F460653

General Info

Members Datasets Scaffolds Average Seq Length
535 260 1070 205

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10755963|Ga0105238_107559631
Length 220
Sequence MQWLRRSFIAGFFVTVPLIISVAAILWLFRLVDGLVGPLYIKLLGPNAVPPGLGVATTALAILLVGAIATNVVGKRLLQRTEWLLMHVPLFRSIYAPVKQLVVAFSPDNEYGFKRVVLIEDVSRGFLLGFLTREFTIDRGQGPEPLVAVYVPTNHLYLGDIVICPRDRASYPDITVEQGIRIFLTGGMALAGRIGARRGDDRVGDFRVQSGVLTLYKGRE

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
253 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 4.11
Rhizosphere 90.28
Stem 0
Stem Tuber 0
Unclassified 11.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10755963 3300009551 Bacteria 986
2 Ga0065712_10002619 3300005290 Bacteria 4325
3 Ga0065712_10112318 3300005290 Bacteria 1802
4 Ga0065712_10317043 3300005290 Unclassified 834
5 Ga0065715_10018429 3300005293 Bacteria 3032
6 Ga0065715_10097585 3300005293 Bacteria 3682
7 Ga0065715_10154316 3300005293 Bacteria 1694
8 Ga0065715_10202184 3300005293 Bacteria 1356
9 Ga0065715_10283236 3300005293 Bacteria 1081
10 Ga0065707_10002935 3300005295 Bacteria 6637
11 Ga0065707_10114178 3300005295 Bacteria 2304
12 Ga0065707_10145516 3300005295 Bacteria 1719
13 Ga0065707_10397455 3300005295 Bacteria 857
14 Ga0070658_10188679 3300005327 Bacteria 1737
15 Ga0070676_10028753 3300005328 Bacteria 3158
16 Ga0070676_10053472 3300005328 Bacteria 2379
17 Ga0070683_100086185 3300005329 Bacteria 2945
18 Ga0070690_100019138 3300005330 Bacteria 4149
19 Ga0070670_100013699 3300005331 Bacteria 6949
20 Ga0070670_100023819 3300005331 Bacteria 5267
21 Ga0070670_100144660 3300005331 Bacteria 2056
22 Ga0070670_100193329 3300005331 Bacteria 1768
23 Ga0070677_10123467 3300005333 Bacteria 1172
24 Ga0070677_10220866 3300005333 Bacteria 925
25 Ga0068869_100049354 3300005334 Bacteria 3046
26 Ga0068869_100083017 3300005334 Bacteria 2396
27 Ga0068869_100246271 3300005334 Unclassified 1426
28 Ga0070666_10047510 3300005335 Bacteria 2882
29 Ga0070680_100044316 3300005336 Bacteria 3615
30 Ga0070682_100443072 3300005337 Bacteria 993
31 Ga0068868_100062110 3300005338 Bacteria 2961
32 Ga0070689_100039302 3300005340 Bacteria 3622
33 Ga0070689_100997082 3300005340 Bacteria 745
34 Ga0070691_10025596 3300005341 Bacteria 2748
35 Ga0070687_100123098 3300005343 Unclassified 1486
36 Ga0070687_100537898 3300005343 Unclassified 793
37 Ga0070661_100021350 3300005344 Bacteria 4622
38 Ga0070692_10029084 3300005345 Bacteria 2753
39 Ga0070668_100005545 3300005347 Bacteria 9365
40 Ga0070669_100025522 3300005353 Bacteria 4244
41 Ga0070675_100222314 3300005354 Unclassified 1645
42 Ga0070675_100640074 3300005354 Bacteria 966
43 Ga0070675_100777513 3300005354 Bacteria 875
44 Ga0070671_100202840 3300005355 Bacteria 1682
45 Ga0070674_100049731 3300005356 Bacteria 2883
46 Ga0070674_100198478 3300005356 Bacteria 1548
47 Ga0070674_100337625 3300005356 Bacteria 1213
48 Ga0070673_100034852 3300005364 Bacteria 3813
49 Ga0070673_100223534 3300005364 Bacteria 1630
50 Ga0070673_100312650 3300005364 Bacteria 1386
51 Ga0070673_100345898 3300005364 Bacteria 1319
52 Ga0070673_100483559 3300005364 Bacteria 1118
53 Ga0070688_100020716 3300005365 Bacteria 3828
54 Ga0070688_100053447 3300005365 Bacteria 2527
55 Ga0070688_100223070 3300005365 Bacteria 1329
56 Ga0070688_100347336 3300005365 Bacteria 1085
57 Ga0070659_100047831 3300005366 Bacteria 3357
58 Ga0070659_100265501 3300005366 Bacteria 1425
59 Ga0070659_100396721 3300005366 Unclassified 1164
60 Ga0070659_101079130 3300005366 Bacteria 707
61 Ga0070667_100190076 3300005367 Bacteria 1819
62 Ga0070667_100375559 3300005367 Bacteria 1290
63 Ga0070701_10010253 3300005438 Bacteria 4136
64 Ga0070701_10020810 3300005438 Bacteria 3120
65 Ga0070701_10174201 3300005438 Unclassified 1255
66 Ga0070701_10326874 3300005438 Bacteria 951
67 Ga0070711_100215273 3300005439 Bacteria 1490
68 Ga0070700_100043722 3300005441 Bacteria 2757
69 Ga0070663_100115274 3300005455 Bacteria 2024
70 Ga0070663_100277849 3300005455 Bacteria 1334
71 Ga0070663_100847532 3300005455 Unclassified 786
72 Ga0070678_100010948 3300005456 Bacteria 5567
73 Ga0070678_100117354 3300005456 Bacteria 2093
74 Ga0070662_100023264 3300005457 Bacteria 4254
75 Ga0070662_100042946 3300005457 Bacteria 3232
76 Ga0070662_100560632 3300005457 Bacteria 958
77 Ga0070681_10141241 3300005458 Bacteria 2338
78 Ga0070681_10160798 3300005458 Bacteria 2170
79 Ga0068867_100034734 3300005459 Bacteria 3657
80 Ga0068867_100346688 3300005459 Bacteria 1238
81 Ga0070706_100304782 3300005467 Bacteria 1486
82 Ga0070707_100095763 3300005468 Bacteria 2875
83 Ga0070698_100315432 3300005471 Bacteria 1494
84 Ga0070679_100085984 3300005530 Bacteria 3132
85 Ga0070684_100000213 3300005535 Bacteria 40774
86 Ga0070684_100021090 3300005535 Bacteria 5413
87 Ga0070672_100260643 3300005543 Bacteria 1462
88 Ga0070672_100491436 3300005543 Bacteria 1061
89 Ga0070686_100030771 3300005544 Bacteria 3276
90 Ga0070695_100458497 3300005545 Bacteria 978
91 Ga0070693_100018762 3300005547 Bacteria 3617
92 Ga0070693_100048812 3300005547 Bacteria 2412
93 Ga0070693_100345193 3300005547 Bacteria 1017
94 Ga0070704_100019929 3300005549 Bacteria 4316
95 Ga0070704_100083332 3300005549 Bacteria 2360
96 Ga0070704_100105787 3300005549 Bacteria 2131
97 Ga0068855_100197821 3300005563 Bacteria 2264
98 Ga0068855_100367469 3300005563 Bacteria 1582
99 Ga0070664_100003485 3300005564 Bacteria 12706
100 Ga0070664_100251768 3300005564 Bacteria 1588
101 Ga0070664_100563693 3300005564 Bacteria 1054
102 Ga0070664_100869639 3300005564 Bacteria 844
103 Ga0068857_100115181 3300005577 Bacteria 2418
104 Ga0068857_100145826 3300005577 Bacteria 2142
105 Ga0068854_100072781 3300005578 Bacteria 2517
106 Ga0068856_100358811 3300005614 Unclassified 1476
107 Ga0070702_100020751 3300005615 Bacteria 3446
108 Ga0068852_100027261 3300005616 Bacteria 4655
109 Ga0068852_100385947 3300005616 Bacteria 1375
110 Ga0068859_100105083 3300005617 Bacteria 2883
111 Ga0068859_100460888 3300005617 Bacteria 1367
112 Ga0068859_100952348 3300005617 Unclassified 942
113 Ga0068864_100235982 3300005618 Bacteria 1693
114 Ga0068864_100394559 3300005618 Bacteria 1314
115 Ga0068866_10096221 3300005718 Bacteria 1623
116 Ga0068861_100017062 3300005719 Bacteria 5150
117 Ga0068861_100130224 3300005719 Bacteria 2041
118 Ga0068861_100513805 3300005719 Bacteria 1085
119 Ga0068861_100676883 3300005719 Bacteria 956
120 Ga0068861_101107645 3300005719 Bacteria 761
121 Ga0068858_100042644 3300005842 Bacteria 4207
122 Ga0068858_100188574 3300005842 Bacteria 1948
123 Ga0068860_100169730 3300005843 Bacteria 2107
124 Ga0068862_100016570 3300005844 Bacteria 6137
125 Ga0068862_100023828 3300005844 Bacteria 5130
126 Ga0068862_100522120 3300005844 Bacteria 1130
127 Ga0075365_10007126 3300006038 Bacteria 6237
128 Ga0075365_10047716 3300006038 Bacteria 2816
129 Ga0075368_10003124 3300006042 Bacteria 5495
130 Ga0075364_10011584 3300006051 Bacteria 5359
131 Ga0075367_10003066 3300006178 Bacteria 7835
132 Ga0075367_10442936 3300006178 Unclassified 823
133 Ga0075369_10100541 3300006186 Bacteria 1297
134 Ga0075366_10007177 3300006195 Bacteria 6138
135 Ga0075366_10355114 3300006195 Bacteria 900
136 Ga0097621_100028109 3300006237 Bacteria 4430
137 Ga0097621_100812541 3300006237 Unclassified 867
138 Ga0075370_10033912 3300006353 Bacteria 2860
139 Ga0068871_100607659 3300006358 Bacteria 995
140 Ga0068871_100790291 3300006358 Bacteria 874
141 Ga0075428_100006187 3300006844 Bacteria 13316
142 Ga0075431_100142913 3300006847 Bacteria 2467
143 Ga0075431_100494938 3300006847 Bacteria 1214
144 Ga0075433_10112240 3300006852 Bacteria 2418
145 Ga0075434_100001737 3300006871 Bacteria 18704
146 Ga0075434_100196888 3300006871 Bacteria 2035
147 Ga0075434_100278027 3300006871 Bacteria 1694
148 Ga0075434_100328886 3300006871 Bacteria 1549
149 Ga0075434_100413990 3300006871 Bacteria 1369
150 Ga0075434_100658306 3300006871 Bacteria 1065
151 Ga0075429_100051387 3300006880 Bacteria 3587
152 Ga0075429_100497814 3300006880 Bacteria 1068
153 Ga0068865_100095685 3300006881 Bacteria 2164
154 Ga0068865_100245525 3300006881 Unclassified 1410
155 Ga0068865_100297874 3300006881 Bacteria 1290
156 Ga0097620_100105077 3300006931 Bacteria 2883
157 Ga0097620_100302895 3300006931 Bacteria 1692
158 Ga0097620_100460846 3300006931 Bacteria 1367
159 Ga0097620_100952268 3300006931 Unclassified 942
160 Ga0075435_100001458 3300007076 Bacteria 15191
161 Ga0075435_100030576 3300007076 Bacteria 4236
162 Ga0075435_100096310 3300007076 Bacteria 2448
163 Ga0075435_100539614 3300007076 Unclassified 1010
164 Ga0105240_10278604 3300009093 Bacteria 1922
165 Ga0105240_10940545 3300009093 Unclassified 928
166 Ga0111539_10000512 3300009094 Bacteria 49211
167 Ga0111539_10001914 3300009094 Bacteria 27722
168 Ga0111539_10009801 3300009094 Bacteria 12091
169 Ga0111539_10125663 3300009094 Bacteria 3005
170 Ga0111539_10192331 3300009094 Bacteria 2380
171 Ga0111539_10195219 3300009094 Bacteria 2361
172 Ga0111539_10627154 3300009094 Bacteria 1252
173 Ga0111539_10805781 3300009094 Bacteria 1093
174 Ga0111539_10900625 3300009094 Bacteria 1029
175 Ga0111539_11422240 3300009094 Bacteria 804
176 Ga0111539_11734897 3300009094 Unclassified 724
177 Ga0105245_10315143 3300009098 Bacteria 1539
178 Ga0105245_11473898 3300009098 Unclassified 731
179 Ga0114129_10007864 3300009147 Bacteria 15169
180 Ga0114129_10044141 3300009147 Bacteria 6271
181 Ga0114129_10048827 3300009147 Bacteria 5948
182 Ga0114129_10380665 3300009147 Bacteria 1864
183 Ga0114129_10458172 3300009147 Bacteria 1671
184 Ga0114129_11274450 3300009147 Bacteria 912
185 Ga0105243_10009828 3300009148 Bacteria 7281
186 Ga0105241_10117423 3300009174 Bacteria 2138
187 Ga0105242_10177626 3300009176 Bacteria 1876
188 Ga0105242_10332953 3300009176 Bacteria 1396
189 Ga0105242_10343296 3300009176 Bacteria 1377
190 Ga0105242_10443131 3300009176 Unclassified 1222
191 Ga0105248_10004840 3300009177 Bacteria 14908
192 Ga0105248_10033622 3300009177 Bacteria 5728
193 Ga0105248_10199785 3300009177 Bacteria 2253
194 Ga0105248_10210289 3300009177 Bacteria 2192
195 Ga0105248_10836044 3300009177 Bacteria 1039
196 Ga0105238_10380557 3300009551 Bacteria 1403
197 Ga0105249_10028686 3300009553 Bacteria 5023
198 Ga0105249_10263133 3300009553 Bacteria 1715
199 Ga0105249_10329213 3300009553 Bacteria 1541
200 Ga0105239_10114307 3300010375 Bacteria 2994
201 Ga0105246_11320867 3300011119 Bacteria 669
202 Ga0157370_10366137 3300013104 Bacteria 1328
203 Ga0157374_10216644 3300013296 Bacteria 1878
204 Ga0157378_10257850 3300013297 Bacteria 1672
205 Ga0157378_11838241 3300013297 Bacteria 654
206 Ga0163162_10236445 3300013306 Bacteria 1957
207 Ga0157375_11256666 3300013308 Unclassified 870
208 Ga0157380_10012408 3300014326 Bacteria 6183
209 Ga0157380_10028867 3300014326 Bacteria 4235
210 Ga0157380_10136255 3300014326 Bacteria 2102
211 Ga0157380_10267614 3300014326 Bacteria 1556
212 Ga0157380_10700138 3300014326 Bacteria 1018
213 Ga0157380_10754838 3300014326 Bacteria 985
214 Ga0157380_11154145 3300014326 Unclassified 816
215 Ga0157377_10142010 3300014745 Bacteria 1476
216 Ga0157376_10052778 3300014969 Bacteria 3382
217 Ga0157376_10535494 3300014969 Bacteria 1157
218 Ga0207666_1017999 3300025271 Bacteria 1024
219 Ga0207697_10048968 3300025315 Bacteria 1744
220 Ga0207653_10012507 3300025885 Bacteria 2650
221 Ga0207682_10040786 3300025893 Bacteria 1893
222 Ga0207682_10156975 3300025893 Unclassified 1029
223 Ga0207642_10074523 3300025899 Bacteria 1627
224 Ga0207688_10094660 3300025901 Bacteria 1719
225 Ga0207680_10072653 3300025903 Bacteria 2136
226 Ga0207647_10026527 3300025904 Bacteria 3790
227 Ga0207645_10004801 3300025907 Bacteria 9940
228 Ga0207645_10095662 3300025907 Bacteria 1913
229 Ga0207645_10144081 3300025907 Bacteria 1553
230 Ga0207643_10461625 3300025908 Bacteria 809
231 Ga0207684_10217008 3300025910 Bacteria 1650
232 Ga0207684_10502344 3300025910 Bacteria 1039
233 Ga0207654_10062896 3300025911 Bacteria 2176
234 Ga0207707_10035269 3300025912 Bacteria 4375
235 Ga0207707_10232195 3300025912 Bacteria 1605
236 Ga0207695_10107454 3300025913 Bacteria 2776
237 Ga0207663_10144579 3300025916 Bacteria 1661
238 Ga0207660_10671897 3300025917 Unclassified 845
239 Ga0207662_10019837 3300025918 Bacteria 3831
240 Ga0207657_10174048 3300025919 Bacteria 1743
241 Ga0207649_10005774 3300025920 Bacteria 6700
242 Ga0207652_10057453 3300025921 Bacteria 3351
243 Ga0207681_10030196 3300025923 Bacteria 3531
244 Ga0207681_10073425 3300025923 Bacteria 2393
245 Ga0207681_10124983 3300025923 Bacteria 1893
246 Ga0207681_10127065 3300025923 Bacteria 1879
247 Ga0207681_10796462 3300025923 Bacteria 789
248 Ga0207694_10236296 3300025924 Bacteria 1493
249 Ga0207694_10608786 3300025924 Bacteria 919
250 Ga0207650_10002558 3300025925 Bacteria 12608
251 Ga0207650_10052308 3300025925 Bacteria 3025
252 Ga0207650_10055778 3300025925 Bacteria 2934
253 Ga0207650_10112252 3300025925 Bacteria 2112
254 Ga0207659_10229685 3300025926 Bacteria 1496
255 Ga0207659_10670849 3300025926 Bacteria 887
256 Ga0207700_10018642 3300025928 Bacteria 4670
257 Ga0207700_10793400 3300025928 Bacteria 847
258 Ga0207644_10068704 3300025931 Bacteria 2585
259 Ga0207644_10155998 3300025931 Bacteria 1770
260 Ga0207690_10142835 3300025932 Bacteria 1766
261 Ga0207690_10250313 3300025932 Bacteria 1368
262 Ga0207690_10267609 3300025932 Unclassified 1326
263 Ga0207690_10314693 3300025932 Bacteria 1229
264 Ga0207706_10025340 3300025933 Bacteria 5315
265 Ga0207706_10045161 3300025933 Bacteria 3904
266 Ga0207706_10358046 3300025933 Bacteria 1268
267 Ga0207686_10040858 3300025934 Bacteria 2823
268 Ga0207709_10041775 3300025935 Bacteria 2754
269 Ga0207670_10059839 3300025936 Bacteria 2592
270 Ga0207669_10010037 3300025937 Bacteria 4542
271 Ga0207669_10018356 3300025937 Bacteria 3614
272 Ga0207669_10054679 3300025937 Bacteria 2413
273 Ga0207669_10301580 3300025937 Bacteria 1218
274 Ga0207704_10069821 3300025938 Bacteria 2222
275 Ga0207691_10194892 3300025940 Bacteria 1766
276 Ga0207691_10273269 3300025940 Bacteria 1455
277 Ga0207691_10485989 3300025940 Unclassified 1049
278 Ga0207711_10048716 3300025941 Bacteria 3625
279 Ga0207711_10343976 3300025941 Bacteria 1381
280 Ga0207711_10512701 3300025941 Bacteria 1118
281 Ga0207711_10639480 3300025941 Bacteria 992
282 Ga0207689_10083290 3300025942 Bacteria 2630
283 Ga0207689_10087572 3300025942 Bacteria 2558
284 Ga0207661_10001430 3300025944 Bacteria 16095
285 Ga0207661_10002652 3300025944 Bacteria 12308
286 Ga0207679_10006989 3300025945 Bacteria 7154
287 Ga0207679_10159812 3300025945 Bacteria 1844
288 Ga0207679_10217763 3300025945 Bacteria 1605
289 Ga0207667_10097614 3300025949 Bacteria 3032
290 Ga0207667_10648305 3300025949 Unclassified 1062
291 Ga0207651_10038744 3300025960 Bacteria 3135
292 Ga0207651_10184824 3300025960 Bacteria 1657
293 Ga0207651_10349985 3300025960 Bacteria 1244
294 Ga0207712_10030890 3300025961 Bacteria 3605
295 Ga0207712_10216944 3300025961 Bacteria 1527
296 Ga0207668_10134823 3300025972 Bacteria 1890
297 Ga0207668_10153312 3300025972 Bacteria 1787
298 Ga0207640_10226376 3300025981 Bacteria 1435
299 Ga0207677_10027982 3300026023 Bacteria 3559
300 Ga0207677_10143333 3300026023 Bacteria 1833
301 Ga0207703_10154777 3300026035 Bacteria 2002
302 Ga0207703_10184687 3300026035 Bacteria 1842
303 Ga0207678_10123974 3300026067 Bacteria 2205
304 Ga0207708_10001820 3300026075 Bacteria 15737
305 Ga0207708_10040703 3300026075 Bacteria 3543
306 Ga0207708_10061138 3300026075 Bacteria 2876
307 Ga0207708_10074839 3300026075 Bacteria 2596
308 Ga0207708_10075078 3300026075 Bacteria 2592
309 Ga0207641_10210148 3300026088 Bacteria 1799
310 Ga0207641_10859035 3300026088 Unclassified 900
311 Ga0207648_10000959 3300026089 Bacteria 32621
312 Ga0207648_10248001 3300026089 Bacteria 1587
313 Ga0207676_10049985 3300026095 Bacteria 3257
314 Ga0207674_10142992 3300026116 Bacteria 2352
315 Ga0207674_10149511 3300026116 Bacteria 2293
316 Ga0207675_100021012 3300026118 Bacteria 6086
317 Ga0207675_100041107 3300026118 Bacteria 4318
318 Ga0207675_100058891 3300026118 Bacteria 3584
319 Ga0207675_100213852 3300026118 Bacteria 1855
320 Ga0207675_100595574 3300026118 Bacteria 1108
321 Ga0207675_100647230 3300026118 Unclassified 1063
322 Ga0207675_101122487 3300026118 Unclassified 806
323 Ga0207683_10015366 3300026121 Bacteria 6518
324 Ga0207683_10238190 3300026121 Bacteria 1660
325 Ga0207683_10551791 3300026121 Unclassified 1065
326 Ga0207683_10803172 3300026121 Bacteria 873
327 Ga0207698_10414892 3300026142 Unclassified 1290
328 Ga0207698_11038178 3300026142 Bacteria 831
329 Ga0209983_1016753 3300027665 Bacteria 1515
330 Ga0209813_10026655 3300027866 Bacteria 1673
331 Ga0207428_10000574 3300027907 Bacteria 43446
332 Ga0207428_10000658 3300027907 Bacteria 40461
333 Ga0207428_10020157 3300027907 Bacteria 5670
334 Ga0207428_10027003 3300027907 Bacteria 4783
335 Ga0207428_10262144 3300027907 Bacteria 1287
336 Ga0268265_10016262 3300028380 Bacteria 5107
337 Ga0268265_10029346 3300028380 Bacteria 3947
338 Ga0268265_10253192 3300028380 Bacteria 1561
339 Ga0268265_10261287 3300028380 Bacteria 1539
340 Ga0268265_10262261 3300028380 Bacteria 1537
341 Ga0268264_10189786 3300028381 Bacteria 1872
342 Ga0268264_10241461 3300028381 Bacteria 1673
343 Ga0307408_100063720 3300031548 Bacteria 2698
344 Ga0307408_101041518 3300031548 Bacteria 756
345 Ga0307405_10006363 3300031731 Bacteria 5804
346 Ga0307405_10496745 3300031731 Bacteria 977
347 Ga0307410_10007286 3300031852 Bacteria 6045
348 Ga0307410_10061361 3300031852 Bacteria 2573
349 Ga0307410_10228013 3300031852 Bacteria 1437
350 Ga0307406_10834899 3300031901 Unclassified 780
351 Ga0307409_100072275 3300031995 Bacteria 2746
352 Ga0307409_100538395 3300031995 Bacteria 1144
353 Ga0307416_100029325 3300032002 Bacteria 4108
354 Ga0307416_100068319 3300032002 Bacteria 2936
355 Ga0307416_100233377 3300032002 Bacteria 1776
356 Ga0307416_100397650 3300032002 Bacteria 1414
357 Ga0307416_100564764 3300032002 Unclassified 1213
358 Ga0307416_101805867 3300032002 Bacteria 715
359 Ga0307414_10270413 3300032004 Bacteria 1423
360 Ga0307411_10102883 3300032005 Bacteria 2025
361 Ga0307411_10129057 3300032005 Bacteria 1844
362 Ga0307411_10193844 3300032005 Bacteria 1554
363 Ga0307411_10194446 3300032005 Bacteria 1552
364 Ga0373938_0073997 3300034957 Bacteria 819
365 Ga0373940_0073249 3300035088 Unclassified 1001
366 Ga0373936_0281824 3300035113 Unclassified 747
367 Ga0373939_0028886 3300035114 Bacteria 1582
368 Ga0373945_0093038 3300035116 Unclassified 1170
369 Ga0373960_0030610 3300035121 Bacteria 1500
370 Ga0373943_0048756 3300035170 Bacteria 2076
371 Ga0373955_0442476 3300035172 Bacteria 792
372 Ga0373942_0006218 3300035207 Bacteria 2757
373 Ga0373924_0087018 3300035410 Bacteria 1334
374 Ga0373927_0133554 3300035695 Bacteria 1622
375 Ga0373937_0001942 3300036401 Bacteria 17300
376 Ga0373925_0012122 3300037068 Bacteria 6239
377 Ga0395905_0282231 3300037471 Bacteria 1547
378 Ga0451789_1281983 3300041443 Bacteria 952
379 Ga0451800_0974527 3300041459 Unclassified 726
380 Ga0451853_0228372 3300041512 Unclassified 1156
381 Ga0451853_0573528 3300041512 Unclassified 804
382 Ga0439433_0018173 3300041999 Bacteria 1564
383 Ga0450894_012701 3300042131 Unclassified 1103
384 Ga0439446_0180376 3300042156 Unclassified 706
385 Ga0439435_0003763 3300042436 Bacteria 3193
386 Ga0451577_0046462 3300042876 Bacteria 3885
387 Ga0451577_0541077 3300042876 Bacteria 1057
388 Ga0453684_0016537 3300044712 Bacteria 11519
389 Ga0453684_0664494 3300044712 Bacteria 1136
390 Ga0466957_0500715 3300044842 Unclassified 842
391 Ga0466959_0195915 3300045049 Bacteria 1408
392 Ga0451576_0595731 3300045051 Unclassified 1162
393 Ga0466967_0266701 3300045976 Bacteria 1639
394 Ga0466967_0271806 3300045976 Bacteria 1624
395 Ga0495662_0044246 3300046476 Bacteria 2150
396 Ga0495628_0347348 3300046516 Unclassified 1091
397 Ga0495628_0494320 3300046516 Bacteria 884
398 Ga0495630_0221894 3300046517 Bacteria 1443
399 Ga0495598_0087526 3300046537 Bacteria 1010
400 Ga0495621_0079561 3300046539 Bacteria 1220
401 Ga0495667_0217781 3300046559 Bacteria 1219
402 Ga0495599_0110315 3300046678 Bacteria 1714
403 Ga0495599_0354825 3300046678 Bacteria 879
404 Ga0495613_0071535 3300046689 Bacteria 2528
405 Ga0495686_0212747 3300047472 Bacteria 1104
406 Ga0496102_0934982 3300048905 Bacteria 788
407 Ga0496104_0003311 3300048907 Bacteria 13902
408 Ga0496106_0208517 3300048909 Bacteria 1556
409 Ga0496108_0012914 3300048911 Bacteria 6806
410 Ga0496109_0003151 3300048912 Bacteria 13754
411 Ga0496109_0511993 3300048912 Unclassified 1133
412 Ga0496109_0570499 3300048912 Unclassified 1067
413 Ga0496109_0580127 3300048912 Bacteria 1057
414 Ga0496110_0009805 3300048913 Bacteria 7758
415 Ga0496110_0232016 3300048913 Bacteria 1679
416 Ga0496110_0268287 3300048913 Bacteria 1554
417 Ga0496110_0352288 3300048913 Bacteria 1341
418 Ga0496111_0544357 3300048914 Bacteria 852
419 Ga0496112_0000717 3300048915 Bacteria 23023
420 Ga0496112_0189779 3300048915 Bacteria 2017
421 Ga0496112_0283239 3300048915 Bacteria 1604
422 Ga0496112_0636185 3300048915 Unclassified 997
423 Ga0496113_0239117 3300048916 Bacteria 1449
424 Ga0496114_0544986 3300048917 Bacteria 1025
425 Ga0496114_0702560 3300048917 Unclassified 887
426 Ga0501033_0117061 3300049570 Bacteria 1936
427 Ga0501034_0001614 3300049571 Bacteria 29290
428 Ga0501036_0026429 3300049572 Bacteria 4900
429 Ga0501036_0052796 3300049572 Bacteria 3443
430 Ga0501036_0457091 3300049572 Bacteria 1064
431 Ga0501037_0384706 3300049573 Unclassified 964
432 Ga0501039_0082902 3300049575 Bacteria 2497
433 Ga0501039_0180668 3300049575 Bacteria 1659
434 Ga0501039_0246502 3300049575 Bacteria 1405
435 Ga0501040_0061552 3300049576 Bacteria 2582
436 Ga0501041_0021830 3300049577 Bacteria 3835
437 Ga0501041_0109699 3300049577 Bacteria 1712
438 Ga0501041_0151459 3300049577 Bacteria 1448
439 Ga0501043_0273200 3300049579 Bacteria 1297
440 Ga0501047_0209696 3300049581 Bacteria 1807
441 Ga0501048_0072673 3300049582 Bacteria 2428
442 Ga0501048_0073428 3300049582 Bacteria 2414
443 Ga0501048_0209678 3300049582 Bacteria 1382
444 Ga0501048_0265045 3300049582 Bacteria 1221
445 Ga0501067_0020356 3300049583 Bacteria 3671
446 Ga0501067_0066226 3300049583 Bacteria 2000
447 Ga0501069_0321583 3300049585 Bacteria 909
448 Ga0501070_0776280 3300049586 Unclassified 754
449 Ga0501071_0023114 3300049587 Bacteria 4339
450 Ga0501071_0094123 3300049587 Bacteria 2203
451 Ga0501071_0126453 3300049587 Unclassified 1897
452 Ga0501071_0226020 3300049587 Unclassified 1409
453 Ga0501071_0526630 3300049587 Bacteria 907
454 Ga0501072_0013537 3300049588 Bacteria 6243
455 Ga0501072_0241238 3300049588 Unclassified 1439
456 Ga0501073_0003523 3300049589 Bacteria 11760
457 Ga0501074_0134858 3300049590 Bacteria 1766
458 Ga0501075_0012805 3300049591 Bacteria 5970
459 Ga0501075_0014199 3300049591 Bacteria 5707
460 Ga0501075_0039869 3300049591 Bacteria 3516
461 Ga0501076_0014418 3300049592 Bacteria 5953
462 Ga0501076_0031805 3300049592 Bacteria 4117
463 Ga0501076_0804701 3300049592 Unclassified 775
464 Ga0501079_0042170 3300049741 Bacteria 3525
465 Ga0501079_0247263 3300049741 Bacteria 1394
466 Ga0501079_0555324 3300049741 Bacteria 903
467 Ga0501080_0187391 3300049742 Bacteria 1902
468 Ga0501080_0544191 3300049742 Bacteria 1034
469 Ga0501081_0043093 3300049743 Bacteria 3095
470 Ga0501081_0046116 3300049743 Bacteria 2995
471 Ga0501083_0262280 3300049744 Bacteria 1124
472 Ga0501045_0032970 3300049824 Bacteria 3755
473 Ga0501045_0045220 3300049824 Bacteria 3206
474 Ga0501045_0205979 3300049824 Bacteria 1465
475 Ga0501045_0336321 3300049824 Bacteria 1124
476 Ga0501045_0715289 3300049824 Bacteria 739
477 nmdc:mga03683_20734_c1 3300050489 Bacteria 2526
478 nmdc:mga03n38_164324_c1 3300050490 Bacteria 1126
479 nmdc:mga00v17_123973_c1 3300050491 Unclassified 1647
480 nmdc:mga00v17_26716_c1 3300050491 Bacteria 3366
481 nmdc:mga00v17_4710_c1 3300050491 Bacteria 7128
482 nmdc:mga0yw44_44397_c1 3300050492 Bacteria 2658
483 nmdc:mga0yw44_5821_c1 3300050492 Bacteria 5880
484 nmdc:mga0k408_411246_c1 3300050493 Bacteria 805
485 nmdc:mga0k408_7994_c1 3300050493 Bacteria 5671
486 nmdc:mga06z11_2267_c1 3300050494 Bacteria 7319
487 nmdc:mga06z11_398448_c1 3300050494 Unclassified 828
488 nmdc:mga04h51_22198_c1 3300050495 Bacteria 1918
489 nmdc:mga07m45_35200_c1 3300050496 Bacteria 2785
490 nmdc:mga05p37_2107_c3 3300050507 Bacteria 21373
491 nmdc:mga05p37_23171_c1 3300050507 Bacteria 7533
492 nmdc:mga05p37_365850_c1 3300050507 Bacteria 1694
493 nmdc:mga05p37_859692_c1 3300050507 Unclassified 984
494 nmdc:mga06r32_166677_c1 3300050510 Bacteria 2186
495 nmdc:mga06r32_304935_c1 3300050510 Bacteria 1578
496 nmdc:mga06r32_333649_c1 3300050510 Bacteria 1501
497 nmdc:mga06r32_650732_c1 3300050510 Unclassified 1022
498 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
499 nmdc:mga08y16_15384_c1 3300050511 Bacteria 8046
500 nmdc:mga08y16_413944_c1 3300050511 Bacteria 1378
501 nmdc:mga08y16_42111_c1 3300050511 Bacteria 4783
502 nmdc:mga08y16_457924_c1 3300050511 Bacteria 1300
503 nmdc:mga08y16_46791_c1 3300050511 Bacteria 4529
504 nmdc:mga08y16_504_c1 3300050511 Bacteria 36040
505 nmdc:mga08y16_553286_c1 3300050511 Bacteria 1164
506 nmdc:mga08y16_833873_c1 3300050511 Bacteria 912
507 nmdc:mga0n895_10522_c1 3300050512 Bacteria 8181
508 nmdc:mga0n895_1452021_c1 3300050512 Unclassified 653
509 nmdc:mga0n895_230447_c1 3300050512 Unclassified 1880
510 nmdc:mga0n895_253976_c1 3300050512 Bacteria 1784
511 nmdc:mga0n895_305068_c1 3300050512 Bacteria 1614
512 nmdc:mga0n895_352058_c1 3300050512 Bacteria 1492
513 nmdc:mga0n895_840183_c1 3300050512 Bacteria 907
514 nmdc:mga0rr50_241035_c1 3300050513 Bacteria 1499
515 nmdc:mga0rr50_522648_c1 3300050513 Unclassified 1010
516 nmdc:mga0rr50_75639_c1 3300050513 Bacteria 2582
517 nmdc:mga0a205_106639_c1 3300050515 Bacteria 2700
518 nmdc:mga0a205_121162_c1 3300050515 Bacteria 2515
519 nmdc:mga0a205_142168_c1 3300050515 Bacteria 2300
520 nmdc:mga0a205_63715_c1 3300050515 Bacteria 3561
521 nmdc:mga0sz30_25710_c1 3300050516 Bacteria 2408
522 Ga0495595_0092087 3300053084 Bacteria 1455
523 Ga0495619_0366294 3300053085 Bacteria 996
524 Ga0500646_0021345 3300053090 Bacteria 1725
525 Ga0500628_029297 3300053129 Bacteria 1182
526 Ga0500652_090000 3300053131 Unclassified 1281
527 Ga0501084_0018536 3300054114 Bacteria 5793
528 Ga0501084_0615021 3300054114 Unclassified 918
529 Ga0590071_000685 3300059421 Bacteria 9608
530 Ga0590071_013115 3300059421 Bacteria 1942
531 Ga0590075_000348 3300059424 Bacteria 12914
532 Ga0590077_000756 3300059426 Bacteria 8468
533 Ga0501082_0134351 3300060353 Bacteria 2146
534 Ga0501082_0546192 3300060353 Bacteria 1013
535 Ga0530510_0049455 3300061734 Bacteria 3038
536 Ga0105238_10755963
537 Ga0065712_10002619
538 Ga0065712_10112318
539 Ga0065712_10317043
540 Ga0065715_10018429
541 Ga0065715_10097585
542 Ga0065715_10154316
543 Ga0065715_10202184
544 Ga0065715_10283236
545 Ga0065707_10002935
546 Ga0065707_10114178
547 Ga0065707_10145516
548 Ga0065707_10397455
549 Ga0070658_10188679
550 Ga0070676_10028753
551 Ga0070676_10053472
552 Ga0070683_100086185
553 Ga0070690_100019138
554 Ga0070670_100013699
555 Ga0070670_100023819
556 Ga0070670_100144660
557 Ga0070670_100193329
558 Ga0070677_10123467
559 Ga0070677_10220866
560 Ga0068869_100049354
561 Ga0068869_100083017
562 Ga0068869_100246271
563 Ga0070666_10047510
564 Ga0070680_100044316
565 Ga0070682_100443072
566 Ga0068868_100062110
567 Ga0070689_100039302
568 Ga0070689_100997082
569 Ga0070691_10025596
570 Ga0070687_100123098
571 Ga0070687_100537898
572 Ga0070661_100021350
573 Ga0070692_10029084
574 Ga0070668_100005545
575 Ga0070669_100025522
576 Ga0070675_100222314
577 Ga0070675_100640074
578 Ga0070675_100777513
579 Ga0070671_100202840
580 Ga0070674_100049731
581 Ga0070674_100198478
582 Ga0070674_100337625
583 Ga0070673_100034852
584 Ga0070673_100223534
585 Ga0070673_100312650
586 Ga0070673_100345898
587 Ga0070673_100483559
588 Ga0070688_100020716
589 Ga0070688_100053447
590 Ga0070688_100223070
591 Ga0070688_100347336
592 Ga0070659_100047831
593 Ga0070659_100265501
594 Ga0070659_100396721
595 Ga0070659_101079130
596 Ga0070667_100190076
597 Ga0070667_100375559
598 Ga0070701_10010253
599 Ga0070701_10020810
600 Ga0070701_10174201
601 Ga0070701_10326874
602 Ga0070711_100215273
603 Ga0070700_100043722
604 Ga0070663_100115274
605 Ga0070663_100277849
606 Ga0070663_100847532
607 Ga0070678_100010948
608 Ga0070678_100117354
609 Ga0070662_100023264
610 Ga0070662_100042946
611 Ga0070662_100560632
612 Ga0070681_10141241
613 Ga0070681_10160798
614 Ga0068867_100034734
615 Ga0068867_100346688
616 Ga0070706_100304782
617 Ga0070707_100095763
618 Ga0070698_100315432
619 Ga0070679_100085984
620 Ga0070684_100000213
621 Ga0070684_100021090
622 Ga0070672_100260643
623 Ga0070672_100491436
624 Ga0070686_100030771
625 Ga0070695_100458497
626 Ga0070693_100018762
627 Ga0070693_100048812
628 Ga0070693_100345193
629 Ga0070704_100019929
630 Ga0070704_100083332
631 Ga0070704_100105787
632 Ga0068855_100197821
633 Ga0068855_100367469
634 Ga0070664_100003485
635 Ga0070664_100251768
636 Ga0070664_100563693
637 Ga0070664_100869639
638 Ga0068857_100115181
639 Ga0068857_100145826
640 Ga0068854_100072781
641 Ga0068856_100358811
642 Ga0070702_100020751
643 Ga0068852_100027261
644 Ga0068852_100385947
645 Ga0068859_100105083
646 Ga0068859_100460888
647 Ga0068859_100952348
648 Ga0068864_100235982
649 Ga0068864_100394559
650 Ga0068866_10096221
651 Ga0068861_100017062
652 Ga0068861_100130224
653 Ga0068861_100513805
654 Ga0068861_100676883
655 Ga0068861_101107645
656 Ga0068858_100042644
657 Ga0068858_100188574
658 Ga0068860_100169730
659 Ga0068862_100016570
660 Ga0068862_100023828
661 Ga0068862_100522120
662 Ga0075365_10007126
663 Ga0075365_10047716
664 Ga0075368_10003124
665 Ga0075364_10011584
666 Ga0075367_10003066
667 Ga0075367_10442936
668 Ga0075369_10100541
669 Ga0075366_10007177
670 Ga0075366_10355114
671 Ga0097621_100028109
672 Ga0097621_100812541
673 Ga0075370_10033912
674 Ga0068871_100607659
675 Ga0068871_100790291
676 Ga0075428_100006187
677 Ga0075431_100142913
678 Ga0075431_100494938
679 Ga0075433_10112240
680 Ga0075434_100001737
681 Ga0075434_100196888
682 Ga0075434_100278027
683 Ga0075434_100328886
684 Ga0075434_100413990
685 Ga0075434_100658306
686 Ga0075429_100051387
687 Ga0075429_100497814
688 Ga0068865_100095685
689 Ga0068865_100245525
690 Ga0068865_100297874
691 Ga0097620_100105077
692 Ga0097620_100302895
693 Ga0097620_100460846
694 Ga0097620_100952268
695 Ga0075435_100001458
696 Ga0075435_100030576
697 Ga0075435_100096310
698 Ga0075435_100539614
699 Ga0105240_10278604
700 Ga0105240_10940545
701 Ga0111539_10000512
702 Ga0111539_10001914
703 Ga0111539_10009801
704 Ga0111539_10125663
705 Ga0111539_10192331
706 Ga0111539_10195219
707 Ga0111539_10627154
708 Ga0111539_10805781
709 Ga0111539_10900625
710 Ga0111539_11422240
711 Ga0111539_11734897
712 Ga0105245_10315143
713 Ga0105245_11473898
714 Ga0114129_10007864
715 Ga0114129_10044141
716 Ga0114129_10048827
717 Ga0114129_10380665
718 Ga0114129_10458172
719 Ga0114129_11274450
720 Ga0105243_10009828
721 Ga0105241_10117423
722 Ga0105242_10177626
723 Ga0105242_10332953
724 Ga0105242_10343296
725 Ga0105242_10443131
726 Ga0105248_10004840
727 Ga0105248_10033622
728 Ga0105248_10199785
729 Ga0105248_10210289
730 Ga0105248_10836044
731 Ga0105238_10380557
732 Ga0105249_10028686
733 Ga0105249_10263133
734 Ga0105249_10329213
735 Ga0105239_10114307
736 Ga0105246_11320867
737 Ga0157370_10366137
738 Ga0157374_10216644
739 Ga0157378_10257850
740 Ga0157378_11838241
741 Ga0163162_10236445
742 Ga0157375_11256666
743 Ga0157380_10012408
744 Ga0157380_10028867
745 Ga0157380_10136255
746 Ga0157380_10267614
747 Ga0157380_10700138
748 Ga0157380_10754838
749 Ga0157380_11154145
750 Ga0157377_10142010
751 Ga0157376_10052778
752 Ga0157376_10535494
753 Ga0207666_1017999
754 Ga0207697_10048968
755 Ga0207653_10012507
756 Ga0207682_10040786
757 Ga0207682_10156975
758 Ga0207642_10074523
759 Ga0207688_10094660
760 Ga0207680_10072653
761 Ga0207647_10026527
762 Ga0207645_10004801
763 Ga0207645_10095662
764 Ga0207645_10144081
765 Ga0207643_10461625
766 Ga0207684_10217008
767 Ga0207684_10502344
768 Ga0207654_10062896
769 Ga0207707_10035269
770 Ga0207707_10232195
771 Ga0207695_10107454
772 Ga0207663_10144579
773 Ga0207660_10671897
774 Ga0207662_10019837
775 Ga0207657_10174048
776 Ga0207649_10005774
777 Ga0207652_10057453
778 Ga0207681_10030196
779 Ga0207681_10073425
780 Ga0207681_10124983
781 Ga0207681_10127065
782 Ga0207681_10796462
783 Ga0207694_10236296
784 Ga0207694_10608786
785 Ga0207650_10002558
786 Ga0207650_10052308
787 Ga0207650_10055778
788 Ga0207650_10112252
789 Ga0207659_10229685
790 Ga0207659_10670849
791 Ga0207700_10018642
792 Ga0207700_10793400
793 Ga0207644_10068704
794 Ga0207644_10155998
795 Ga0207690_10142835
796 Ga0207690_10250313
797 Ga0207690_10267609
798 Ga0207690_10314693
799 Ga0207706_10025340
800 Ga0207706_10045161
801 Ga0207706_10358046
802 Ga0207686_10040858
803 Ga0207709_10041775
804 Ga0207670_10059839
805 Ga0207669_10010037
806 Ga0207669_10018356
807 Ga0207669_10054679
808 Ga0207669_10301580
809 Ga0207704_10069821
810 Ga0207691_10194892
811 Ga0207691_10273269
812 Ga0207691_10485989
813 Ga0207711_10048716
814 Ga0207711_10343976
815 Ga0207711_10512701
816 Ga0207711_10639480
817 Ga0207689_10083290
818 Ga0207689_10087572
819 Ga0207661_10001430
820 Ga0207661_10002652
821 Ga0207679_10006989
822 Ga0207679_10159812
823 Ga0207679_10217763
824 Ga0207667_10097614
825 Ga0207667_10648305
826 Ga0207651_10038744
827 Ga0207651_10184824
828 Ga0207651_10349985
829 Ga0207712_10030890
830 Ga0207712_10216944
831 Ga0207668_10134823
832 Ga0207668_10153312
833 Ga0207640_10226376
834 Ga0207677_10027982
835 Ga0207677_10143333
836 Ga0207703_10154777
837 Ga0207703_10184687
838 Ga0207678_10123974
839 Ga0207708_10001820
840 Ga0207708_10040703
841 Ga0207708_10061138
842 Ga0207708_10074839
843 Ga0207708_10075078
844 Ga0207641_10210148
845 Ga0207641_10859035
846 Ga0207648_10000959
847 Ga0207648_10248001
848 Ga0207676_10049985
849 Ga0207674_10142992
850 Ga0207674_10149511
851 Ga0207675_100021012
852 Ga0207675_100041107
853 Ga0207675_100058891
854 Ga0207675_100213852
855 Ga0207675_100595574
856 Ga0207675_100647230
857 Ga0207675_101122487
858 Ga0207683_10015366
859 Ga0207683_10238190
860 Ga0207683_10551791
861 Ga0207683_10803172
862 Ga0207698_10414892
863 Ga0207698_11038178
864 Ga0209983_1016753
865 Ga0209813_10026655
866 Ga0207428_10000574
867 Ga0207428_10000658
868 Ga0207428_10020157
869 Ga0207428_10027003
870 Ga0207428_10262144
871 Ga0268265_10016262
872 Ga0268265_10029346
873 Ga0268265_10253192
874 Ga0268265_10261287
875 Ga0268265_10262261
876 Ga0268264_10189786
877 Ga0268264_10241461
878 Ga0307408_100063720
879 Ga0307408_101041518
880 Ga0307405_10006363
881 Ga0307405_10496745
882 Ga0307410_10007286
883 Ga0307410_10061361
884 Ga0307410_10228013
885 Ga0307406_10834899
886 Ga0307409_100072275
887 Ga0307409_100538395
888 Ga0307416_100029325
889 Ga0307416_100068319
890 Ga0307416_100233377
891 Ga0307416_100397650
892 Ga0307416_100564764
893 Ga0307416_101805867
894 Ga0307414_10270413
895 Ga0307411_10102883
896 Ga0307411_10129057
897 Ga0307411_10193844
898 Ga0307411_10194446
899 Ga0373938_0073997
900 Ga0373940_0073249
901 Ga0373936_0281824
902 Ga0373939_0028886
903 Ga0373945_0093038
904 Ga0373960_0030610
905 Ga0373943_0048756
906 Ga0373955_0442476
907 Ga0373942_0006218
908 Ga0373924_0087018
909 Ga0373927_0133554
910 Ga0373937_0001942
911 Ga0373925_0012122
912 Ga0395905_0282231
913 Ga0451789_1281983
914 Ga0451800_0974527
915 Ga0451853_0228372
916 Ga0451853_0573528
917 Ga0439433_0018173
918 Ga0450894_012701
919 Ga0439446_0180376
920 Ga0439435_0003763
921 Ga0451577_0046462
922 Ga0451577_0541077
923 Ga0453684_0016537
924 Ga0453684_0664494
925 Ga0466957_0500715
926 Ga0466959_0195915
927 Ga0451576_0595731
928 Ga0466967_0266701
929 Ga0466967_0271806
930 Ga0495662_0044246
931 Ga0495628_0347348
932 Ga0495628_0494320
933 Ga0495630_0221894
934 Ga0495598_0087526
935 Ga0495621_0079561
936 Ga0495667_0217781
937 Ga0495599_0110315
938 Ga0495599_0354825
939 Ga0495613_0071535
940 Ga0495686_0212747
941 Ga0496102_0934982
942 Ga0496104_0003311
943 Ga0496106_0208517
944 Ga0496108_0012914
945 Ga0496109_0003151
946 Ga0496109_0511993
947 Ga0496109_0570499
948 Ga0496109_0580127
949 Ga0496110_0009805
950 Ga0496110_0232016
951 Ga0496110_0268287
952 Ga0496110_0352288
953 Ga0496111_0544357
954 Ga0496112_0000717
955 Ga0496112_0189779
956 Ga0496112_0283239
957 Ga0496112_0636185
958 Ga0496113_0239117
959 Ga0496114_0544986
960 Ga0496114_0702560
961 Ga0501033_0117061
962 Ga0501034_0001614
963 Ga0501036_0026429
964 Ga0501036_0052796
965 Ga0501036_0457091
966 Ga0501037_0384706
967 Ga0501039_0082902
968 Ga0501039_0180668
969 Ga0501039_0246502
970 Ga0501040_0061552
971 Ga0501041_0021830
972 Ga0501041_0109699
973 Ga0501041_0151459
974 Ga0501043_0273200
975 Ga0501047_0209696
976 Ga0501048_0072673
977 Ga0501048_0073428
978 Ga0501048_0209678
979 Ga0501048_0265045
980 Ga0501067_0020356
981 Ga0501067_0066226
982 Ga0501069_0321583
983 Ga0501070_0776280
984 Ga0501071_0023114
985 Ga0501071_0094123
986 Ga0501071_0126453
987 Ga0501071_0226020
988 Ga0501071_0526630
989 Ga0501072_0013537
990 Ga0501072_0241238
991 Ga0501073_0003523
992 Ga0501074_0134858
993 Ga0501075_0012805
994 Ga0501075_0014199
995 Ga0501075_0039869
996 Ga0501076_0014418
997 Ga0501076_0031805
998 Ga0501076_0804701
999 Ga0501079_0042170
1000 Ga0501079_0247263
1001 Ga0501079_0555324
1002 Ga0501080_0187391
1003 Ga0501080_0544191
1004 Ga0501081_0043093
1005 Ga0501081_0046116
1006 Ga0501083_0262280
1007 Ga0501045_0032970
1008 Ga0501045_0045220
1009 Ga0501045_0205979
1010 Ga0501045_0336321
1011 Ga0501045_0715289
1012 nmdc:mga03683_20734_c1
1013 nmdc:mga03n38_164324_c1
1014 nmdc:mga00v17_123973_c1
1015 nmdc:mga00v17_26716_c1
1016 nmdc:mga00v17_4710_c1
1017 nmdc:mga0yw44_44397_c1
1018 nmdc:mga0yw44_5821_c1
1019 nmdc:mga0k408_411246_c1
1020 nmdc:mga0k408_7994_c1
1021 nmdc:mga06z11_2267_c1
1022 nmdc:mga06z11_398448_c1
1023 nmdc:mga04h51_22198_c1
1024 nmdc:mga07m45_35200_c1
1025 nmdc:mga05p37_2107_c3
1026 nmdc:mga05p37_23171_c1
1027 nmdc:mga05p37_365850_c1
1028 nmdc:mga05p37_859692_c1
1029 nmdc:mga06r32_166677_c1
1030 nmdc:mga06r32_304935_c1
1031 nmdc:mga06r32_333649_c1
1032 nmdc:mga06r32_650732_c1
1033 nmdc:mga08y16_10_c1
1034 nmdc:mga08y16_15384_c1
1035 nmdc:mga08y16_413944_c1
1036 nmdc:mga08y16_42111_c1
1037 nmdc:mga08y16_457924_c1
1038 nmdc:mga08y16_46791_c1
1039 nmdc:mga08y16_504_c1
1040 nmdc:mga08y16_553286_c1
1041 nmdc:mga08y16_833873_c1
1042 nmdc:mga0n895_10522_c1
1043 nmdc:mga0n895_1452021_c1
1044 nmdc:mga0n895_230447_c1
1045 nmdc:mga0n895_253976_c1
1046 nmdc:mga0n895_305068_c1
1047 nmdc:mga0n895_352058_c1
1048 nmdc:mga0n895_840183_c1
1049 nmdc:mga0rr50_241035_c1
1050 nmdc:mga0rr50_522648_c1
1051 nmdc:mga0rr50_75639_c1
1052 nmdc:mga0a205_106639_c1
1053 nmdc:mga0a205_121162_c1
1054 nmdc:mga0a205_142168_c1
1055 nmdc:mga0a205_63715_c1
1056 nmdc:mga0sz30_25710_c1
1057 Ga0495595_0092087
1058 Ga0495619_0366294
1059 Ga0500646_0021345
1060 Ga0500628_029297
1061 Ga0500652_090000
1062 Ga0501084_0018536
1063 Ga0501084_0615021
1064 Ga0590071_000685
1065 Ga0590071_013115
1066 Ga0590075_000348
1067 Ga0590077_000756
1068 Ga0501082_0134351
1069 Ga0501082_0546192
1070 Ga0530510_0049455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04367

DUF502

Protein of unknown function (DUF502)

56

159

0.91

Map