x19_940544_c1_127_447 | 106 |
| 211 | 3300053153 | Ga0500616_0000779 | Ga0500616_0000779_27127_27447 | 106 |
| 212 | 3300061734 | Ga0530510_0614483 | Ga0530510_0614483_437_760 | 106 |
| 213 | 3300005331 | Ga0070670_101206868 | Ga0070670_1012068682 | 107 |
| 214 | 3300005334 | Ga0068869_101096404 | Ga0068869_1010964042 | 107 |
| 215 | 3300005336 | Ga0070680_101943742 | Ga0070680_1019437421 | 107 |
| 216 | 3300005337 | Ga0070682_100051894 | Ga0070682_1000518941 | 107 |
| 217 | 3300005339 | Ga0070660_100943478 | Ga0070660_1009434781 | 107 |
| 218 | 3300005340 | Ga0070689_101290719 | Ga0070689_1012907191 | 107 |
| 219 | 3300005344 | Ga0070661_100068950 | Ga0070661_1000689504 | 107 |
| 220 | 3300005354 | Ga0070675_101785043 | Ga0070675_1017850431 | 107 |
| 221 | 3300005356 | Ga0070674_101758743 | Ga0070674_1017587432 | 107 |
| 222 | 3300005364 | Ga0070673_100112284 | Ga0070673_1001122844 | 107 |
| 223 | 3300005434 | Ga0070709_10019667 | Ga0070709_100196673 | 107 |
| 224 | 3300005435 | Ga0070714_100042303 | Ga0070714_1000423034 | 107 |
| 225 | 3300005436 | Ga0070713_100027078 | Ga0070713_1000270783 | 107 |
| 226 | 3300005437 | Ga0070710_10018848 | Ga0070710_100188481 | 107 |
| 227 | 3300005437 | Ga0070710_10525980 | Ga0070710_105259802 | 107 |
| 228 | 3300005439 | Ga0070711_100107987 | Ga0070711_1001079873 | 107 |
| 229 | 3300005439 | Ga0070711_100295915 | Ga0070711_1002959152 | 107 |
| 230 | 3300005439 | Ga0070711_101100424 | Ga0070711_1011004241 | 107 |
| 231 | 3300005439 | Ga0070711_101322623 | Ga0070711_1013226232 | 107 |
| 232 | 3300005455 | Ga0070663_101482806 | Ga0070663_1014828061 | 107 |
| 233 | 3300005467 | Ga0070706_100776585 | Ga0070706_1007765851 | 107 |
| 234 | 3300005468 | Ga0070707_100851381 | Ga0070707_1008513812 | 107 |
| 235 | 3300005471 | Ga0070698_100225806 | Ga0070698_1002258062 | 107 |
| 236 | 3300005545 | Ga0070695_100432804 | Ga0070695_1004328043 | 107 |
| 237 | 3300005546 | Ga0070696_100178563 | Ga0070696_1001785634 | 107 |
| 238 | 3300005546 | Ga0070696_100268365 | Ga0070696_1002683653 | 107 |
| 239 | 3300005564 | Ga0070664_101477613 | Ga0070664_1014776131 | 107 |
| 240 | 3300005614 | Ga0068856_100381562 | Ga0068856_1003815622 | 107 |
| 241 | 3300005718 | Ga0068866_10790694 | Ga0068866_107906942 | 107 |
| 242 | 3300005981 | Ga0081538_10026390 | Ga0081538_100263906 | 107 |
| 243 | 3300006028 | Ga0070717_10011591 | Ga0070717_100115916 | 107 |
| 244 | 3300006028 | Ga0070717_11739286 | Ga0070717_117392862 | 107 |
| 245 | 3300006042 | Ga0075368_10514267 | Ga0075368_105142672 | 107 |
| 246 | 3300006163 | Ga0070715_10037319 | Ga0070715_100373191 | 107 |
| 247 | 3300006163 | Ga0070715_10971977 | Ga0070715_109719771 | 107 |
| 248 | 3300006175 | Ga0070712_100004708 | Ga0070712_1000047085 | 107 |
| 249 | 3300006175 | Ga0070712_100447138 | Ga0070712_1004471382 | 107 |
| 250 | 3300006175 | Ga0070712_100886897 | Ga0070712_1008868972 | 107 |
| 251 | 3300006175 | Ga0070712_101024507 | Ga0070712_1010245072 | 107 |
| 252 | 3300006175 | Ga0070712_101126572 | Ga0070712_1011265722 | 107 |
| 253 | 3300006178 | Ga0075367_10385935 | Ga0075367_103859352 | 107 |
| 254 | 3300006844 | Ga0075428_101318767 | Ga0075428_1013187672 | 107 |
| 255 | 3300006871 | Ga0075434_100018928 | Ga0075434_1000189287 | 107 |
| 256 | 3300006871 | Ga0075434_100394586 | Ga0075434_1003945861 | 107 |
| 257 | 3300006881 | Ga0068865_100707055 | Ga0068865_1007070551 | 107 |
| 258 | 3300007076 | Ga0075435_100303019 | Ga0075435_1003030192 | 107 |
| 259 | 3300009098 | Ga0105245_10548509 | Ga0105245_105485092 | 107 |
| 260 | 3300009147 | Ga0114129_10997269 | Ga0114129_109972691 | 107 |
| 261 | 3300009148 | Ga0105243_10538042 | Ga0105243_105380423 | 107 |
| 262 | 3300009174 | Ga0105241_10699820 | Ga0105241_106998202 | 107 |
| 263 | 3300009176 | Ga0105242_10052807 | Ga0105242_100528075 | 107 |
| 264 | 3300009177 | Ga0105248_10036293 | Ga0105248_100362935 | 107 |
| 265 | 3300010375 | Ga0105239_10392152 | Ga0105239_103921523 | 107 |
| 266 | 3300011119 | Ga0105246_10145785 | Ga0105246_101457855 | 107 |
| 267 | 3300012490 | Ga0157322_1041503 | Ga0157322_10415032 | 107 |
| 268 | 3300013296 | Ga0157374_10048798 | Ga0157374_100487985 | 107 |
| 269 | 3300013297 | Ga0157378_10102191 | Ga0157378_101021912 | 107 |
| 270 | 3300014325 | Ga0163163_10951288 | Ga0163163_109512882 | 107 |
| 271 | 3300017792 | Ga0163161_10105666 | Ga0163161_101056664 | 107 |
| 272 | 3300017792 | Ga0163161_11319042 | Ga0163161_113190422 | 107 |
| 273 | 3300020082 | Ga0206353_11679581 | Ga0206353_116795812 | 107 |
| 274 | 3300025900 | Ga0207710_10074321 | Ga0207710_100743214 | 107 |
| 275 | 3300025905 | Ga0207685_10015207 | Ga0207685_100152073 | 107 |
| 276 | 3300025906 | Ga0207699_10079930 | Ga0207699_100799302 | 107 |
| 277 | 3300025915 | Ga0207693_10004288 | Ga0207693_100042888 | 107 |
| 278 | 3300025915 | Ga0207693_10129170 | Ga0207693_101291703 | 107 |
| 279 | 3300025915 | Ga0207693_10239240 | Ga0207693_102392402 | 107 |
| 280 | 3300025916 | Ga0207663_10042470 | Ga0207663_100424704 | 107 |
| 281 | 3300025916 | Ga0207663_10046625 | Ga0207663_100466254 | 107 |
| 282 | 3300025916 | Ga0207663_10094716 | Ga0207663_100947163 | 107 |
| 283 | 3300025920 | Ga0207649_11276412 | Ga0207649_112764122 | 107 |
| 284 | 3300025921 | Ga0207652_10284929 | Ga0207652_102849293 | 107 |
| 285 | 3300025927 | Ga0207687_10749406 | Ga0207687_107494061 | 107 |
| 286 | 3300025927 | Ga0207687_11011748 | Ga0207687_110117482 | 107 |
| 287 | 3300025928 | Ga0207700_10534784 | Ga0207700_105347841 | 107 |
| 288 | 3300025929 | Ga0207664_10034629 | Ga0207664_100346292 | 107 |
| 289 | 3300025938 | Ga0207704_10562624 | Ga0207704_105626242 | 107 |
| 290 | 3300025942 | Ga0207689_11534810 | Ga0207689_115348101 | 107 |
| 291 | 3300025945 | Ga0207679_10244295 | Ga0207679_102442952 | 107 |
| 292 | 3300026035 | Ga0207703_10479312 | Ga0207703_104793122 | 107 |
| 293 | 3300026078 | Ga0207702_10398226 | Ga0207702_103982262 | 107 |
| 294 | 3300035086 | Ga0373934_0017176 | Ga0373934_0017176_2312_2638 | 107 |
| 295 | 3300035111 | Ga0373923_0439967 | Ga0373923_0439967_67_390 | 107 |
| 296 | 3300035117 | Ga0373953_0001453 | Ga0373953_0001453_5060_5386 | 107 |
| 297 | 3300035118 | Ga0373954_0003881 | Ga0373954_0003881_753_1079 | 107 |
| 298 | 3300035120 | Ga0373957_0043499 | Ga0373957_0043499_1068_1394 | 107 |
| 299 | 3300035170 | Ga0373943_0029980 | Ga0373943_0029980_1861_2184 | 107 |
| 300 | 3300035172 | Ga0373955_0011690 | Ga0373955_0011690_1074_1400 | 107 |
| 301 | 3300035692 | Ga0373935_0027732 | Ga0373935_0027732_1416_1739 | 107 |
| 302 | 3300035695 | Ga0373927_0277091 | Ga0373927_0277091_344_670 | 107 |
| 303 | 3300035725 | Ga0373947_0019388 | Ga0373947_0019388_109_432 | 107 |
| 304 | 3300036401 | Ga0373937_0022046 | Ga0373937_0022046_2873_3199 | 107 |
| 305 | 3300036401 | Ga0373937_0537860 | Ga0373937_0537860_333_659 | 107 |
| 306 | 3300037068 | Ga0373925_0310667 | Ga0373925_0310667_670_993 | 107 |
| 307 | 3300037853 | Ga0436364_1454240 | Ga0436364_1454240_64_390 | 107 |
| 308 | 3300039453 | Ga0436362_0746501 | Ga0436362_0746501_12_383 | 107 |
| 309 | 3300044706 | Ga0466964_0325375 | Ga0466964_0325375_326_652 | 107 |
| 310 | 3300046459 | Ga0495629_0031581 | Ga0495629_0031581_2732_3058 | 107 |
| 311 | 3300046462 | Ga0495651_0014021 | Ga0495651_0014021_3796_4122 | 107 |
| 312 | 3300046463 | Ga0495653_0031563 | Ga0495653_0031563_1105_1431 | 107 |
| 313 | 3300046476 | Ga0495662_0205682 | Ga0495662_0205682_600_923 | 107 |
| 314 | 3300046477 | Ga0495664_0023586 | Ga0495664_0023586_1199_1525 | 107 |
| 315 | 3300046511 | Ga0495608_0096108 | Ga0495608_0096108_1561_1887 | 107 |
| 316 | 3300046514 | Ga0495618_0007386 | Ga0495618_0007386_5002_5328 | 107 |
| 317 | 3300046516 | Ga0495628_0087931 | Ga0495628_0087931_1393_1719 | 107 |
| 318 | 3300046516 | Ga0495628_0375544 | Ga0495628_0375544_696_1022 | 107 |
| 319 | 3300046517 | Ga0495630_0239442 | Ga0495630_0239442_397_723 | 107 |
| 320 | 3300046529 | Ga0495652_0044786 | Ga0495652_0044786_2498_2824 | 107 |
| 321 | 3300046533 | Ga0495640_0002839 | Ga0495640_0002839_1398_1724 | 107 |
| 322 | 3300046536 | Ga0495587_0001257 | Ga0495587_0001257_41_367 | 107 |
| 323 | 3300046543 | Ga0495645_0030534 | Ga0495645_0030534_2206_2532 | 107 |
| 324 | 3300046559 | Ga0495667_0035829 | Ga0495667_0035829_1828_2154 | 107 |
| 325 | 3300046642 | Ga0495634_0039764 | Ga0495634_0039764_1799_2125 | 107 |
| 326 | 3300046642 | Ga0495634_0322717 | Ga0495634_0322717_261_584 | 107 |
| 327 | 3300046675 | Ga0495657_0006788 | Ga0495657_0006788_1781_2107 | 107 |
| 328 | 3300046678 | Ga0495599_0037800 | Ga0495599_0037800_1870_2196 | 107 |
| 329 | 3300046680 | Ga0495646_0074641 | Ga0495646_0074641_229_555 | 107 |
| 330 | 3300046680 | Ga0495646_0423423 | Ga0495646_0423423_293_619 | 107 |
| 331 | 3300046683 | Ga0495658_0506919 | Ga0495658_0506919_97_420 | 107 |
| 332 | 3300046689 | Ga0495613_0057451 | Ga0495613_0057451_643_969 | 107 |
| 333 | 3300046690 | Ga0495624_0091186 | Ga0495624_0091186_312_638 | 107 |
| 334 | 3300046690 | Ga0495624_0826163 | Ga0495624_0826163_81_404 | 107 |
| 335 | 3300046809 | Ga0495600_0075926 | Ga0495600_0075926_1606_1932 | 107 |
| 336 | 3300047317 | Ga0495604_0004652 | Ga0495604_0004652_8554_8880 | 107 |
| 337 | 3300047319 | Ga0495674_0011509 | Ga0495674_0011509_5374_5700 | 107 |
| 338 | 3300047319 | Ga0495674_0918500 | Ga0495674_0918500_207_530 | 107 |
| 339 | 3300047322 | Ga0495680_0002786 | Ga0495680_0002786_10276_10602 | 107 |
| 340 | 3300047322 | Ga0495680_0522252 | Ga0495680_0522252_135_458 | 107 |
| 341 | 3300047444 | Ga0495675_0002188 | Ga0495675_0002188_9798_10124 | 107 |
| 342 | 3300047471 | Ga0495684_0045251 | Ga0495684_0045251_1570_1896 | 107 |
| 343 | 3300047673 | Ga0495593_0044748 | Ga0495593_0044748_411_737 | 107 |
| 344 | 3300048903 | Ga0496100_0101955 | Ga0496100_0101955_203_529 | 107 |
| 345 | 3300048903 | Ga0496100_0909949 | Ga0496100_0909949_297_623 | 107 |
| 346 | 3300048904 | Ga0496101_0063411 | Ga0496101_0063411_1502_1828 | 107 |
| 347 | 3300048904 | Ga0496101_0456539 | Ga0496101_0456539_12_338 | 107 |
| 348 | 3300048905 | Ga0496102_0011991 | Ga0496102_0011991_3351_3677 | 107 |
| 349 | 3300048905 | Ga0496102_0319701 | Ga0496102_0319701_30_407 | 107 |
| 350 | 3300048907 | Ga0496104_0008003 | Ga0496104_0008003_7153_7479 | 107 |
| 351 | 3300048908 | Ga0496105_0047705 | Ga0496105_0047705_1194_1520 | 107 |
| 352 | 3300048909 | Ga0496106_0094681 | Ga0496106_0094681_1418_1744 | 107 |
| 353 | 3300048909 | Ga0496106_0190876 | Ga0496106_0190876_766_1092 | 107 |
| 354 | 3300048910 | Ga0496107_0031413 | Ga0496107_0031413_272_598 | 107 |
| 355 | 3300048911 | Ga0496108_0153902 | Ga0496108_0153902_1308_1634 | 107 |
| 356 | 3300048913 | Ga0496110_0459856 | Ga0496110_0459856_70_396 | 107 |
| 357 | 3300048915 | Ga0496112_0237073 | Ga0496112_0237073_430_756 | 107 |
| 358 | 3300048917 | Ga0496114_0078590 | Ga0496114_0078590_629_955 | 107 |
| 359 | 3300048917 | Ga0496114_0822822 | Ga0496114_0822822_389_712 | 107 |
| 360 | 3300048918 | Ga0496115_0080115 | Ga0496115_0080115_1451_1777 | 107 |
| 361 | 3300048918 | Ga0496115_0573025 | Ga0496115_0573025_258_584 | 107 |
| 362 | 3300049570 | Ga0501033_0496231 | Ga0501033_0496231_399_725 | 107 |
| 363 | 3300049575 | Ga0501039_0892317 | Ga0501039_0892317_101_427 | 107 |
| 364 | 3300049579 | Ga0501043_0637873 | Ga0501043_0637873_144_470 | 107 |
| 365 | 3300049582 | Ga0501048_0784702 | Ga0501048_0784702_137_463 | 107 |
| 366 | 3300049584 | Ga0501068_1085202 | Ga0501068_1085202_130_456 | 107 |
| 367 | 3300049587 | Ga0501071_0214825 | Ga0501071_0214825_574_900 | 107 |
| 368 | 3300049588 | Ga0501072_0314780 | Ga0501072_0314780_451_777 | 107 |
| 369 | 3300049588 | Ga0501072_0414669 | Ga0501072_0414669_465_791 | 107 |
| 370 | 3300049592 | Ga0501076_0297666 | Ga0501076_0297666_887_1213 | 107 |
| 371 | 3300049593 | Ga0501077_0082939 | Ga0501077_0082939_414_740 | 107 |
| 372 | 3300049593 | Ga0501077_0234263 | Ga0501077_0234263_114_440 | 107 |
| 373 | 3300049741 | Ga0501079_0157529 | Ga0501079_0157529_1300_1626 | 107 |
| 374 | 3300049741 | Ga0501079_1409301 | Ga0501079_1409301_129_455 | 107 |
| 375 | 3300049742 | Ga0501080_0850173 | Ga0501080_0850173_124_450 | 107 |
| 376 | 3300049743 | Ga0501081_0051310 | Ga0501081_0051310_1774_2100 | 107 |
| 377 | 3300049743 | Ga0501081_1121539 | Ga0501081_1121539_257_583 | 107 |
| 378 | 3300049744 | Ga0501083_0230679 | Ga0501083_0230679_104_430 | 107 |
| 379 | 3300049822 | Ga0501035_0920852 | Ga0501035_0920852_308_634 | 107 |
| 380 | 3300049824 | Ga0501045_0111471 | Ga0501045_0111471_1017_1343 | 107 |
| 381 | 3300050492 | nmdc:mga0yw44_19480_c1 | nmdc:mga0yw44_19480_c1_182_508 | 107 |
| 382 | 3300050492 | nmdc:mga0yw44_19480_c1 | nmdc:mga0yw44_19480_c1_3237_3563 | 107 |
| 383 | 3300050494 | nmdc:mga06z11_262606_c1 | nmdc:mga06z11_262606_c1_487_813 | 107 |
| 384 | 3300050512 | nmdc:mga0n895_10874_c1 | nmdc:mga0n895_10874_c1_5323_5655 | 107 |
| 385 | 3300050512 | nmdc:mga0n895_1753463_c1 | nmdc:mga0n895_1753463_c1_118_444 | 107 |
| 386 | 3300053077 | Ga0495601_0069029 | Ga0495601_0069029_321_647 | 107 |
| 387 | 3300053077 | Ga0495601_1026770 | Ga0495601_1026770_65_388 | 107 |
| 388 | 3300053078 | Ga0495612_0007038 | Ga0495612_0007038_3184_3510 | 107 |
| 389 | 3300053078 | Ga0495612_0065575 | Ga0495612_0065575_902_1228 | 107 |
| 390 | 3300053084 | Ga0495595_0010058 | Ga0495595_0010058_2206_2532 | 107 |
| 391 | 3300053084 | Ga0495595_0141292 | Ga0495595_0141292_817_1143 | 107 |
| 392 | 3300053085 | Ga0495619_0010715 | Ga0495619_0010715_3338_3664 | 107 |
| 393 | 3300053085 | Ga0495619_0012642 | Ga0495619_0012642_2280_2606 | 107 |
| 394 | 3300054114 | Ga0501084_1074644 | Ga0501084_1074644_102_428 | 107 |
| 395 | 3300060353 | Ga0501082_0193717 | Ga0501082_0193717_1243_1569 | 107 |
| 396 | 3300060353 | Ga0501082_1389919 | Ga0501082_1389919_138_464 | 107 |
| 397 | 3300061734 | Ga0530510_0082904 | Ga0530510_0082904_1180_1506 | 107 |
| 398 | 3300061734 | Ga0530510_0659809 | Ga0530510_0659809_399_725 | 107 |
| 399 | 3300003215 | JGI25153J46596_10000123 | JGI25153J46596_1000012316 | 108 |
| 400 | 3300005327 | Ga0070658_10019884 | Ga0070658_100198843 | 108 |
| 401 | 3300005336 | Ga0070680_100026268 | Ga0070680_1000262684 | 108 |
| 402 | 3300005339 | Ga0070660_100095019 | Ga0070660_1000950192 | 108 |
| 403 | 3300005341 | Ga0070691_10417826 | Ga0070691_104178262 | 108 |
| 404 | 3300005344 | Ga0070661_100373965 | Ga0070661_1003739653 | 108 |
| 405 | 3300005366 | Ga0070659_100002582 | Ga0070659_10000258210 | 108 |
| 406 | 3300005437 | Ga0070710_10263687 | Ga0070710_102636872 | 108 |
| 407 | 3300005458 | Ga0070681_10032977 | Ga0070681_100329777 | 108 |
| 408 | 3300005530 | Ga0070679_100015819 | Ga0070679_1000158193 | 108 |
| 409 | 3300005539 | Ga0068853_100048354 | Ga0068853_1000483543 | 108 |
| 410 | 3300005539 | Ga0068853_100761220 | Ga0068853_1007612201 | 108 |
| 411 | 3300005937 | Ga0081455_10004915 | Ga0081455_1000491512 | 108 |
| 412 | 3300005937 | Ga0081455_10016611 | Ga0081455_100166116 | 108 |
| 413 | 3300005937 | Ga0081455_10249463 | Ga0081455_102494632 | 108 |
| 414 | 3300005937 | Ga0081455_10942001 | Ga0081455_109420011 | 108 |
| 415 | 3300005983 | Ga0081540_1039382 | Ga0081540_10393826 | 108 |
| 416 | 3300006038 | Ga0075365_10005965 | Ga0075365_100059651 | 108 |
| 417 | 3300006038 | Ga0075365_10157420 | Ga0075365_101574203 | 108 |
| 418 | 3300006038 | Ga0075365_10208641 | Ga0075365_102086412 | 108 |
| 419 | 3300006051 | Ga0075364_10121553 | Ga0075364_101215532 | 108 |
| 420 | 3300006175 | Ga0070712_100077892 | Ga0070712_1000778924 | 108 |
| 421 | 3300006175 | Ga0070712_100292334 | Ga0070712_1002923342 | 108 |
| 422 | 3300006177 | Ga0075362_10042856 | Ga0075362_100428565 | 108 |
| 423 | 3300006178 | Ga0075367_10067238 | Ga0075367_100672384 | 108 |
| 424 | 3300006844 | Ga0075428_100086288 | Ga0075428_1000862882 | 108 |
| 425 | 3300006844 | Ga0075428_100225960 | Ga0075428_1002259602 | 108 |
| 426 | 3300006844 | Ga0075428_100999358 | Ga0075428_1009993582 | 108 |
| 427 | 3300006846 | Ga0075430_100044548 | Ga0075430_1000445484 | 108 |
| 428 | 3300006847 | Ga0075431_100137563 | Ga0075431_1001375633 | 108 |
| 429 | 3300009551 | Ga0105238_10044506 | Ga0105238_100445062 | 108 |
| 430 | 3300009551 | Ga0105238_10383095 | Ga0105238_103830953 | 108 |
| 431 | 3300010159 | Ga0099796_10098897 | Ga0099796_100988972 | 108 |
| 432 | 3300025297 | Ga0209758_1000471 | Ga0209758_100047157 | 108 |
| 433 | 3300025304 | Ga0209257_1111540 | Ga0209257_11115401 | 108 |
| 434 | 3300025898 | Ga0207692_10276456 | Ga0207692_102764561 | 108 |
| 435 | 3300025905 | Ga0207685_10166677 | Ga0207685_101666773 | 108 |
| 436 | 3300025906 | Ga0207699_10617224 | Ga0207699_106172242 | 108 |
| 437 | 3300025906 | Ga0207699_11457658 | Ga0207699_114576582 | 108 |
| 438 | 3300025909 | Ga0207705_10007081 | Ga0207705_100070815 | 108 |
| 439 | 3300025912 | Ga0207707_10006922 | Ga0207707_100069228 | 108 |
| 440 | 3300025915 | Ga0207693_10345281 | Ga0207693_103452811 | 108 |
| 441 | 3300025915 | Ga0207693_10415542 | Ga0207693_104155421 | 108 |
| 442 | 3300025917 | Ga0207660_10003657 | Ga0207660_100036572 | 108 |
| 443 | 3300025919 | Ga0207657_10000372 | Ga0207657_1000037223 | 108 |
| 444 | 3300025919 | Ga0207657_10039324 | Ga0207657_100393243 | 108 |
| 445 | 3300025920 | Ga0207649_10234111 | Ga0207649_102341113 | 108 |
| 446 | 3300025921 | Ga0207652_10007908 | Ga0207652_100079086 | 108 |
| 447 | 3300025924 | Ga0207694_10023367 | Ga0207694_100233672 | 108 |
| 448 | 3300025928 | Ga0207700_10219225 | Ga0207700_102192253 | 108 |
| 449 | 3300025932 | Ga0207690_10038450 | Ga0207690_100384504 | 108 |
| 450 | 3300025939 | Ga0207665_10156653 | Ga0207665_101566533 | 108 |
| 451 | 3300025949 | Ga0207667_10021734 | Ga0207667_100217345 | 108 |
| 452 | 3300026041 | Ga0207639_10012255 | Ga0207639_100122554 | 108 |
| 453 | 3300027512 | Ga0209179_1064652 | Ga0209179_10646522 | 108 |
| 454 | 3300035089 | Ga0373944_0213437 | Ga0373944_0213437_25_366 | 108 |
| 455 | 3300035111 | Ga0373923_0003698 | Ga0373923_0003698_3794_4135 | 108 |
| 456 | 3300035113 | Ga0373936_0000419 | Ga0373936_0000419_1298_1639 | 108 |
| 457 | 3300035113 | Ga0373936_0008941 | Ga0373936_0008941_2365_2703 | 108 |
| 458 | 3300035114 | Ga0373939_0418355 | Ga0373939_0418355_48_389 | 108 |
| 459 | 3300035116 | Ga0373945_0004359 | Ga0373945_0004359_3580_3921 | 108 |
| 460 | 3300035117 | Ga0373953_0025521 | Ga0373953_0025521_280_621 | 108 |
| 461 | 3300035118 | Ga0373954_0002992 | Ga0373954_0002992_1441_1782 | 108 |
| 462 | 3300035119 | Ga0373956_0010700 | Ga0373956_0010700_2989_3330 | 108 |
| 463 | 3300035120 | Ga0373957_0013775 | Ga0373957_0013775_1486_1827 | 108 |
| 464 | 3300035170 | Ga0373943_0009759 | Ga0373943_0009759_1073_1414 | 108 |
| 465 | 3300035171 | Ga0373946_0000532 | Ga0373946_0000532_12066_12407 | 108 |
| 466 | 3300035172 | Ga0373955_0000096 | Ga0373955_0000096_24265_24606 | 108 |
| 467 | 3300035410 | Ga0373924_0023100 | Ga0373924_0023100_537_878 | 108 |
| 468 | 3300035692 | Ga0373935_0038879 | Ga0373935_0038879_1860_2201 | 108 |
| 469 | 3300035695 | Ga0373927_0011579 | Ga0373927_0011579_2754_3095 | 108 |
| 470 | 3300035724 | Ga0373933_0024792 | Ga0373933_0024792_2674_3015 | 108 |
| 471 | 3300035724 | Ga0373933_0324234 | Ga0373933_0324234_517_858 | 108 |
| 472 | 3300035725 | Ga0373947_0002497 | Ga0373947_0002497_62_403 | 108 |
| 473 | 3300036401 | Ga0373937_0000009 | Ga0373937_0000009_128555_128896 | 108 |
| 474 | 3300037068 | Ga0373925_0000036 | Ga0373925_0000036_126664_127005 | 108 |
| 475 | 3300042876 | Ga0451577_1034530 | Ga0451577_1034530_26_436 | 108 |
| 476 | 3300045051 | Ga0451576_1450783 | Ga0451576_1450783_275_685 | 108 |
| 477 | 3300046454 | Ga0495592_0000018 | Ga0495592_0000018_65646_65987 | 108 |
| 478 | 3300046459 | Ga0495629_0002014 | Ga0495629_0002014_8763_9104 | 108 |
| 479 | 3300046459 | Ga0495629_0037751 | Ga0495629_0037751_1537_1878 | 108 |
| 480 | 3300046462 | Ga0495651_0000322 | Ga0495651_0000322_21164_21505 | 108 |
| 481 | 3300046463 | Ga0495653_0000032 | Ga0495653_0000032_97756_98097 | 108 |
| 482 | 3300046473 | Ga0495582_0171765 | Ga0495582_0171765_258_599 | 108 |
| 483 | 3300046476 | Ga0495662_0021767 | Ga0495662_0021767_1901_2242 | 108 |
| 484 | 3300046477 | Ga0495664_0000010 | Ga0495664_0000010_139615_139956 | 108 |
| 485 | 3300046499 | Ga0495594_0754463 | Ga0495594_0754463_47_388 | 108 |
| 486 | 3300046511 | Ga0495608_0000008 | Ga0495608_0000008_128693_129034 | 108 |
| 487 | 3300046514 | Ga0495618_0000002 | Ga0495618_0000002_141888_142229 | 108 |
| 488 | 3300046514 | Ga0495618_0230918 | Ga0495618_0230918_744_1085 | 108 |
| 489 | 3300046516 | Ga0495628_0000009 | Ga0495628_0000009_139643_139984 | 108 |
| 490 | 3300046517 | Ga0495630_0000450 | Ga0495630_0000450_28869_29210 | 108 |
| 491 | 3300046529 | Ga0495652_0000011 | Ga0495652_0000011_128383_128724 | 108 |
| 492 | 3300046531 | Ga0495665_0064234 | Ga0495665_0064234_1166_1507 | 108 |
| 493 | 3300046533 | Ga0495640_0000009 | Ga0495640_0000009_77135_77476 | 108 |
| 494 | 3300046533 | Ga0495640_0462247 | Ga0495640_0462247_135_476 | 108 |
| 495 | 3300046535 | Ga0495586_0024112 | Ga0495586_0024112_330_671 | 108 |
| 496 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_253361_253702 | 108 |
| 497 | 3300046543 | Ga0495645_0000010 | Ga0495645_0000010_97756_98097 | 108 |
| 498 | 3300046559 | Ga0495667_0000005 | Ga0495667_0000005_139643_139984 | 108 |
| 499 | 3300046642 | Ga0495634_0000656 | Ga0495634_0000656_1218_1559 | 108 |
| 500 | 3300046663 | Ga0495635_0000008 | Ga0495635_0000008_128366_128707 | 108 |
| 501 | 3300046664 | Ga0495659_0558390 | Ga0495659_0558390_37_444 | 108 |
| 502 | 3300046675 | Ga0495657_0000058 | Ga0495657_0000058_83119_83460 | 108 |
| 503 | 3300046678 | Ga0495599_0000007 | Ga0495599_0000007_128383_128724 | 108 |
| 504 | 3300046679 | Ga0495623_0000067 | Ga0495623_0000067_33035_33376 | 108 |
| 505 | 3300046680 | Ga0495646_0000126 | Ga0495646_0000126_24875_25216 | 108 |
| 506 | 3300046683 | Ga0495658_0075305 | Ga0495658_0075305_551_892 | 108 |
| 507 | 3300046689 | Ga0495613_0009636 | Ga0495613_0009636_2416_2757 | 108 |
| 508 | 3300046690 | Ga0495624_0010482 | Ga0495624_0010482_5528_5869 | 108 |
| 509 | 3300046809 | Ga0495600_0000001 | Ga0495600_0000001_128383_128724 | 108 |
| 510 | 3300047315 | Ga0495581_0016578 | Ga0495581_0016578_1155_1496 | 108 |
| 511 | 3300047317 | Ga0495604_0000012 | Ga0495604_0000012_139630_139971 | 108 |
| 512 | 3300047319 | Ga0495674_0000011 | Ga0495674_0000011_141916_142257 | 108 |
| 513 | 3300047319 | Ga0495674_0398046 | Ga0495674_0398046_628_969 | 108 |
| 514 | 3300047321 | Ga0495676_0447572 | Ga0495676_0447572_440_781 | 108 |
| 515 | 3300047322 | Ga0495680_0000045 | Ga0495680_0000045_28912_29253 | 108 |
| 516 | 3300047322 | Ga0495680_0230564 | Ga0495680_0230564_163_504 | 108 |
| 517 | 3300047444 | Ga0495675_0000110 | Ga0495675_0000110_45193_45534 | 108 |
| 518 | 3300047471 | Ga0495684_0000014 | Ga0495684_0000014_139632_139973 | 108 |
| 519 | 3300047471 | Ga0495684_0275842 | Ga0495684_0275842_714_1055 | 108 |
| 520 | 3300047673 | Ga0495593_0001961 | Ga0495593_0001961_485_826 | 108 |
| 521 | 3300047673 | Ga0495593_0106869 | Ga0495593_0106869_565_906 | 108 |
| 522 | 3300048088 | Ga0495602_0000019 | Ga0495602_0000019_139607_139948 | 108 |
| 523 | 3300048903 | Ga0496100_0442614 | Ga0496100_0442614_309_647 | 108 |
| 524 | 3300049586 | Ga0501070_0687391 | Ga0501070_0687391_15_341 | 108 |
| 525 | 3300049589 | Ga0501073_0818780 | Ga0501073_0818780_282_623 | 108 |
| 526 | 3300050490 | nmdc:mga03n38_253529_c1 | nmdc:mga03n38_253529_c1_522_851 | 108 |
| 527 | 3300050491 | nmdc:mga00v17_26848_c1 | nmdc:mga00v17_26848_c1_788_1132 | 108 |
| 528 | 3300050492 | nmdc:mga0yw44_145313_c1 | nmdc:mga0yw44_145313_c1_1188_1517 | 108 |
| 529 | 3300050492 | nmdc:mga0yw44_1888_c1 | nmdc:mga0yw44_1888_c1_2139_2483 | 108 |
| 530 | 3300050507 | nmdc:mga05p37_828528_c1 | nmdc:mga05p37_828528_c1_434_778 | 108 |
| 531 | 3300050509 | nmdc:mga0qj67_72949_c1 | nmdc:mga0qj67_72949_c1_539_883 | 108 |
| 532 | 3300050510 | nmdc:mga06r32_115007_c1 | nmdc:mga06r32_115007_c1_985_1329 | 108 |
| 533 | 3300053077 | Ga0495601_0000009 | Ga0495601_0000009_128366_128707 | 108 |
| 534 | 3300053078 | Ga0495612_0000019 | Ga0495612_0000019_9121_9462 | 108 |
| 535 | 3300053084 | Ga0495595_0000015 | Ga0495595_0000015_109621_109962 | 108 |
| 536 | 3300053085 | Ga0495619_0000012 | Ga0495619_0000012_128366_128707 | 108 |
| 537 | 3300053085 | Ga0495619_0011194 | Ga0495619_0011194_5226_5567 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.9263 | 12 | 69 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9238 | 14 | 69 |
| 6j05-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9193 | 2 | 81 |
| 1wq2-assembly1.cif.gz_B | neutron crystal structure of dissimilatory sulfite reductase d (dsrd) | 0.914 | 26 | 70 |
| 6j05-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.912 | 2 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53478_1_106_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9758 | 3 | 100 | 1.10.10.10 |
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9365 | 15 | 69 | 1.10.10.10 |
| af_P71941_17_120_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9333 | 2 | 77 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9294 | 6 | 71 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9238 | 14 | 69 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538JLE8-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9907 | 2 | 100 |
GO:0003700
|
| AF-A0A1W6ZPW3-F1-model_v4 | Transcriptional regulator | 0.9844 | 1 | 100 |
GO:0003700
|
| AF-A0A2S7K9D7-F1-model_v4 | Transcriptional regulator | 0.9823 | 1 | 101 |
GO:0003700
|
| AF-A4EDA4-F1-model_v4 | Putative transcription regulator protein | 0.9786 | 1 | 100 |
GO:0003700
|
| AF-A0A2S7K9D7-F1-model_v4 | Transcriptional regulator | 0.9728 | 1 | 101 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar