F460773

General Info

Members Datasets Scaffolds Average Seq Length
536 303 1072 166

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10954939|Ga0111539_109549392
Length 163
Sequence VDDRLVVGWQIGRRPRAFRRVAVRCAHGYPAVTEQAARAEGGTPFPTTYWLTCPWLVAALARVEAAGGVERWSSAAAADPALAASLARADAEQRRLRPELDVGIGGSRDPVKLKCLHAHAAFALARPGYELGEQILAEAGERWCPDARCGAAKTATEETASAR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
195 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.84
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10954939 3300009094 Bacteria 997
2 JGI24743J22301_10027977 3300001991 Bacteria 1102
3 JGI24738J21930_10027994 3300002075 Bacteria 1154
4 Ga0070658_10495930 3300005327 Bacteria 1054
5 Ga0070676_10643788 3300005328 Bacteria 769
6 Ga0070683_100847359 3300005329 Unclassified 877
7 Ga0070670_100054300 3300005331 Bacteria 3439
8 Ga0070677_10020547 3300005333 Bacteria 2407
9 Ga0070677_10058851 3300005333 Bacteria 1579
10 Ga0068869_100353366 3300005334 Bacteria 1198
11 Ga0070680_100079887 3300005336 Bacteria 2696
12 Ga0070680_100131216 3300005336 Bacteria 2096
13 Ga0070682_100153574 3300005337 Bacteria 1582
14 Ga0068868_100067602 3300005338 Bacteria 2844
15 Ga0068868_100200720 3300005338 Bacteria 1662
16 Ga0070660_100010077 3300005339 Bacteria 6667
17 Ga0070660_100187219 3300005339 Unclassified 1676
18 Ga0070660_100287657 3300005339 Bacteria 1346
19 Ga0070689_100024068 3300005340 Bacteria 4566
20 Ga0070691_10074723 3300005341 Bacteria 1649
21 Ga0070687_100152029 3300005343 Unclassified 1359
22 Ga0070661_100071860 3300005344 Bacteria 2546
23 Ga0070692_10037625 3300005345 Bacteria 2461
24 Ga0070692_10125934 3300005345 Bacteria 1434
25 Ga0070668_100182410 3300005347 Bacteria 1715
26 Ga0070668_100265972 3300005347 Bacteria 1427
27 Ga0070669_100163337 3300005353 Archaea 1732
28 Ga0070669_100611620 3300005353 Bacteria 914
29 Ga0070675_100018792 3300005354 Bacteria 5502
30 Ga0070675_100277683 3300005354 Bacteria 1471
31 Ga0070671_100287581 3300005355 Bacteria 1399
32 Ga0070674_100048235 3300005356 Bacteria 2922
33 Ga0070674_100077949 3300005356 Bacteria 2360
34 Ga0070674_100090483 3300005356 Bacteria 2207
35 Ga0070674_100437518 3300005356 Bacteria 1077
36 Ga0070673_100021260 3300005364 Bacteria 4699
37 Ga0070673_100228132 3300005364 Bacteria 1615
38 Ga0070688_100635421 3300005365 Bacteria 820
39 Ga0070659_100045560 3300005366 Bacteria 3436
40 Ga0070667_100778569 3300005367 Bacteria 888
41 Ga0070714_100041639 3300005435 Bacteria 3877
42 Ga0070714_100062127 3300005435 Bacteria 3210
43 Ga0070714_100063163 3300005435 Bacteria 3184
44 Ga0070714_100461162 3300005435 Bacteria 1208
45 Ga0070713_100058480 3300005436 Bacteria 3215
46 Ga0070701_10007793 3300005438 Bacteria 4597
47 Ga0070701_10014887 3300005438 Bacteria 3576
48 Ga0070711_100357249 3300005439 Bacteria 1176
49 Ga0070705_100031915 3300005440 Bacteria 2921
50 Ga0070700_100043536 3300005441 Bacteria 2762
51 Ga0070700_100335450 3300005441 Bacteria 1116
52 Ga0070700_100425442 3300005441 Bacteria 1004
53 Ga0070694_100376782 3300005444 Bacteria 1106
54 Ga0070663_100284133 3300005455 Bacteria 1319
55 Ga0070678_100040444 3300005456 Bacteria 3299
56 Ga0070678_100043131 3300005456 Bacteria 3211
57 Ga0070678_100175828 3300005456 Bacteria 1748
58 Ga0070678_100298340 3300005456 Bacteria 1368
59 Ga0070662_100039906 3300005457 Bacteria 3341
60 Ga0070662_100076553 3300005457 Bacteria 2480
61 Ga0070681_10380289 3300005458 Bacteria 1323
62 Ga0070681_10427455 3300005458 Bacteria 1236
63 Ga0068867_100085682 3300005459 Bacteria 2382
64 Ga0068867_100164018 3300005459 Bacteria 1754
65 Ga0070685_10032068 3300005466 Bacteria 2941
66 Ga0070685_10045329 3300005466 Bacteria 2521
67 Ga0070685_10876045 3300005466 Bacteria 667
68 Ga0070707_100000499 3300005468 Bacteria 39000
69 Ga0070679_100201269 3300005530 Bacteria 1957
70 Ga0070679_100518503 3300005530 Bacteria 1136
71 Ga0070684_100040113 3300005535 Bacteria 4029
72 Ga0070684_100218582 3300005535 Bacteria 1738
73 Ga0070684_100343995 3300005535 Bacteria 1371
74 Ga0070684_100418666 3300005535 Bacteria 1236
75 Ga0068853_100049399 3300005539 Bacteria 3615
76 Ga0068853_100234005 3300005539 Bacteria 1681
77 Ga0068853_100679680 3300005539 Unclassified 981
78 Ga0070672_100081551 3300005543 Bacteria 2594
79 Ga0070672_100105963 3300005543 Bacteria 2286
80 Ga0070672_100335128 3300005543 Bacteria 1287
81 Ga0070686_100529371 3300005544 Bacteria 919
82 Ga0070695_100000007 3300005545 Bacteria 89343
83 Ga0070696_100181062 3300005546 Bacteria 1563
84 Ga0070693_100130028 3300005547 Bacteria 1573
85 Ga0070665_100071514 3300005548 Bacteria 3475
86 Ga0070704_100012979 3300005549 Bacteria 5155
87 Ga0068855_100038069 3300005563 Bacteria 5716
88 Ga0068855_100234159 3300005563 Bacteria 2054
89 Ga0068855_100429047 3300005563 Bacteria 1445
90 Ga0070664_100111738 3300005564 Bacteria 2385
91 Ga0070664_100262730 3300005564 Bacteria 1553
92 Ga0070664_100692108 3300005564 Bacteria 949
93 Ga0070664_100969390 3300005564 Bacteria 799
94 Ga0068857_100496751 3300005577 Bacteria 1145
95 Ga0068854_100309597 3300005578 Bacteria 1280
96 Ga0068854_100522745 3300005578 Unclassified 1002
97 Ga0068856_100144383 3300005614 Bacteria 2387
98 Ga0068856_100426966 3300005614 Bacteria 1345
99 Ga0070702_100078624 3300005615 Bacteria 1969
100 Ga0068852_100044919 3300005616 Bacteria 3755
101 Ga0068852_100096828 3300005616 Bacteria 2653
102 Ga0068859_100068014 3300005617 Bacteria 3597
103 Ga0068859_101141374 3300005617 Bacteria 858
104 Ga0068864_100210658 3300005618 Bacteria 1789
105 Ga0068866_10026029 3300005718 Bacteria 2757
106 Ga0068866_10068403 3300005718 Bacteria 1867
107 Ga0068866_11096641 3300005718 Bacteria 570
108 Ga0068861_100066178 3300005719 Bacteria 2785
109 Ga0068861_100598552 3300005719 Bacteria 1011
110 Ga0068851_10062001 3300005834 Bacteria 1918
111 Ga0068870_10032820 3300005840 Bacteria 2644
112 Ga0068870_10046709 3300005840 Bacteria 2272
113 Ga0068870_10426813 3300005840 Bacteria 869
114 Ga0068863_100027850 3300005841 Bacteria 5394
115 Ga0068858_100091132 3300005842 Bacteria 2837
116 Ga0068858_100118645 3300005842 Bacteria 2473
117 Ga0068860_100374039 3300005843 Bacteria 1406
118 Ga0068860_101064860 3300005843 Bacteria 827
119 Ga0068862_100114720 3300005844 Bacteria 2368
120 Ga0068862_100226635 3300005844 Bacteria 1694
121 Ga0081455_10018815 3300005937 Bacteria 6553
122 Ga0081538_10005584 3300005981 Bacteria 11291
123 Ga0070717_10001105 3300006028 Bacteria 18179
124 Ga0070717_10031753 3300006028 Bacteria 4252
125 Ga0070717_10044496 3300006028 Bacteria 3625
126 Ga0097621_100285934 3300006237 Bacteria 1453
127 Ga0097621_100872878 3300006237 Bacteria 837
128 Ga0068871_101079884 3300006358 Bacteria 750
129 Ga0075428_100065032 3300006844 Bacteria 3994
130 Ga0075428_100683945 3300006844 Bacteria 1093
131 Ga0075428_101827359 3300006844 Unclassified 632
132 Ga0075431_100022592 3300006847 Bacteria 6431
133 Ga0075434_100099304 3300006871 Bacteria 2916
134 Ga0075434_100168108 3300006871 Bacteria 2213
135 Ga0068865_100095779 3300006881 Bacteria 2163
136 Ga0068865_100169500 3300006881 Bacteria 1672
137 Ga0068865_100431576 3300006881 Bacteria 1086
138 Ga0097620_100068011 3300006931 Bacteria 3597
139 Ga0097620_101141489 3300006931 Bacteria 858
140 Ga0075435_100015463 3300007076 Bacteria 5738
141 Ga0105244_10246130 3300009036 Bacteria 834
142 Ga0105240_10005400 3300009093 Bacteria 19053
143 Ga0105240_10462637 3300009093 Bacteria 1417
144 Ga0111539_10195269 3300009094 Bacteria 2361
145 Ga0111539_10618844 3300009094 Bacteria 1261
146 Ga0105245_10038930 3300009098 Bacteria 4231
147 Ga0105245_10121829 3300009098 Bacteria 2438
148 Ga0105245_10218415 3300009098 Bacteria 1838
149 Ga0105247_10058964 3300009101 Bacteria 2375
150 Ga0114129_11212621 3300009147 Bacteria 939
151 Ga0105243_10008242 3300009148 Bacteria 8004
152 Ga0105243_10087734 3300009148 Bacteria 2554
153 Ga0105243_10182475 3300009148 Bacteria 1826
154 Ga0105243_10330875 3300009148 Bacteria 1391
155 Ga0105243_10490825 3300009148 Bacteria 1161
156 Ga0105243_11399520 3300009148 Bacteria 720
157 Ga0105241_10461604 3300009174 Bacteria 1125
158 Ga0105242_10147105 3300009176 Bacteria 2050
159 Ga0105248_10035641 3300009177 Bacteria 5566
160 Ga0105248_10193562 3300009177 Bacteria 2291
161 Ga0105248_10498926 3300009177 Bacteria 1372
162 Ga0105237_10234253 3300009545 Bacteria 1837
163 Ga0105238_10094583 3300009551 Bacteria 2976
164 Ga0105238_10247995 3300009551 Bacteria 1758
165 Ga0105249_10219454 3300009553 Bacteria 1870
166 Ga0105249_12810008 3300009553 Unclassified 558
167 Ga0105239_10004989 3300010375 Bacteria 15673
168 Ga0105239_10128311 3300010375 Bacteria 2820
169 Ga0105239_11012628 3300010375 Unclassified 955
170 Ga0105246_10011569 3300011119 Bacteria 5477
171 Ga0105246_11650594 3300011119 Bacteria 607
172 Ga0157323_1003618 3300012495 Bacteria 942
173 Ga0157373_10880496 3300013100 Unclassified 664
174 Ga0157371_10171897 3300013102 Bacteria 1549
175 Ga0157371_10588606 3300013102 Unclassified 827
176 Ga0157369_10143307 3300013105 Bacteria 2527
177 Ga0157374_10662938 3300013296 Bacteria 1055
178 Ga0157378_10668257 3300013297 Bacteria 1056
179 Ga0163162_10117339 3300013306 Bacteria 2763
180 Ga0163162_10565675 3300013306 Bacteria 1264
181 Ga0157372_10187387 3300013307 Bacteria 2396
182 Ga0157372_10283376 3300013307 Bacteria 1927
183 Ga0157375_10025190 3300013308 Bacteria 5522
184 Ga0157375_10494027 3300013308 Bacteria 1388
185 Ga0157375_10652524 3300013308 Bacteria 1208
186 Ga0163163_10032010 3300014325 Bacteria 5079
187 Ga0163163_10406218 3300014325 Unclassified 1420
188 Ga0163163_10762855 3300014325 Bacteria 1031
189 Ga0157380_10021657 3300014326 Bacteria 4825
190 Ga0157380_10029570 3300014326 Bacteria 4188
191 Ga0157380_10176019 3300014326 Bacteria 1875
192 Ga0157380_11053426 3300014326 Bacteria 850
193 Ga0157380_11383696 3300014326 Bacteria 754
194 Ga0182008_10054713 3300014497 Bacteria 1974
195 Ga0157377_10202505 3300014745 Bacteria 1261
196 Ga0157377_10206490 3300014745 Unclassified 1250
197 Ga0157379_10003816 3300014968 Bacteria 12847
198 Ga0157379_10077539 3300014968 Bacteria 2975
199 Ga0157379_10361741 3300014968 Bacteria 1330
200 Ga0157376_10010527 3300014969 Bacteria 6771
201 Ga0157376_10813672 3300014969 Bacteria 948
202 Ga0163161_10118701 3300017792 Bacteria 1985
203 Ga0206353_10239140 3300020082 Bacteria 1276
204 Ga0207656_10048197 3300025321 Bacteria 1833
205 Ga0207682_10010155 3300025893 Bacteria 3694
206 Ga0207642_10003794 3300025899 Bacteria 4814
207 Ga0207642_10055250 3300025899 Bacteria 1815
208 Ga0207642_10437576 3300025899 Bacteria 790
209 Ga0207710_10054718 3300025900 Bacteria 1798
210 Ga0207688_10124108 3300025901 Bacteria 1509
211 Ga0207688_10342345 3300025901 Bacteria 920
212 Ga0207688_10407696 3300025901 Bacteria 844
213 Ga0207680_10342341 3300025903 Bacteria 1049
214 Ga0207647_10026483 3300025904 Bacteria 3794
215 Ga0207699_10311733 3300025906 Bacteria 1101
216 Ga0207645_10275436 3300025907 Bacteria 1116
217 Ga0207643_10018615 3300025908 Bacteria 3802
218 Ga0207643_10047381 3300025908 Bacteria 2432
219 Ga0207705_10581712 3300025909 Bacteria 871
220 Ga0207654_10311239 3300025911 Bacteria 1074
221 Ga0207707_10394868 3300025912 Bacteria 1188
222 Ga0207695_10248128 3300025913 Bacteria 1680
223 Ga0207671_10861592 3300025914 Bacteria 717
224 Ga0207663_10521944 3300025916 Bacteria 925
225 Ga0207662_10023184 3300025918 Bacteria 3564
226 Ga0207657_10012056 3300025919 Bacteria 8550
227 Ga0207657_10202502 3300025919 Bacteria 1596
228 Ga0207649_10036969 3300025920 Bacteria 2945
229 Ga0207649_11397840 3300025920 Bacteria 554
230 Ga0207646_10000903 3300025922 Bacteria 38217
231 Ga0207681_10294241 3300025923 Unclassified 1283
232 Ga0207694_10171032 3300025924 Bacteria 1759
233 Ga0207650_10419233 3300025925 Bacteria 1110
234 Ga0207659_10378173 3300025926 Bacteria 1180
235 Ga0207687_10015376 3300025927 Bacteria 5016
236 Ga0207687_10188478 3300025927 Bacteria 1603
237 Ga0207687_10310956 3300025927 Bacteria 1272
238 Ga0207687_10849635 3300025927 Bacteria 780
239 Ga0207700_10205387 3300025928 Bacteria 1662
240 Ga0207700_10551055 3300025928 Bacteria 1024
241 Ga0207664_10012137 3300025929 Bacteria 6155
242 Ga0207664_10020539 3300025929 Bacteria 4897
243 Ga0207644_10089769 3300025931 Bacteria 2288
244 Ga0207644_10461860 3300025931 Bacteria 1044
245 Ga0207690_10125963 3300025932 Unclassified 1868
246 Ga0207706_10327771 3300025933 Bacteria 1332
247 Ga0207706_10594659 3300025933 Bacteria 951
248 Ga0207686_10161425 3300025934 Bacteria 1571
249 Ga0207709_10032756 3300025935 Bacteria 3046
250 Ga0207709_10163327 3300025935 Bacteria 1555
251 Ga0207670_10041284 3300025936 Bacteria 3033
252 Ga0207670_10210109 3300025936 Bacteria 1484
253 Ga0207669_10006546 3300025937 Bacteria 5336
254 Ga0207669_10015258 3300025937 Bacteria 3870
255 Ga0207669_10032297 3300025937 Bacteria 2938
256 Ga0207704_10136017 3300025938 Bacteria 1710
257 Ga0207704_10648759 3300025938 Bacteria 869
258 Ga0207691_10013058 3300025940 Bacteria 7952
259 Ga0207691_10171920 3300025940 Unclassified 1897
260 Ga0207691_10196207 3300025940 Bacteria 1759
261 Ga0207691_10248588 3300025940 Bacteria 1536
262 Ga0207711_10310199 3300025941 Unclassified 1457
263 Ga0207689_10148388 3300025942 Bacteria 1933
264 Ga0207689_10363270 3300025942 Bacteria 1204
265 Ga0207679_10595464 3300025945 Bacteria 996
266 Ga0207679_10817235 3300025945 Bacteria 850
267 Ga0207667_11085345 3300025949 Bacteria 784
268 Ga0207712_10059325 3300025961 Bacteria 2708
269 Ga0207712_10288475 3300025961 Bacteria 1342
270 Ga0207640_10568003 3300025981 Unclassified 956
271 Ga0207658_10969311 3300025986 Bacteria 775
272 Ga0207677_10185225 3300026023 Bacteria 1641
273 Ga0207677_10334665 3300026023 Bacteria 1263
274 Ga0207703_10064916 3300026035 Bacteria 2998
275 Ga0207703_10372666 3300026035 Bacteria 1319
276 Ga0207639_10243049 3300026041 Bacteria 1566
277 Ga0207639_10509852 3300026041 Bacteria 1100
278 Ga0207678_10039113 3300026067 Bacteria 4117
279 Ga0207678_10680921 3300026067 Bacteria 904
280 Ga0207708_10028029 3300026075 Bacteria 4265
281 Ga0207708_10616705 3300026075 Bacteria 920
282 Ga0207702_10183525 3300026078 Bacteria 1928
283 Ga0207702_10428661 3300026078 Bacteria 1280
284 Ga0207641_10524439 3300026088 Bacteria 1153
285 Ga0207648_10069541 3300026089 Bacteria 3067
286 Ga0207648_10150197 3300026089 Bacteria 2056
287 Ga0207648_10391698 3300026089 Bacteria 1258
288 Ga0207648_10443418 3300026089 Bacteria 1181
289 Ga0207648_10514608 3300026089 Bacteria 1096
290 Ga0207676_10029241 3300026095 Bacteria 4123
291 Ga0207674_10224933 3300026116 Bacteria 1825
292 Ga0207675_100231376 3300026118 Bacteria 1783
293 Ga0207683_10175682 3300026121 Bacteria 1941
294 Ga0207698_10227190 3300026142 Bacteria 1691
295 Ga0207698_10613176 3300026142 Bacteria 1074
296 Ga0207698_11622483 3300026142 Bacteria 662
297 Ga0207428_10140465 3300027907 Bacteria 1844
298 Ga0207428_10307138 3300027907 Bacteria 1173
299 Ga0268266_10064539 3300028379 Bacteria 3164
300 Ga0268266_10106977 3300028379 Bacteria 2473
301 Ga0268266_10221708 3300028379 Bacteria 1739
302 Ga0268265_10268354 3300028380 Bacteria 1521
303 Ga0268265_10347938 3300028380 Bacteria 1352
304 Ga0268264_10268646 3300028381 Unclassified 1592
305 Ga0265326_10003777 3300028558 Bacteria 4938
306 Ga0265319_1010282 3300028563 Bacteria 3912
307 Ga0265334_10002449 3300028573 Bacteria 8714
308 Ga0265318_10001217 3300028577 Bacteria 15646
309 Ga0265323_10111543 3300028653 Bacteria 897
310 Ga0265336_10023184 3300028666 Bacteria 1971
311 Ga0265338_10035821 3300028800 Bacteria 4760
312 Ga0265324_10081391 3300029957 Bacteria 1101
313 Ga0265330_10001984 3300031235 Bacteria 11353
314 Ga0265332_10011123 3300031238 Bacteria 3999
315 Ga0265328_10004806 3300031239 Bacteria 5833
316 Ga0265320_10060422 3300031240 Bacteria 1809
317 Ga0265320_10087137 3300031240 Bacteria 1451
318 Ga0265325_10012158 3300031241 Bacteria 4927
319 Ga0265329_10008860 3300031242 Bacteria 3790
320 Ga0265340_10017566 3300031247 Bacteria 3699
321 Ga0265339_10015135 3300031249 Bacteria 4633
322 Ga0265331_10012328 3300031250 Bacteria 4633
323 Ga0265327_10010014 3300031251 Bacteria 6741
324 Ga0265316_10024715 3300031344 Bacteria 5025
325 Ga0265313_10023839 3300031595 Bacteria 3286
326 Ga0265314_10008940 3300031711 Bacteria 8531
327 Ga0265314_10243316 3300031711 Bacteria 1036
328 Ga0265342_10016701 3300031712 Bacteria 4789
329 Ga0265342_10260197 3300031712 Bacteria 923
330 Ga0307405_10221766 3300031731 Unclassified 1388
331 Ga0373948_0066313 3300034817 Bacteria 801
332 Ga0373958_0012442 3300034819 Unclassified 1456
333 Ga0373938_0006399 3300034957 Bacteria 2034
334 Ga0373928_0015003 3300035084 Bacteria 1572
335 Ga0373932_0123656 3300035112 Unclassified 865
336 Ga0373941_0032000 3300035115 Bacteria 1571
337 Ga0373960_0035910 3300035121 Unclassified 1409
338 Ga0373962_0023306 3300035242 Bacteria 1648
339 Ga0373931_0232760 3300035691 Bacteria 1114
340 Ga0395899_0012992 3300037312 Bacteria 6371
341 Ga0395900_0035348 3300037418 Bacteria 5146
342 Ga0395900_0482812 3300037418 Unclassified 1191
343 Ga0395898_0075900 3300037466 Bacteria 3246
344 Ga0395898_0350161 3300037466 Unclassified 1408
345 Ga0395905_0025915 3300037471 Bacteria 5526
346 Ga0395905_1388701 3300037471 Unclassified 606
347 Ga0395901_0055732 3300038443 Bacteria 4111
348 Ga0395901_0312052 3300038443 Unclassified 1628
349 Ga0395901_0642311 3300038443 Unclassified 1065
350 Ga0451853_3414004 3300041512 Bacteria 939
351 Ga0450918_014679 3300042531 Bacteria 1361
352 Ga0466965_0067557 3300044683 Bacteria 1794
353 Ga0466965_0117761 3300044683 Bacteria 1370
354 Ga0466966_0030723 3300044684 Bacteria 3485
355 Ga0466966_0066759 3300044684 Bacteria 2260
356 Ga0466961_0027346 3300044693 Bacteria 3668
357 Ga0466961_0080629 3300044693 Bacteria 2060
358 Ga0466961_0088983 3300044693 Bacteria 1950
359 Ga0466963_0002243 3300044694 Bacteria 10724
360 Ga0466963_0007718 3300044694 Bacteria 6428
361 Ga0466963_0011927 3300044694 Bacteria 5307
362 Ga0466963_0019451 3300044694 Bacteria 4260
363 Ga0466963_0035210 3300044694 Bacteria 3260
364 Ga0466963_0038952 3300044694 Bacteria 3110
365 Ga0466964_0004002 3300044706 Bacteria 5414
366 Ga0466964_0028534 3300044706 Bacteria 2199
367 Ga0466964_0041393 3300044706 Bacteria 1863
368 Ga0466964_0062405 3300044706 Unclassified 1554
369 Ga0466964_0089145 3300044706 Bacteria 1339
370 Ga0466964_0317297 3300044706 Unclassified 791
371 Ga0466971_0041117 3300044719 Bacteria 2076
372 Ga0466971_0051212 3300044719 Bacteria 1858
373 Ga0466971_0083141 3300044719 Bacteria 1462
374 Ga0466968_0005128 3300044735 Bacteria 4900
375 Ga0466970_0040437 3300044765 Bacteria 2476
376 Ga0466957_0018810 3300044842 Bacteria 4060
377 Ga0466957_0024865 3300044842 Bacteria 3548
378 Ga0466957_0035076 3300044842 Bacteria 3010
379 Ga0466957_0060862 3300044842 Unclassified 2316
380 Ga0466957_0170467 3300044842 Bacteria 1417
381 Ga0466957_0772241 3300044842 Bacteria 681
382 Ga0466960_0003178 3300044901 Bacteria 6300
383 Ga0466960_0308943 3300044901 Bacteria 893
384 Ga0466959_0001767 3300045049 Bacteria 13474
385 Ga0466959_0005580 3300045049 Bacteria 8644
386 Ga0466958_0007353 3300045836 Bacteria 6051
387 Ga0466958_0018843 3300045836 Bacteria 4010
388 Ga0466958_0299261 3300045836 Unclassified 1033
389 Ga0466958_0301095 3300045836 Bacteria 1029
390 Ga0466958_0497893 3300045836 Bacteria 791
391 Ga0466967_0000300 3300045976 Bacteria 22193
392 Ga0466967_0009122 3300045976 Bacteria 7336
393 Ga0466967_0023976 3300045976 Bacteria 5010
394 Ga0466967_0027797 3300045976 Bacteria 4710
395 Ga0466967_0042797 3300045976 Bacteria 3916
396 Ga0466967_0045294 3300045976 Bacteria 3821
397 Ga0466967_0047230 3300045976 Bacteria 3752
398 Ga0466967_0054655 3300045976 Bacteria 3516
399 Ga0466967_0707726 3300045976 Bacteria 998
400 Ga0466967_0861394 3300045976 Bacteria 900
401 Ga0495592_0002732 3300046454 Bacteria 12499
402 Ga0495603_0010669 3300046455 Bacteria 5571
403 Ga0495603_0043413 3300046455 Bacteria 2685
404 Ga0495629_0227286 3300046459 Bacteria 1286
405 Ga0495651_0340723 3300046462 Bacteria 993
406 Ga0495653_0048443 3300046463 Bacteria 3280
407 Ga0495664_0020777 3300046477 Bacteria 3790
408 Ga0495664_0175331 3300046477 Bacteria 1300
409 Ga0495584_0101168 3300046491 Unclassified 1457
410 Ga0495584_0434078 3300046491 Unclassified 668
411 Ga0495594_0125369 3300046499 Bacteria 1453
412 Ga0495596_0120411 3300046500 Bacteria 1019
413 Ga0495608_0023669 3300046511 Bacteria 4207
414 Ga0495608_0262314 3300046511 Bacteria 1075
415 Ga0495618_0050577 3300046514 Bacteria 2625
416 Ga0495628_0047682 3300046516 Bacteria 3397
417 Ga0495630_0060472 3300046517 Bacteria 2843
418 Ga0495637_0119369 3300046520 Bacteria 1016
419 Ga0495644_0049877 3300046523 Bacteria 1571
420 Ga0495644_0260770 3300046523 Unclassified 674
421 Ga0495652_0162175 3300046529 Unclassified 1734
422 Ga0495652_0204795 3300046529 Bacteria 1494
423 Ga0495654_0225326 3300046530 Bacteria 791
424 Ga0495640_0186789 3300046533 Bacteria 1319
425 Ga0495640_0698525 3300046533 Bacteria 609
426 Ga0495587_0175414 3300046536 Bacteria 1216
427 Ga0495609_0214666 3300046538 Bacteria 800
428 Ga0495645_0015955 3300046543 Bacteria 5351
429 Ga0495633_0415549 3300046558 Bacteria 608
430 Ga0495667_0002577 3300046559 Bacteria 12113
431 Ga0495635_0016922 3300046663 Bacteria 5093
432 Ga0495659_0098564 3300046664 Bacteria 1130
433 Ga0495588_0447922 3300046674 Bacteria 677
434 Ga0495657_0003815 3300046675 Bacteria 12188
435 Ga0495657_0232901 3300046675 Bacteria 1113
436 Ga0495657_0587871 3300046675 Bacteria 645
437 Ga0495599_0178685 3300046678 Bacteria 1309
438 Ga0495646_0045685 3300046680 Bacteria 2674
439 Ga0495646_0164062 3300046680 Bacteria 1228
440 Ga0495613_0862232 3300046689 Bacteria 588
441 Ga0495671_0315981 3300046692 Bacteria 750
442 Ga0495674_0685919 3300047319 Bacteria 805
443 Ga0495676_0453810 3300047321 Bacteria 845
444 Ga0495680_0030376 3300047322 Bacteria 4412
445 Ga0495680_0041731 3300047322 Bacteria 3646
446 Ga0495680_0100593 3300047322 Bacteria 2154
447 Ga0495680_0338108 3300047322 Bacteria 1051
448 Ga0495675_0155519 3300047444 Bacteria 1411
449 Ga0495684_0010689 3300047471 Bacteria 7096
450 Ga0495593_0226032 3300047673 Bacteria 939
451 Ga0495602_0386464 3300048088 Bacteria 1001
452 Ga0496100_0010553 3300048903 Bacteria 5232
453 Ga0496100_0617038 3300048903 Bacteria 843
454 Ga0496101_0035933 3300048904 Bacteria 3506
455 Ga0496102_0017065 3300048905 Bacteria 6354
456 Ga0496102_0329126 3300048905 Bacteria 1439
457 Ga0496103_0208222 3300048906 Bacteria 1258
458 Ga0496104_0001249 3300048907 Bacteria 21900
459 Ga0496104_0111245 3300048907 Bacteria 2626
460 Ga0496104_1148694 3300048907 Bacteria 680
461 Ga0496105_0002794 3300048908 Bacteria 12764
462 Ga0496105_0347659 3300048908 Bacteria 1185
463 Ga0496105_0426009 3300048908 Unclassified 1050
464 Ga0496106_0010194 3300048909 Bacteria 6944
465 Ga0496106_0173741 3300048909 Unclassified 1709
466 Ga0496107_0088921 3300048910 Bacteria 2255
467 Ga0496107_0450466 3300048910 Bacteria 956
468 Ga0496108_0002204 3300048911 Bacteria 15597
469 Ga0496108_0021802 3300048911 Bacteria 5265
470 Ga0496108_0042720 3300048911 Bacteria 3785
471 Ga0496109_0005212 3300048912 Bacteria 10859
472 Ga0496109_0046245 3300048912 Bacteria 3952
473 Ga0496109_0080794 3300048912 Bacteria 2996
474 Ga0496109_0603066 3300048912 Bacteria 1034
475 Ga0496110_0035129 3300048913 Bacteria 4347
476 Ga0496110_0172817 3300048913 Bacteria 1960
477 Ga0496111_0009723 3300048914 Bacteria 6428
478 Ga0496111_0023776 3300048914 Bacteria 4305
479 Ga0496111_0370579 3300048914 Unclassified 1059
480 Ga0496111_0825183 3300048914 Bacteria 670
481 Ga0496112_0068725 3300048915 Bacteria 3499
482 Ga0496112_0284213 3300048915 Bacteria 1601
483 Ga0496113_0027258 3300048916 Bacteria 4094
484 Ga0496113_0135191 3300048916 Bacteria 1937
485 Ga0496114_0004028 3300048917 Bacteria 11350
486 Ga0496114_0069364 3300048917 Bacteria 2960
487 Ga0496114_0071705 3300048917 Bacteria 2912
488 Ga0496114_0073953 3300048917 Bacteria 2869
489 Ga0496114_0174825 3300048917 Unclassified 1873
490 Ga0496114_0215505 3300048917 Bacteria 1685
491 Ga0496114_0260541 3300048917 Bacteria 1526
492 Ga0496115_0027538 3300048918 Bacteria 4447
493 Ga0496115_0172714 3300048918 Unclassified 1787
494 Ga0501039_0633076 3300049575 Bacteria 838
495 Ga0501040_0460831 3300049576 Bacteria 915
496 Ga0501042_0174882 3300049578 Bacteria 1549
497 Ga0501046_0617043 3300049580 Bacteria 769
498 Ga0501048_0245654 3300049582 Unclassified 1270
499 Ga0501048_0294148 3300049582 Bacteria 1155
500 Ga0501048_0322175 3300049582 Bacteria 1101
501 Ga0501067_0005667 3300049583 Bacteria 6932
502 Ga0501067_0028431 3300049583 Unclassified 3098
503 Ga0501068_0036720 3300049584 Unclassified 2931
504 Ga0501069_0007502 3300049585 Bacteria 5728
505 Ga0501069_0042155 3300049585 Bacteria 2524
506 Ga0501071_0405205 3300049587 Bacteria 1041
507 Ga0501072_0050047 3300049588 Bacteria 3290
508 Ga0501072_0312851 3300049588 Unclassified 1248
509 Ga0501075_0211655 3300049591 Bacteria 1479
510 Ga0501076_0687762 3300049592 Bacteria 844
511 Ga0501080_0636111 3300049742 Bacteria 945
512 Ga0501081_0413182 3300049743 Bacteria 1000
513 nmdc:mga05p37_369609_c1 3300050507 Unclassified 1683
514 nmdc:mga05p37_65936_c1 3300050507 Bacteria 4454
515 nmdc:mga08y16_26236_c1 3300050511 Bacteria 6144
516 nmdc:mga08y16_829676_c1 3300050511 Unclassified 915
517 nmdc:mga0n895_246949_c1 3300050512 Bacteria 1811
518 nmdc:mga0n895_4721_c1 3300050512 Bacteria 11251
519 nmdc:mga0rr50_8064_c1 3300050513 Bacteria 6533
520 nmdc:mga08x19_106671_c1 3300050514 Bacteria 1864
521 nmdc:mga08x19_335801_c1 3300050514 Bacteria 1053
522 Ga0495601_0095504 3300053077 Bacteria 1916
523 Ga0495601_0118429 3300053077 Bacteria 1719
524 Ga0495612_0011561 3300053078 Bacteria 3556
525 Ga0495612_0100291 3300053078 Bacteria 1232
526 Ga0495595_0010033 3300053084 Bacteria 3929
527 Ga0495595_0077357 3300053084 Bacteria 1580
528 Ga0495595_0247329 3300053084 Unclassified 892
529 Ga0495619_0023256 3300053085 Bacteria 3972
530 Ga0495619_0032119 3300053085 Bacteria 3405
531 Ga0495619_0153325 3300053085 Unclassified 1589
532 Ga0501084_0663321 3300054114 Bacteria 880
533 Ga0501082_0227667 3300060353 Bacteria 1623
534 Ga0466962_0016061 3300061719 Bacteria 3611
535 Ga0466962_0060651 3300061719 Unclassified 1806
536 Ga0530510_0981382 3300061734 Bacteria 646
537 Ga0111539_10954939
538 JGI24743J22301_10027977
539 JGI24738J21930_10027994
540 Ga0070658_10495930
541 Ga0070676_10643788
542 Ga0070683_100847359
543 Ga0070670_100054300
544 Ga0070677_10020547
545 Ga0070677_10058851
546 Ga0068869_100353366
547 Ga0070680_100079887
548 Ga0070680_100131216
549 Ga0070682_100153574
550 Ga0068868_100067602
551 Ga0068868_100200720
552 Ga0070660_100010077
553 Ga0070660_100187219
554 Ga0070660_100287657
555 Ga0070689_100024068
556 Ga0070691_10074723
557 Ga0070687_100152029
558 Ga0070661_100071860
559 Ga0070692_10037625
560 Ga0070692_10125934
561 Ga0070668_100182410
562 Ga0070668_100265972
563 Ga0070669_100163337
564 Ga0070669_100611620
565 Ga0070675_100018792
566 Ga0070675_100277683
567 Ga0070671_100287581
568 Ga0070674_100048235
569 Ga0070674_100077949
570 Ga0070674_100090483
571 Ga0070674_100437518
572 Ga0070673_100021260
573 Ga0070673_100228132
574 Ga0070688_100635421
575 Ga0070659_100045560
576 Ga0070667_100778569
577 Ga0070714_100041639
578 Ga0070714_100062127
579 Ga0070714_100063163
580 Ga0070714_100461162
581 Ga0070713_100058480
582 Ga0070701_10007793
583 Ga0070701_10014887
584 Ga0070711_100357249
585 Ga0070705_100031915
586 Ga0070700_100043536
587 Ga0070700_100335450
588 Ga0070700_100425442
589 Ga0070694_100376782
590 Ga0070663_100284133
591 Ga0070678_100040444
592 Ga0070678_100043131
593 Ga0070678_100175828
594 Ga0070678_100298340
595 Ga0070662_100039906
596 Ga0070662_100076553
597 Ga0070681_10380289
598 Ga0070681_10427455
599 Ga0068867_100085682
600 Ga0068867_100164018
601 Ga0070685_10032068
602 Ga0070685_10045329
603 Ga0070685_10876045
604 Ga0070707_100000499
605 Ga0070679_100201269
606 Ga0070679_100518503
607 Ga0070684_100040113
608 Ga0070684_100218582
609 Ga0070684_100343995
610 Ga0070684_100418666
611 Ga0068853_100049399
612 Ga0068853_100234005
613 Ga0068853_100679680
614 Ga0070672_100081551
615 Ga0070672_100105963
616 Ga0070672_100335128
617 Ga0070686_100529371
618 Ga0070695_100000007
619 Ga0070696_100181062
620 Ga0070693_100130028
621 Ga0070665_100071514
622 Ga0070704_100012979
623 Ga0068855_100038069
624 Ga0068855_100234159
625 Ga0068855_100429047
626 Ga0070664_100111738
627 Ga0070664_100262730
628 Ga0070664_100692108
629 Ga0070664_100969390
630 Ga0068857_100496751
631 Ga0068854_100309597
632 Ga0068854_100522745
633 Ga0068856_100144383
634 Ga0068856_100426966
635 Ga0070702_100078624
636 Ga0068852_100044919
637 Ga0068852_100096828
638 Ga0068859_100068014
639 Ga0068859_101141374
640 Ga0068864_100210658
641 Ga0068866_10026029
642 Ga0068866_10068403
643 Ga0068866_11096641
644 Ga0068861_100066178
645 Ga0068861_100598552
646 Ga0068851_10062001
647 Ga0068870_10032820
648 Ga0068870_10046709
649 Ga0068870_10426813
650 Ga0068863_100027850
651 Ga0068858_100091132
652 Ga0068858_100118645
653 Ga0068860_100374039
654 Ga0068860_101064860
655 Ga0068862_100114720
656 Ga0068862_100226635
657 Ga0081455_10018815
658 Ga0081538_10005584
659 Ga0070717_10001105
660 Ga0070717_10031753
661 Ga0070717_10044496
662 Ga0097621_100285934
663 Ga0097621_100872878
664 Ga0068871_101079884
665 Ga0075428_100065032
666 Ga0075428_100683945
667 Ga0075428_101827359
668 Ga0075431_100022592
669 Ga0075434_100099304
670 Ga0075434_100168108
671 Ga0068865_100095779
672 Ga0068865_100169500
673 Ga0068865_100431576
674 Ga0097620_100068011
675 Ga0097620_101141489
676 Ga0075435_100015463
677 Ga0105244_10246130
678 Ga0105240_10005400
679 Ga0105240_10462637
680 Ga0111539_10195269
681 Ga0111539_10618844
682 Ga0105245_10038930
683 Ga0105245_10121829
684 Ga0105245_10218415
685 Ga0105247_10058964
686 Ga0114129_11212621
687 Ga0105243_10008242
688 Ga0105243_10087734
689 Ga0105243_10182475
690 Ga0105243_10330875
691 Ga0105243_10490825
692 Ga0105243_11399520
693 Ga0105241_10461604
694 Ga0105242_10147105
695 Ga0105248_10035641
696 Ga0105248_10193562
697 Ga0105248_10498926
698 Ga0105237_10234253
699 Ga0105238_10094583
700 Ga0105238_10247995
701 Ga0105249_10219454
702 Ga0105249_12810008
703 Ga0105239_10004989
704 Ga0105239_10128311
705 Ga0105239_11012628
706 Ga0105246_10011569
707 Ga0105246_11650594
708 Ga0157323_1003618
709 Ga0157373_10880496
710 Ga0157371_10171897
711 Ga0157371_10588606
712 Ga0157369_10143307
713 Ga0157374_10662938
714 Ga0157378_10668257
715 Ga0163162_10117339
716 Ga0163162_10565675
717 Ga0157372_10187387
718 Ga0157372_10283376
719 Ga0157375_10025190
720 Ga0157375_10494027
721 Ga0157375_10652524
722 Ga0163163_10032010
723 Ga0163163_10406218
724 Ga0163163_10762855
725 Ga0157380_10021657
726 Ga0157380_10029570
727 Ga0157380_10176019
728 Ga0157380_11053426
729 Ga0157380_11383696
730 Ga0182008_10054713
731 Ga0157377_10202505
732 Ga0157377_10206490
733 Ga0157379_10003816
734 Ga0157379_10077539
735 Ga0157379_10361741
736 Ga0157376_10010527
737 Ga0157376_10813672
738 Ga0163161_10118701
739 Ga0206353_10239140
740 Ga0207656_10048197
741 Ga0207682_10010155
742 Ga0207642_10003794
743 Ga0207642_10055250
744 Ga0207642_10437576
745 Ga0207710_10054718
746 Ga0207688_10124108
747 Ga0207688_10342345
748 Ga0207688_10407696
749 Ga0207680_10342341
750 Ga0207647_10026483
751 Ga0207699_10311733
752 Ga0207645_10275436
753 Ga0207643_10018615
754 Ga0207643_10047381
755 Ga0207705_10581712
756 Ga0207654_10311239
757 Ga0207707_10394868
758 Ga0207695_10248128
759 Ga0207671_10861592
760 Ga0207663_10521944
761 Ga0207662_10023184
762 Ga0207657_10012056
763 Ga0207657_10202502
764 Ga0207649_10036969
765 Ga0207649_11397840
766 Ga0207646_10000903
767 Ga0207681_10294241
768 Ga0207694_10171032
769 Ga0207650_10419233
770 Ga0207659_10378173
771 Ga0207687_10015376
772 Ga0207687_10188478
773 Ga0207687_10310956
774 Ga0207687_10849635
775 Ga0207700_10205387
776 Ga0207700_10551055
777 Ga0207664_10012137
778 Ga0207664_10020539
779 Ga0207644_10089769
780 Ga0207644_10461860
781 Ga0207690_10125963
782 Ga0207706_10327771
783 Ga0207706_10594659
784 Ga0207686_10161425
785 Ga0207709_10032756
786 Ga0207709_10163327
787 Ga0207670_10041284
788 Ga0207670_10210109
789 Ga0207669_10006546
790 Ga0207669_10015258
791 Ga0207669_10032297
792 Ga0207704_10136017
793 Ga0207704_10648759
794 Ga0207691_10013058
795 Ga0207691_10171920
796 Ga0207691_10196207
797 Ga0207691_10248588
798 Ga0207711_10310199
799 Ga0207689_10148388
800 Ga0207689_10363270
801 Ga0207679_10595464
802 Ga0207679_10817235
803 Ga0207667_11085345
804 Ga0207712_10059325
805 Ga0207712_10288475
806 Ga0207640_10568003
807 Ga0207658_10969311
808 Ga0207677_10185225
809 Ga0207677_10334665
810 Ga0207703_10064916
811 Ga0207703_10372666
812 Ga0207639_10243049
813 Ga0207639_10509852
814 Ga0207678_10039113
815 Ga0207678_10680921
816 Ga0207708_10028029
817 Ga0207708_10616705
818 Ga0207702_10183525
819 Ga0207702_10428661
820 Ga0207641_10524439
821 Ga0207648_10069541
822 Ga0207648_10150197
823 Ga0207648_10391698
824 Ga0207648_10443418
825 Ga0207648_10514608
826 Ga0207676_10029241
827 Ga0207674_10224933
828 Ga0207675_100231376
829 Ga0207683_10175682
830 Ga0207698_10227190
831 Ga0207698_10613176
832 Ga0207698_11622483
833 Ga0207428_10140465
834 Ga0207428_10307138
835 Ga0268266_10064539
836 Ga0268266_10106977
837 Ga0268266_10221708
838 Ga0268265_10268354
839 Ga0268265_10347938
840 Ga0268264_10268646
841 Ga0265326_10003777
842 Ga0265319_1010282
843 Ga0265334_10002449
844 Ga0265318_10001217
845 Ga0265323_10111543
846 Ga0265336_10023184
847 Ga0265338_10035821
848 Ga0265324_10081391
849 Ga0265330_10001984
850 Ga0265332_10011123
851 Ga0265328_10004806
852 Ga0265320_10060422
853 Ga0265320_10087137
854 Ga0265325_10012158
855 Ga0265329_10008860
856 Ga0265340_10017566
857 Ga0265339_10015135
858 Ga0265331_10012328
859 Ga0265327_10010014
860 Ga0265316_10024715
861 Ga0265313_10023839
862 Ga0265314_10008940
863 Ga0265314_10243316
864 Ga0265342_10016701
865 Ga0265342_10260197
866 Ga0307405_10221766
867 Ga0373948_0066313
868 Ga0373958_0012442
869 Ga0373938_0006399
870 Ga0373928_0015003
871 Ga0373932_0123656
872 Ga0373941_0032000
873 Ga0373960_0035910
874 Ga0373962_0023306
875 Ga0373931_0232760
876 Ga0395899_0012992
877 Ga0395900_0035348
878 Ga0395900_0482812
879 Ga0395898_0075900
880 Ga0395898_0350161
881 Ga0395905_0025915
882 Ga0395905_1388701
883 Ga0395901_0055732
884 Ga0395901_0312052
885 Ga0395901_0642311
886 Ga0451853_3414004
887 Ga0450918_014679
888 Ga0466965_0067557
889 Ga0466965_0117761
890 Ga0466966_0030723
891 Ga0466966_0066759
892 Ga0466961_0027346
893 Ga0466961_0080629
894 Ga0466961_0088983
895 Ga0466963_0002243
896 Ga0466963_0007718
897 Ga0466963_0011927
898 Ga0466963_0019451
899 Ga0466963_0035210
900 Ga0466963_0038952
901 Ga0466964_0004002
902 Ga0466964_0028534
903 Ga0466964_0041393
904 Ga0466964_0062405
905 Ga0466964_0089145
906 Ga0466964_0317297
907 Ga0466971_0041117
908 Ga0466971_0051212
909 Ga0466971_0083141
910 Ga0466968_0005128
911 Ga0466970_0040437
912 Ga0466957_0018810
913 Ga0466957_0024865
914 Ga0466957_0035076
915 Ga0466957_0060862
916 Ga0466957_0170467
917 Ga0466957_0772241
918 Ga0466960_0003178
919 Ga0466960_0308943
920 Ga0466959_0001767
921 Ga0466959_0005580
922 Ga0466958_0007353
923 Ga0466958_0018843
924 Ga0466958_0299261
925 Ga0466958_0301095
926 Ga0466958_0497893
927 Ga0466967_0000300
928 Ga0466967_0009122
929 Ga0466967_0023976
930 Ga0466967_0027797
931 Ga0466967_0042797
932 Ga0466967_0045294
933 Ga0466967_0047230
934 Ga0466967_0054655
935 Ga0466967_0707726
936 Ga0466967_0861394
937 Ga0495592_0002732
938 Ga0495603_0010669
939 Ga0495603_0043413
940 Ga0495629_0227286
941 Ga0495651_0340723
942 Ga0495653_0048443
943 Ga0495664_0020777
944 Ga0495664_0175331
945 Ga0495584_0101168
946 Ga0495584_0434078
947 Ga0495594_0125369
948 Ga0495596_0120411
949 Ga0495608_0023669
950 Ga0495608_0262314
951 Ga0495618_0050577
952 Ga0495628_0047682
953 Ga0495630_0060472
954 Ga0495637_0119369
955 Ga0495644_0049877
956 Ga0495644_0260770
957 Ga0495652_0162175
958 Ga0495652_0204795
959 Ga0495654_0225326
960 Ga0495640_0186789
961 Ga0495640_0698525
962 Ga0495587_0175414
963 Ga0495609_0214666
964 Ga0495645_0015955
965 Ga0495633_0415549
966 Ga0495667_0002577
967 Ga0495635_0016922
968 Ga0495659_0098564
969 Ga0495588_0447922
970 Ga0495657_0003815
971 Ga0495657_0232901
972 Ga0495657_0587871
973 Ga0495599_0178685
974 Ga0495646_0045685
975 Ga0495646_0164062
976 Ga0495613_0862232
977 Ga0495671_0315981
978 Ga0495674_0685919
979 Ga0495676_0453810
980 Ga0495680_0030376
981 Ga0495680_0041731
982 Ga0495680_0100593
983 Ga0495680_0338108
984 Ga0495675_0155519
985 Ga0495684_0010689
986 Ga0495593_0226032
987 Ga0495602_0386464
988 Ga0496100_0010553
989 Ga0496100_0617038
990 Ga0496101_0035933
991 Ga0496102_0017065
992 Ga0496102_0329126
993 Ga0496103_0208222
994 Ga0496104_0001249
995 Ga0496104_0111245
996 Ga0496104_1148694
997 Ga0496105_0002794
998 Ga0496105_0347659
999 Ga0496105_0426009
1000 Ga0496106_0010194
1001 Ga0496106_0173741
1002 Ga0496107_0088921
1003 Ga0496107_0450466
1004 Ga0496108_0002204
1005 Ga0496108_0021802
1006 Ga0496108_0042720
1007 Ga0496109_0005212
1008 Ga0496109_0046245
1009 Ga0496109_0080794
1010 Ga0496109_0603066
1011 Ga0496110_0035129
1012 Ga0496110_0172817
1013 Ga0496111_0009723
1014 Ga0496111_0023776
1015 Ga0496111_0370579
1016 Ga0496111_0825183
1017 Ga0496112_0068725
1018 Ga0496112_0284213
1019 Ga0496113_0027258
1020 Ga0496113_0135191
1021 Ga0496114_0004028
1022 Ga0496114_0069364
1023 Ga0496114_0071705
1024 Ga0496114_0073953
1025 Ga0496114_0174825
1026 Ga0496114_0215505
1027 Ga0496114_0260541
1028 Ga0496115_0027538
1029 Ga0496115_0172714
1030 Ga0501039_0633076
1031 Ga0501040_0460831
1032 Ga0501042_0174882
1033 Ga0501046_0617043
1034 Ga0501048_0245654
1035 Ga0501048_0294148
1036 Ga0501048_0322175
1037 Ga0501067_0005667
1038 Ga0501067_0028431
1039 Ga0501068_0036720
1040 Ga0501069_0007502
1041 Ga0501069_0042155
1042 Ga0501071_0405205
1043 Ga0501072_0050047
1044 Ga0501072_0312851
1045 Ga0501075_0211655
1046 Ga0501076_0687762
1047 Ga0501080_0636111
1048 Ga0501081_0413182
1049 nmdc:mga05p37_369609_c1
1050 nmdc:mga05p37_65936_c1
1051 nmdc:mga08y16_26236_c1
1052 nmdc:mga08y16_829676_c1
1053 nmdc:mga0n895_246949_c1
1054 nmdc:mga0n895_4721_c1
1055 nmdc:mga0rr50_8064_c1
1056 nmdc:mga08x19_106671_c1
1057 nmdc:mga08x19_335801_c1
1058 Ga0495601_0095504
1059 Ga0495601_0118429
1060 Ga0495612_0011561
1061 Ga0495612_0100291
1062 Ga0495595_0010033
1063 Ga0495595_0077357
1064 Ga0495595_0247329
1065 Ga0495619_0023256
1066 Ga0495619_0032119
1067 Ga0495619_0153325
1068 Ga0501084_0663321
1069 Ga0501082_0227667
1070 Ga0466962_0016061
1071 Ga0466962_0060651
1072 Ga0530510_0981382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04417

DUF501

Protein of unknown function (DUF501)

21

101

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jxr-assembly1.cif.gz_A crystal structure human immunodeficiency virus-1 matrix protein mutant q63r crystal form 1 0.2949 43 148
7jxr-assembly2.cif.gz_B crystal structure human immunodeficiency virus-1 matrix protein mutant q63r crystal form 1 0.2368 51 152
7jxr-assembly1.cif.gz_A crystal structure human immunodeficiency virus-1 matrix protein mutant q63r crystal form 1 0.2055 43 148
7jxr-assembly2.cif.gz_B crystal structure human immunodeficiency virus-1 matrix protein mutant q63r crystal form 1 0.1765 51 152
ID Description Score Start End Superfamily
af_Q9VEP8_137_697_1.10.640.10 Mainly Alpha;Orthogonal Bundle;Myeloperoxidase, subunit C;Haem peroxidase domain superfamily, animal type 0.284 3 45 1.10.640.10
af_P69434_98_193_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.227 55 153 1.25.40.10
af_P69434_98_193_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.218 55 153 1.25.40.10
af_A0A1P8B5A1_66_206_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.1555 55 158 1.25.40.10
af_A0A1P8B5A1_66_206_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.1283 55 158 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7V9JP12-F1-model_v4 DUF501 domain-containing protein 0.994 1 162
AF-A0A538DC47-F1-model_v4 DUF501 domain-containing protein 0.9923 1 161
AF-A0A7V9CR68-F1-model_v4 DUF501 domain-containing protein 0.9901 1 161
AF-A0A7V9JP12-F1-model_v4 DUF501 domain-containing protein 0.9819 1 162
AF-A0A538G6S4-F1-model_v4 DUF501 domain-containing protein 0.9707 1 140

Map