metagRoot

F460638

General Info

Members	Datasets	Scaffolds	Average Seq Length
535	257	491	216

Family's Representative Sequence

Representative Sequence	3300006195\|Ga0075366_10002475\|Ga0075366_100024757
Length	243
Sequence	MERKRRGEIKPTRSNSSNRWMHEHVTDPYVHEAKRLGYRSRSAFKILEIDQKCKLLKPGMTVVDLGAAPGGWSQMVSPKVGAPGGDVAPKTGAEASKSSGKSRKGRVIAIDLLEMQGLAGVEFIQADFSTDEGLALVTATLGKDHKADLVMSDMAPNISGIGISDQAKSMYLCELALDFAAGFLQPNGAFVVKTFQGVGFTEFFQSMKTTFKEVKSVKPKASRDRSTEIYLVGQGLRASTQRG

Samples

	Sample ID	Description	Type	Environment
1	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
2	2547132103	Chromobacterium sp. C-61	Isolate	Rhizosphere
3	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
4	2574179768	Azoarcus communis DSM 12120	Isolate	Unclassified
5	2600255292	Janthinobacterium lividum NFR18	Isolate	Rhizoplane
6	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
7	2738541297	Duganella sp. GV083	Isolate	Unclassified
8	2738541357	Duganella sp. GV053	Isolate	Unclassified
9	2738543003	Duganella sp. GV066	Isolate	Unclassified
10	2738543026	Duganella sp. GV089	Isolate	Unclassified
11	2738543029	Duganella sp. GV039	Isolate	Unclassified
12	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
13	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
14	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
15	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
16	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
17	2842711865	Duganella sp. R-73148	Isolate	Unclassified
18	2843690924	Chromobacterium rhizoryzae JP2-74	Isolate	Rhizosphere
19	2846033681	Chromobacterium sinusclupearum MWU13-2610	Isolate	Rhizosphere
20	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
21	2857547612	Janthinobacterium sp. R-74502	Isolate	Unclassified
22	2857553236	Duganella sp. R-74557	Isolate	Unclassified
23	2857558681	Duganella sp. R-74565	Isolate	Unclassified
24	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
25	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
26	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
27	2885080285	Janthinobacterium sp. AD80	Isolate	Rhizosphere
28	2891633521	Azoarcus rhizosphaerae CC-YHH848	Isolate	Rhizosphere
29	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
30	2904424332	Duganella sp. 1411	Isolate	Rhizosphere
31	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
32	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
33	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
34	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
35	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
36	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
37	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
38	2919476304	Duganella sp. 3397	Isolate	Unclassified
39	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
40	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
41	2932410948	Janthinobacterium lividum 2829	Isolate	Rhizosphere
42	2932416698	Janthinobacterium lividum 2830	Isolate	Rhizosphere
43	2998344455	Vogesella urethralis SLBN-145	Isolate	Rhizosphere
44	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
45	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
46	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
47	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
48	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
49	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
50	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
51	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
52	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
53	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
54	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
55	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
56	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
57	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
58	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
59	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
60	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
61	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
62	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
63	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
64	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
65	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
66	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
67	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
68	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
69	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
70	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
71	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
72	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
73	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
74	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
75	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
76	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
77	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
78	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
79	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
80	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
81	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
84	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
85	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
86	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
87	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
88	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
89	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
90	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
91	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
92	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
93	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
94	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
95	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
110	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
111	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
112	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
113	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
114	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
115	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
116	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
117	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
118	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
119	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
120	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
121	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
122	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
123	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
124	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
125	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
126	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
127	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
128	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
129	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
130	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
131	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
132	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
133	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
134	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
135	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
136	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
137	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
138	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
139	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
140	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
141	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
142	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
143	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
144	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
145	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
146	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
147	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
148	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
149	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
150	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
151	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
152	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
153	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
154	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
155	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
156	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
157	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
158	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
159	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
160	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
161	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
162	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
163	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
164	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
165	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
166	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
167	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
168	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
169	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
170	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
171	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
172	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
173	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
174	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
175	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
176	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
177	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
178	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
179	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
180	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
181	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
182	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
183	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
184	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
185	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
186	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
187	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
188	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
189	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
190	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
191	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
192	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
193	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
194	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
195	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
196	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
197	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
198	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
199	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
200	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
201	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
202	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
203	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
204	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
205	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
206	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
207	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
208	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
209	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
210	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
211	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
212	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
213	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
214	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
215	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
216	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
217	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
218	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
219	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
220	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
221	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
222	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
223	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
224	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
225	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
226	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
227	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
228	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
229	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
230	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
231	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
232	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
233	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
234	3300049766	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought	Metagenome	Rhizosphere
235	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
236	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
238	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
239	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
240	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
241	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
242	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
243	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
244	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
245	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
246	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
247	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
248	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
249	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
250	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
251	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
252	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
253	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
254	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
255	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
256	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
257	639633007	Azoarcus olearius BH72	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	91.78
Metatranscriptomes	0
Isolates	8.22

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	7.48
Nodule	0.75
Rhizoplane	4.49
Rhizosphere	77.76
Stem	0
Stem Tuber	0
Unclassified	9.53

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25155J39150_1000275	3300002704	Bacteria	18778
2	JGI25156J39149_1002838	3300002705	Bacteria	5959
3	JGI25154J39366_1001607	3300002738	Bacteria	7679
4	rootH2_10024853	3300003320	Bacteria	1002
5	Ga0055525_1000047	3300003759	Bacteria	261507
6	Ga0055529_1000125	3300003763	Bacteria	110810
7	Ga0065165_1019953	3300005262	Bacteria	2377
8	Ga0065714_10083160	3300005288	Bacteria	2265
9	Ga0070658_10273733	3300005327	Bacteria	1436
10	Ga0070682_100438685	3300005337	Bacteria	997
11	Ga0070660_100056401	3300005339	Bacteria	3039
12	Ga0070660_100161031	3300005339	Bacteria	1808
13	Ga0070660_100606578	3300005339	Bacteria	915
14	Ga0070661_100235102	3300005344	Bacteria	1409
15	Ga0070661_100488205	3300005344	Bacteria	984
16	Ga0070668_100278488	3300005347	Bacteria	1396
17	Ga0070659_100267538	3300005366	Bacteria	1419
18	Ga0070667_100347981	3300005367	Bacteria	1341
19	Ga0070714_100003989	3300005435	Bacteria	11096
20	Ga0070662_100296908	3300005457	Bacteria	1311
21	Ga0068855_100000037	3300005563	Bacteria	158161
22	Ga0070664_100594956	3300005564	Bacteria	1025
23	Ga0068857_100200958	3300005577	Bacteria	1817
24	Ga0068866_10089364	3300005718	Bacteria	1674
25	Ga0068858_100165715	3300005842	Bacteria	2082
26	Ga0081539_10003666	3300005985	Bacteria	18444
27	Ga0075365_10007553	3300006038	Bacteria	6102
28	Ga0075365_10041245	3300006038	Bacteria	3015
29	Ga0075368_10002260	3300006042	Bacteria	6260
30	Ga0075363_100003613	3300006048	Bacteria	6626
31	Ga0075364_10005797	3300006051	Bacteria	7207
32	Ga0070716_100072557	3300006173	Bacteria	2027
33	Ga0075362_10008887	3300006177	Bacteria	3862
34	Ga0075367_10002015	3300006178	Bacteria	9068
35	Ga0075369_10011342	3300006186	Bacteria	3505
36	Ga0075369_10026560	3300006186	Bacteria	2414
37	Ga0075366_10002475	3300006195	Bacteria	9465
38	Ga0075366_10111227	3300006195	Bacteria	1647
39	Ga0075370_10033429	3300006353	Bacteria	2880
40	Ga0075370_10266106	3300006353	Bacteria	1017
41	Ga0079104_1003020	3300006946	Bacteria	8261
42	Ga0105244_10023223	3300009036	Bacteria	3402
43	Ga0105244_10083964	3300009036	Bacteria	1573
44	Ga0105240_10190525	3300009093	Bacteria	2412
45	Ga0105240_10227932	3300009093	Bacteria	2167
46	Ga0105243_10018177	3300009148	Bacteria	5322
47	Ga0105237_10122054	3300009545	Bacteria	2600
48	Ga0105237_11000262	3300009545	Bacteria	843
49	Ga0105239_10492733	3300010375	Bacteria	1393
50	Ga0105246_10579956	3300011119	Bacteria	966
51	Ga0157371_10000013	3300013102	Bacteria	352631
52	Ga0157371_10380919	3300013102	Bacteria	1030
53	Ga0157370_10001049	3300013104	Bacteria	34805
54	Ga0157370_10224539	3300013104	Bacteria	1739
55	Ga0157370_10620573	3300013104	Bacteria	989
56	Ga0157374_10181849	3300013296	Bacteria	2054
57	Ga0157378_10050117	3300013297	Bacteria	3715
58	Ga0157372_10434256	3300013307	Bacteria	1531
59	Ga0157372_10491272	3300013307	Bacteria	1431
60	Ga0182008_10016736	3300014497	Bacteria	3805
61	Ga0182008_10400130	3300014497	Bacteria	737
62	Ga0182006_1000035	3300015261	Bacteria	232349
63	Ga0182006_1000096	3300015261	Bacteria	104597
64	Ga0182006_1022210	3300015261	Bacteria	2639
65	Ga0182007_10000040	3300015262	Bacteria	120364
66	Ga0182005_1000013	3300015265	Bacteria	396391
67	Ga0182005_1000025	3300015265	Bacteria	235532
68	Ga0163161_10048114	3300017792	Bacteria	3079
69	Ga0163161_10211355	3300017792	Bacteria	1499
70	Ga0213872_10000020	3300021361	Bacteria	159607
71	Ga0213872_10019675	3300021361	Bacteria	3109
72	Ga0209437_108904	3300025233	Bacteria	1587
73	Ga0209455_1000044	3300025272	Bacteria	410787
74	Ga0207705_10078474	3300025909	Bacteria	2403
75	Ga0207657_10091544	3300025919	Bacteria	2536
76	Ga0207657_10453933	3300025919	Bacteria	1006
77	Ga0207657_10522609	3300025919	Bacteria	929
78	Ga0207649_10100132	3300025920	Bacteria	1916
79	Ga0207690_10039891	3300025932	Bacteria	3066
80	Ga0207690_10210151	3300025932	Bacteria	1483
81	Ga0207706_10474013	3300025933	Bacteria	1082
82	Ga0207686_10187850	3300025934	Bacteria	1470
83	Ga0207709_10025077	3300025935	Bacteria	3411
84	Ga0207679_10040399	3300025945	Bacteria	3339
85	Ga0207667_10000053	3300025949	Bacteria	226712
86	Ga0207658_10087973	3300025986	Bacteria	2400
87	Ga0207703_10277411	3300026035	Bacteria	1521
88	Ga0207674_10106065	3300026116	Bacteria	2788
89	Ga0209281_1007059	3300027111	Bacteria	2846
90	Ga0307511_10001014	3300030521	Bacteria	29824
91	Ga0316181_1218544	3300030744	Bacteria	3290
92	Ga0316182_1199092	3300030745	Bacteria	1605
93	Ga0265328_10000005	3300031239	Bacteria	230229
94	Ga0265328_10001363	3300031239	Bacteria	11272
95	Ga0265328_10011926	3300031239	Bacteria	3465
96	Ga0265331_10000070	3300031250	Bacteria	152331
97	Ga0265331_10001058	3300031250	Bacteria	21454
98	Ga0265327_10000156	3300031251	Bacteria	146362
99	Ga0265327_10000472	3300031251	Bacteria	71196
100	Ga0265327_10018727	3300031251	Bacteria	4279
101	Ga0307408_100000294	3300031548	Bacteria	48528
102	Ga0307507_10059523	3300033179	Bacteria	3575
103	Ga0395899_0005514	3300037312	Bacteria	9803
104	Ga0395899_0208194	3300037312	Bacteria	1360
105	Ga0395899_0227147	3300037312	Bacteria	1290
106	Ga0395900_0000331	3300037418	Bacteria	69780
107	Ga0395900_0039845	3300037418	Bacteria	4841
108	Ga0395900_0116900	3300037418	Bacteria	2736
109	Ga0395900_0342376	3300037418	Bacteria	1470
110	Ga0395900_0376926	3300037418	Bacteria	1387
111	Ga0395900_0424199	3300037418	Bacteria	1290
112	Ga0395900_0703921	3300037418	Bacteria	943
113	Ga0395898_0093570	3300037466	Bacteria	2888
114	Ga0395898_0339473	3300037466	Bacteria	1432
115	Ga0395905_0403751	3300037471	Bacteria	1261
116	Ga0395901_0000097	3300038443	Bacteria	118528
117	Ga0395901_0028671	3300038443	Bacteria	5726
118	Ga0395901_0706435	3300038443	Bacteria	1005
119	Ga0436361_0314818	3300039447	Bacteria	1557
120	Ga0436361_0498733	3300039447	Bacteria	3114
121	Ga0436361_0594223	3300039447	Bacteria	49801
122	Ga0436361_0922237	3300039447	Bacteria	22454
123	Ga0451804_0636132	3300041463	Bacteria	772
124	Ga0439448_0020276	3300042005	Bacteria	2055
125	Ga0439448_0091997	3300042005	Bacteria	1025
126	Ga0439455_0111585	3300042012	Bacteria	761
127	Ga0439458_0004250	3300042157	Bacteria	3305
128	Ga0451577_0045277	3300042876	Bacteria	3938
129	Ga0466969_0006928	3300044656	Bacteria	6031
130	Ga0466969_0045626	3300044656	Bacteria	2175
131	Ga0453683_0076793	3300044673	Bacteria	2092
132	Ga0466965_0067998	3300044683	Bacteria	1788
133	Ga0453684_0000005	3300044712	Bacteria	1431632
134	Ga0453684_0000163	3300044712	Bacteria	296196
135	Ga0453684_0000386	3300044712	Bacteria	180948
136	Ga0466971_0082169	3300044719	Bacteria	1470
137	Ga0466968_0169739	3300044735	Bacteria	1010
138	Ga0466957_0317123	3300044842	Bacteria	1051
139	Ga0466960_0056664	3300044901	Bacteria	1909
140	Ga0451576_0001961	3300045051	Bacteria	32770
141	Ga0451576_0058004	3300045051	Bacteria	4047
142	Ga0451576_0103062	3300045051	Bacteria	2968
143	Ga0451576_0929813	3300045051	Unclassified	912
144	Ga0466958_0348328	3300045836	Bacteria	953
145	Ga0466958_0416343	3300045836	Bacteria	868
146	Ga0466967_0307423	3300045976	Bacteria	1526
147	Ga0495617_000004	3300046452	Bacteria	511274
148	Ga0495617_000009	3300046452	Bacteria	312936
149	Ga0495617_018168	3300046452	Bacteria	2377
150	Ga0495617_031790	3300046452	Bacteria	1771
151	Ga0495627_000008	3300046453	Bacteria	572150
152	Ga0495627_006670	3300046453	Bacteria	4497
153	Ga0495627_023646	3300046453	Bacteria	2010
154	Ga0495603_0052996	3300046455	Bacteria	2407
155	Ga0495590_0013563	3300046457	Bacteria	2992
156	Ga0495629_0006506	3300046459	Bacteria	8656
157	Ga0495638_0137311	3300046460	Bacteria	1430
158	Ga0495650_0000011	3300046471	Bacteria	615329
159	Ga0495650_0000494	3300046471	Bacteria	59876
160	Ga0495650_0000593	3300046471	Bacteria	50088
161	Ga0495650_0028439	3300046471	Bacteria	2566
162	Ga0495582_0021333	3300046473	Bacteria	3545
163	Ga0495605_0000024	3300046474	Bacteria	236016
164	Ga0495605_0015140	3300046474	Bacteria	4203
165	Ga0495605_0047984	3300046474	Bacteria	2092
166	Ga0495605_0066053	3300046474	Bacteria	1719
167	Ga0495605_0077298	3300046474	Bacteria	1561
168	Ga0495584_0004700	3300046491	Bacteria	7312
169	Ga0495584_0018909	3300046491	Bacteria	3500
170	Ga0495584_0026934	3300046491	Bacteria	2913
171	Ga0495584_0057393	3300046491	Bacteria	1958
172	Ga0495584_0149034	3300046491	Bacteria	1188
173	Ga0495584_0176680	3300046491	Bacteria	1085
174	Ga0495584_0201995	3300046491	Bacteria	1010
175	Ga0495585_0017853	3300046492	Bacteria	4095
176	Ga0495585_0021109	3300046492	Bacteria	3740
177	Ga0495585_0029443	3300046492	Bacteria	3125
178	Ga0495585_0032805	3300046492	Bacteria	2940
179	Ga0495585_0055498	3300046492	Bacteria	2188
180	Ga0495585_0158847	3300046492	Bacteria	1174
181	Ga0495594_0011814	3300046499	Bacteria	4541
182	Ga0495596_0011263	3300046500	Bacteria	3863
183	Ga0495596_0011276	3300046500	Bacteria	3861
184	Ga0495596_0032096	3300046500	Bacteria	2095
185	Ga0495607_0006535	3300046501	Bacteria	8196
186	Ga0495607_0036400	3300046501	Bacteria	2965
187	Ga0495607_0038773	3300046501	Bacteria	2851
188	Ga0495607_0044902	3300046501	Bacteria	2602
189	Ga0495607_0079132	3300046501	Bacteria	1811
190	Ga0495607_0158591	3300046501	Bacteria	1151
191	Ga0495607_0183740	3300046501	Bacteria	1046
192	Ga0495583_0003595	3300046506	Bacteria	11632
193	Ga0495583_0014453	3300046506	Bacteria	4355
194	Ga0495583_0016161	3300046506	Bacteria	4023
195	Ga0495583_0017569	3300046506	Bacteria	3793
196	Ga0495583_0019334	3300046506	Bacteria	3558
197	Ga0495583_0024000	3300046506	Bacteria	3073
198	Ga0495583_0153247	3300046506	Bacteria	954
199	Ga0495583_0158597	3300046506	Bacteria	934
200	Ga0495583_0212173	3300046506	Bacteria	784
201	Ga0495606_0000927	3300046507	Bacteria	43195
202	Ga0495606_0043133	3300046507	Bacteria	3011
203	Ga0495606_0068443	3300046507	Bacteria	2246
204	Ga0495606_0143644	3300046507	Bacteria	1407
205	Ga0495606_0215008	3300046507	Bacteria	1086
206	Ga0495610_0091031	3300046512	Bacteria	1382
207	Ga0495610_0168228	3300046512	Bacteria	921
208	Ga0495610_0211781	3300046512	Bacteria	787
209	Ga0495616_0000567	3300046513	Bacteria	27995
210	Ga0495616_0005459	3300046513	Bacteria	7820
211	Ga0495616_0016582	3300046513	Bacteria	4074
212	Ga0495616_0019296	3300046513	Bacteria	3722
213	Ga0495616_0021514	3300046513	Bacteria	3492
214	Ga0495616_0027344	3300046513	Bacteria	3027
215	Ga0495616_0044278	3300046513	Bacteria	2258
216	Ga0495616_0051240	3300046513	Bacteria	2059
217	Ga0495616_0063906	3300046513	Bacteria	1797
218	Ga0495616_0082985	3300046513	Bacteria	1529
219	Ga0495616_0171617	3300046513	Bacteria	969
220	Ga0495616_0190919	3300046513	Bacteria	905
221	Ga0495631_0014519	3300046518	Bacteria	3799
222	Ga0495631_0029309	3300046518	Bacteria	2504
223	Ga0495631_0050423	3300046518	Bacteria	1820
224	Ga0495631_0051377	3300046518	Bacteria	1801
225	Ga0495631_0062609	3300046518	Bacteria	1611
226	Ga0495631_0099370	3300046518	Bacteria	1252
227	Ga0495631_0218182	3300046518	Bacteria	814
228	Ga0495632_0005838	3300046519	Bacteria	8057
229	Ga0495632_0022036	3300046519	Bacteria	3422
230	Ga0495632_0024467	3300046519	Bacteria	3206
231	Ga0495632_0026745	3300046519	Bacteria	3032
232	Ga0495632_0033167	3300046519	Bacteria	2653
233	Ga0495632_0180746	3300046519	Bacteria	966
234	Ga0495637_0039723	3300046520	Bacteria	2029
235	Ga0495643_0000346	3300046522	Bacteria	63025
236	Ga0495643_0012630	3300046522	Bacteria	5087
237	Ga0495643_0030060	3300046522	Bacteria	3036
238	Ga0495643_0062471	3300046522	Bacteria	1971
239	Ga0495643_0087382	3300046522	Bacteria	1613
240	Ga0495643_0176092	3300046522	Bacteria	1042
241	Ga0495644_0005136	3300046523	Bacteria	5125
242	Ga0495644_0009052	3300046523	Bacteria	3832
243	Ga0495644_0009840	3300046523	Bacteria	3680
244	Ga0495644_0053003	3300046523	Bacteria	1524
245	Ga0495644_0086974	3300046523	Bacteria	1178
246	Ga0495644_0142217	3300046523	Bacteria	916
247	Ga0495648_0000290	3300046524	Bacteria	57025
248	Ga0495648_0013732	3300046524	Bacteria	5970
249	Ga0495648_0022393	3300046524	Bacteria	4350
250	Ga0495648_0031398	3300046524	Bacteria	3498
251	Ga0495648_0043069	3300046524	Bacteria	2833
252	Ga0495648_0058665	3300046524	Bacteria	2300
253	Ga0495663_0048740	3300046525	Bacteria	1307
254	Ga0495666_0019043	3300046526	Bacteria	3409
255	Ga0495642_0003195	3300046528	Bacteria	6490
256	Ga0495642_0011766	3300046528	Bacteria	3370
257	Ga0495642_0012301	3300046528	Bacteria	3298
258	Ga0495642_0013208	3300046528	Bacteria	3190
259	Ga0495642_0104441	3300046528	Bacteria	1208
260	Ga0495642_0128939	3300046528	Bacteria	1088
261	Ga0495642_0174828	3300046528	Bacteria	933
262	Ga0495654_0025293	3300046530	Bacteria	3059
263	Ga0495654_0090123	3300046530	Bacteria	1424
264	Ga0495654_0097401	3300046530	Bacteria	1358
265	Ga0495654_0099259	3300046530	Bacteria	1342
266	Ga0495654_0107132	3300046530	Bacteria	1279
267	Ga0495665_0245868	3300046531	Bacteria	921
268	Ga0495665_0400864	3300046531	Bacteria	696
269	Ga0495586_0043652	3300046535	Bacteria	2414
270	Ga0495609_0000030	3300046538	Bacteria	215885
271	Ga0495609_0010440	3300046538	Bacteria	4451
272	Ga0495609_0010610	3300046538	Bacteria	4413
273	Ga0495609_0037046	3300046538	Bacteria	2200
274	Ga0495609_0056762	3300046538	Bacteria	1734
275	Ga0495609_0128833	3300046538	Bacteria	1084
276	Ga0495609_0183994	3300046538	Bacteria	878
277	Ga0495597_0014538	3300046542	Bacteria	3745
278	Ga0495597_0026824	3300046542	Bacteria	2645
279	Ga0495597_0040274	3300046542	Bacteria	2088
280	Ga0495597_0058467	3300046542	Bacteria	1685
281	Ga0495597_0073753	3300046542	Bacteria	1467
282	Ga0495597_0152101	3300046542	Bacteria	949
283	Ga0495597_0153221	3300046542	Bacteria	944
284	Ga0495622_0051793	3300046557	Bacteria	1904
285	Ga0495622_0108602	3300046557	Bacteria	1270
286	Ga0495633_0000271	3300046558	Bacteria	60538
287	Ga0495633_0012923	3300046558	Bacteria	4417
288	Ga0495633_0018039	3300046558	Bacteria	3590
289	Ga0495633_0019858	3300046558	Bacteria	3390
290	Ga0495633_0024173	3300046558	Bacteria	3004
291	Ga0495633_0094112	3300046558	Bacteria	1392
292	Ga0495633_0176617	3300046558	Bacteria	983
293	Ga0495656_0049916	3300046615	Bacteria	1784
294	Ga0495656_0068480	3300046615	Bacteria	1569
295	Ga0495656_0199842	3300046615	Bacteria	991
296	Ga0495668_0002794	3300046616	Bacteria	13898
297	Ga0495668_0020751	3300046616	Bacteria	3775
298	Ga0495668_0022209	3300046616	Bacteria	3628
299	Ga0495668_0026520	3300046616	Bacteria	3287
300	Ga0495668_0358502	3300046616	Bacteria	800
301	Ga0495668_0466072	3300046616	Bacteria	695
302	Ga0495611_0089313	3300046648	Bacteria	1423
303	Ga0495611_0168561	3300046648	Bacteria	1023
304	Ga0495625_0072104	3300046660	Bacteria	2422
305	Ga0495625_0159012	3300046660	Bacteria	1515
306	Ga0495625_0318682	3300046660	Bacteria	990
307	Ga0495625_0335045	3300046660	Bacteria	960
308	Ga0495625_0356308	3300046660	Bacteria	923
309	Ga0495635_0001055	3300046663	Bacteria	18247
310	Ga0495661_0003016	3300046665	Bacteria	12690
311	Ga0495661_0023036	3300046665	Bacteria	4047
312	Ga0495661_0026310	3300046665	Bacteria	3748
313	Ga0495661_0053811	3300046665	Bacteria	2419
314	Ga0495661_0066768	3300046665	Bacteria	2115
315	Ga0495661_0069649	3300046665	Bacteria	2060
316	Ga0495661_0089806	3300046665	Bacteria	1750
317	Ga0495661_0128769	3300046665	Bacteria	1389
318	Ga0495661_0172670	3300046665	Bacteria	1151
319	Ga0495588_0000078	3300046674	Bacteria	214254
320	Ga0495588_0021100	3300046674	Bacteria	3206
321	Ga0495588_0032117	3300046674	Bacteria	2644
322	Ga0495588_0056553	3300046674	Bacteria	2025
323	Ga0495623_0078531	3300046679	Bacteria	2046
324	Ga0495669_0000057	3300046684	Bacteria	76704
325	Ga0495669_0000300	3300046684	Bacteria	27496
326	Ga0495669_0052105	3300046684	Bacteria	1837
327	Ga0495669_0272872	3300046684	Bacteria	813
328	Ga0495613_0052335	3300046689	Bacteria	3008
329	Ga0495613_0265214	3300046689	Bacteria	1195
330	Ga0495670_0031651	3300046691	Bacteria	2629
331	Ga0495670_0037555	3300046691	Bacteria	2414
332	Ga0495670_0037740	3300046691	Bacteria	2408
333	Ga0495670_0038742	3300046691	Bacteria	2377
334	Ga0495670_0039377	3300046691	Bacteria	2357
335	Ga0495670_0070088	3300046691	Bacteria	1773
336	Ga0495670_0123074	3300046691	Bacteria	1348
337	Ga0495670_0344590	3300046691	Bacteria	801
338	Ga0495670_0468333	3300046691	Bacteria	683
339	Ga0495671_0014453	3300046692	Bacteria	4248
340	Ga0495671_0045634	3300046692	Bacteria	2193
341	Ga0495671_0106501	3300046692	Bacteria	1369
342	Ga0495671_0270608	3300046692	Bacteria	819
343	Ga0495649_0016251	3300046694	Bacteria	4220
344	Ga0495649_0048714	3300046694	Bacteria	2303
345	Ga0495649_0054619	3300046694	Bacteria	2159
346	Ga0495589_0000021	3300046794	Bacteria	197941
347	Ga0495589_0015027	3300046794	Bacteria	3984
348	Ga0495589_0018583	3300046794	Bacteria	3563
349	Ga0495589_0026665	3300046794	Bacteria	2926
350	Ga0495589_0033697	3300046794	Bacteria	2571
351	Ga0495589_0136801	3300046794	Bacteria	1174
352	Ga0495660_0018126	3300046810	Bacteria	4048
353	Ga0495660_0043715	3300046810	Bacteria	2469
354	Ga0495660_0048746	3300046810	Bacteria	2315
355	Ga0495660_0052263	3300046810	Bacteria	2220
356	Ga0495660_0054214	3300046810	Bacteria	2172
357	Ga0495660_0090284	3300046810	Bacteria	1593
358	Ga0495660_0100935	3300046810	Bacteria	1485
359	Ga0495660_0191465	3300046810	Bacteria	982
360	Ga0495660_0211579	3300046810	Bacteria	919
361	Ga0495581_0024181	3300047315	Bacteria	3520
362	Ga0495604_0125913	3300047317	Bacteria	1847
363	Ga0495636_0027149	3300047318	Bacteria	2332
364	Ga0495636_0192061	3300047318	Bacteria	930
365	Ga0495636_0302368	3300047318	Bacteria	748
366	Ga0495672_0000031	3300047320	Bacteria	298258
367	Ga0495672_0019596	3300047320	Bacteria	4459
368	Ga0495672_0024609	3300047320	Bacteria	3874
369	Ga0495672_0114201	3300047320	Bacteria	1445
370	Ga0495676_0037581	3300047321	Bacteria	4028
371	Ga0495676_0290304	3300047321	Bacteria	1105
372	Ga0495680_0045790	3300047322	Bacteria	3452
373	Ga0495683_0012100	3300047323	Bacteria	4536
374	Ga0495683_0050854	3300047323	Bacteria	2073
375	Ga0495683_0075523	3300047323	Bacteria	1650
376	Ga0495687_000407	3300047443	Bacteria	53252
377	Ga0495687_010545	3300047443	Bacteria	5060
378	Ga0495687_017002	3300047443	Bacteria	3642
379	Ga0495687_025311	3300047443	Bacteria	2808
380	Ga0495675_0023477	3300047444	Bacteria	3929
381	Ga0495677_0000029	3300047445	Bacteria	91481
382	Ga0495677_0018533	3300047445	Bacteria	2522
383	Ga0495677_0025206	3300047445	Bacteria	2157
384	Ga0495677_0117602	3300047445	Bacteria	1012
385	Ga0495679_018541	3300047446	Bacteria	2468
386	Ga0495679_022130	3300047446	Bacteria	2181
387	Ga0495679_033506	3300047446	Bacteria	1640
388	Ga0495679_041958	3300047446	Bacteria	1413
389	Ga0495679_071968	3300047446	Bacteria	994
390	Ga0495685_017538	3300047447	Bacteria	2452
391	Ga0495685_024221	3300047447	Bacteria	2088
392	Ga0495685_037146	3300047447	Bacteria	1671
393	Ga0495685_046579	3300047447	Bacteria	1475
394	Ga0495673_0000026	3300047469	Bacteria	476378
395	Ga0495673_0218919	3300047469	Bacteria	705
396	Ga0495681_0016324	3300047470	Bacteria	4166
397	Ga0495681_0017670	3300047470	Bacteria	3951
398	Ga0495681_0020448	3300047470	Bacteria	3592
399	Ga0495681_0030366	3300047470	Bacteria	2752
400	Ga0495681_0068128	3300047470	Bacteria	1620
401	Ga0495681_0129842	3300047470	Bacteria	1073
402	Ga0495681_0142862	3300047470	Bacteria	1009
403	Ga0495686_0000738	3300047472	Bacteria	43615
404	Ga0495686_0125112	3300047472	Bacteria	1529
405	Ga0495593_0015115	3300047673	Bacteria	4383
406	Ga0495614_0003050	3300048089	Bacteria	7465
407	Ga0495615_0065675	3300048090	Bacteria	967
408	Ga0495626_0009200	3300048091	Bacteria	5347
409	Ga0495626_0015845	3300048091	Bacteria	3847
410	Ga0495626_0016880	3300048091	Bacteria	3698
411	Ga0495626_0033977	3300048091	Bacteria	2441
412	Ga0495626_0184133	3300048091	Bacteria	864
413	Ga0496100_0063388	3300048903	Bacteria	2442
414	Ga0496100_0367224	3300048903	Bacteria	1090
415	Ga0496101_0020529	3300048904	Bacteria	4524
416	Ga0496101_0071264	3300048904	Bacteria	2547
417	Ga0496102_0000198	3300048905	Bacteria	81732
418	Ga0496102_0099041	3300048905	Bacteria	2705
419	Ga0496102_0132452	3300048905	Bacteria	2334
420	Ga0496103_0028205	3300048906	Bacteria	3405
421	Ga0496104_0264325	3300048907	Bacteria	1633
422	Ga0496105_0107014	3300048908	Bacteria	2308
423	Ga0496107_0088394	3300048910	Bacteria	2262
424	Ga0496108_0263227	3300048911	Bacteria	1501
425	Ga0496108_0392629	3300048911	Bacteria	1212
426	Ga0496109_0069130	3300048912	Bacteria	3238
427	Ga0496109_0278255	3300048912	Bacteria	1577
428	Ga0496110_0017718	3300048913	Bacteria	5958
429	Ga0496110_0382513	3300048913	Bacteria	1282
430	Ga0496111_0027877	3300048914	Bacteria	4000
431	Ga0496111_0155586	3300048914	Bacteria	1696
432	Ga0496111_0618430	3300048914	Bacteria	792
433	Ga0496113_0200467	3300048916	Bacteria	1586
434	Ga0496113_0211702	3300048916	Bacteria	1543
435	Ga0496116_0017608	3300048919	Bacteria	5537
436	Ga0496117_0000045	3300048920	Bacteria	301047
437	Ga0496118_0000041	3300048921	Bacteria	301047
438	Ga0496121_0079669	3300048924	Bacteria	2599
439	Ga0496121_0114323	3300048924	Bacteria	2052
440	Ga0496122_0032256	3300048925	Bacteria	4336
441	Ga0496122_0036552	3300048925	Bacteria	3968
442	Ga0496122_0057424	3300048925	Bacteria	2890
443	Ga0496123_0028191	3300048926	Bacteria	4163
444	Ga0496123_0034600	3300048926	Bacteria	3615
445	Ga0496124_0140028	3300048927	Bacteria	1910
446	Ga0496124_0145645	3300048927	Bacteria	1864
447	Ga0496124_0239756	3300048927	Bacteria	1349
448	Ga0496124_0309645	3300048927	Bacteria	1136
449	Ga0496124_0565536	3300048927	Bacteria	747
450	Ga0496125_0040174	3300048928	Bacteria	4015
451	Ga0496125_0056065	3300048928	Bacteria	3203
452	Ga0496125_0135794	3300048928	Bacteria	1721
453	Ga0496125_0143533	3300048928	Bacteria	1655
454	Ga0496125_0216187	3300048928	Bacteria	1239
455	Ga0496126_0116721	3300048929	Bacteria	2319
456	Ga0495678_000006	3300049459	Bacteria	463690
457	Ga0495678_000769	3300049459	Bacteria	28986
458	Ga0495678_017365	3300049459	Bacteria	3263
459	Ga0495678_019925	3300049459	Bacteria	2980
460	Ga0495678_021048	3300049459	Bacteria	2877
461	Ga0495682_0010283	3300049460	Bacteria	3628
462	Ga0495682_0012989	3300049460	Bacteria	3178
463	Ga0501047_0208966	3300049581	Bacteria	1811
464	Ga0501221_028769	3300049704	Bacteria	1146
465	Ga0501234_041180	3300049707	Bacteria	757
466	Ga0501269_015776	3300049766	Bacteria	928
467	Ga0501279_024022	3300049775	Bacteria	880
468	Ga0501044_0333125	3300049823	Bacteria	1440
469	Ga0501044_0624804	3300049823	Bacteria	968
470	nmdc:mga03683_6153_c1	3300050489	Bacteria	4098
471	nmdc:mga03n38_79082_c1	3300050490	Bacteria	1541
472	nmdc:mga00v17_10738_c1	3300050491	Bacteria	5016
473	nmdc:mga0yw44_1007_c1	3300050492	Bacteria	10783
474	nmdc:mga0yw44_30617_c1	3300050492	Bacteria	3121
475	nmdc:mga0k408_185636_c1	3300050493	Bacteria	1240
476	nmdc:mga06z11_52010_c1	3300050494	Bacteria	2100
477	nmdc:mga07m45_196608_c1	3300050496	Bacteria	1173
478	nmdc:mga0sz30_55450_c1	3300050516	Bacteria	1687
479	nmdc:mga0sz30_8585_c1	3300050516	Bacteria	3860
480	Ga0500644_0080232	3300053088	Bacteria	1198
481	Ga0500646_0002464	3300053090	Bacteria	4806
482	Ga0500583_0080861	3300053092	Bacteria	1569
483	Ga0500650_0090921	3300053098	Bacteria	1428
484	Ga0500555_025257	3300053103	Bacteria	1701
485	Ga0500618_000274	3300053125	Bacteria	39526
486	Ga0500642_0079084	3300053130	Bacteria	1507
487	Ga0500655_002240	3300053133	Bacteria	3550
488	Ga0500604_0006324	3300053151	Bacteria	3131
489	Ga0500616_0109679	3300053153	Bacteria	1335
490	Ga0500637_0140920	3300053178	Bacteria	1396
491	Ga0500661_010938	3300055283	Bacteria	1647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046616	Ga0495668_0358502	Ga0495668_0358502_204_779	191
2	iso_pu_bacteria	2842711865	2842714764	191
3	iso_pu_bacteria	2852618963	2852620905	191
4	iso_pu_bacteria	2857547612	2857551058	191
5	iso_pu_bacteria	2857553236	2857558353	191
6	iso_pu_bacteria	2857558681	2857563323	191
7	iso_pu_bacteria	2884811622	2884814185	191
8	iso_pu_bacteria	2884836552	2884840604	191
9	iso_pu_bacteria	2884852848	2884855861	191
10	iso_pu_bacteria	2885080285	2885085800	191
11	iso_pu_bacteria	2896154374	2896157214	191
12	iso_pu_bacteria	2904424332	2904427279	191
13	iso_pu_bacteria	2904439833	2904439964	191
14	iso_pu_bacteria	2904601388	2904604516	191
15	iso_pu_bacteria	2919046199	2919050286	191
16	iso_pu_bacteria	2919476304	2919479855	191
17	iso_pu_bacteria	2928130867	2928133276	191
18	3300053153	Ga0500616_0109679	Ga0500616_0109679_539_1246	192
19	3300046691	Ga0495670_0070088	Ga0495670_0070088_16_597	193
20	3300046691	Ga0495670_0468333	Ga0495670_0468333_14_595	193
21	3300046512	Ga0495610_0211781	Ga0495610_0211781_118_753	195
22	3300046520	Ga0495637_0039723	Ga0495637_0039723_696_1325	195
23	3300046615	Ga0495656_0199842	Ga0495656_0199842_342_962	195
24	3300046691	Ga0495670_0344590	Ga0495670_0344590_152_772	195
25	3300046810	Ga0495660_0211579	Ga0495660_0211579_14_667	195
26	3300047469	Ga0495673_0218919	Ga0495673_0218919_29_649	195
27	3300006173	Ga0070716_100072557	Ga0070716_1000725571	196
28	3300031251	Ga0265327_10000472	Ga0265327_1000047245	196
29	iso_pu_bacteria	2547132103	2547373474	201
30	iso_pu_bacteria	2574179768	2574430540	201
31	iso_pu_bacteria	2843690924	2843694807	201
32	iso_pu_bacteria	2846033681	2846033723	201
33	iso_pu_bacteria	2891633521	2891634752	201
34	iso_pu_bacteria	2998344455	2998345730	201
35	iso_pu_bacteria	639633007	639786526	201
36	3300045051	Ga0451576_0929813	Ga0451576_0929813_250_870	203
37	3300046648	Ga0495611_0168561	Ga0495611_0168561_350_1006	204
38	3300047318	Ga0495636_0302368	Ga0495636_0302368_16_672	204
39	3300006353	Ga0075370_10266106	Ga0075370_102661062	205
40	3300021361	Ga0213872_10019675	Ga0213872_100196755	205
41	3300031239	Ga0265328_10000005	Ga0265328_1000000591	205
42	3300039447	Ga0436361_0922237	Ga0436361_0922237_13772_14389	205
43	3300044656	Ga0466969_0006928	Ga0466969_0006928_4051_4668	205
44	3300045051	Ga0451576_0058004	Ga0451576_0058004_2039_2656	205
45	3300053092	Ga0500583_0080861	Ga0500583_0080861_793_1500	205
46	3300053178	Ga0500637_0140920	Ga0500637_0140920_500_1207	205
47	3300005435	Ga0070714_100003989	Ga0070714_10000398910	206
48	3300006195	Ga0075366_10111227	Ga0075366_101112273	206
49	3300006353	Ga0075370_10033429	Ga0075370_100334292	206
50	3300009093	Ga0105240_10190525	Ga0105240_101905251	206
51	3300013102	Ga0157371_10380919	Ga0157371_103809192	206
52	3300013104	Ga0157370_10001049	Ga0157370_1000104923	206
53	3300030521	Ga0307511_10001014	Ga0307511_100010147	206
54	3300042876	Ga0451577_0045277	Ga0451577_0045277_2721_3371	206
55	3300044673	Ga0453683_0076793	Ga0453683_0076793_632_1282	206
56	3300044712	Ga0453684_0000005	Ga0453684_0000005_1059893_1060525	206
57	3300045051	Ga0451576_0001961	Ga0451576_0001961_15844_16494	206
58	3300049766	Ga0501269_015776	Ga0501269_015776_13_633	206
59	3300055283	Ga0500661_010938	Ga0500661_010938_206_826	206
60	3300005347	Ga0070668_100278488	Ga0070668_1002784882	207
61	3300005367	Ga0070667_100347981	Ga0070667_1003479812	207
62	3300005842	Ga0068858_100165715	Ga0068858_1001657152	207
63	3300005985	Ga0081539_10003666	Ga0081539_1000366615	207
64	3300025986	Ga0207658_10087973	Ga0207658_100879731	207
65	3300026035	Ga0207703_10277411	Ga0207703_102774112	207
66	3300031239	Ga0265328_10001363	Ga0265328_100013637	207
67	3300031239	Ga0265328_10011926	Ga0265328_100119262	207
68	3300031250	Ga0265331_10000070	Ga0265331_10000070123	207
69	3300031250	Ga0265331_10001058	Ga0265331_100010582	207
70	3300031251	Ga0265327_10000156	Ga0265327_1000015622	207
71	3300031251	Ga0265327_10018727	Ga0265327_100187272	207
72	3300041463	Ga0451804_0636132	Ga0451804_0636132_11_733	207
73	3300044712	Ga0453684_0000163	Ga0453684_0000163_93958_94617	207
74	3300044712	Ga0453684_0000386	Ga0453684_0000386_156102_156737	207
75	3300045051	Ga0451576_0103062	Ga0451576_0103062_518_1177	207
76	3300048916	Ga0496113_0211702	Ga0496113_0211702_55_774	207
77	3300025933	Ga0207706_10474013	Ga0207706_104740132	208
78	3300046506	Ga0495583_0158597	Ga0495583_0158597_51_677	208
79	3300046557	Ga0495622_0051793	Ga0495622_0051793_277_945	209
80	iso_pu_bacteria	2521172590	2521557300	210
81	iso_pu_bacteria	2551306416	2553005348	210
82	iso_pu_bacteria	2600255292	2601669875	210
83	iso_pu_bacteria	2643221603	2644027798	210
84	iso_pu_bacteria	2738541297	2738828843	210
85	iso_pu_bacteria	2738541357	2739152639	210
86	iso_pu_bacteria	2738543003	2739194559	210
87	iso_pu_bacteria	2738543026	2739321035	210
88	iso_pu_bacteria	2738543029	2739339276	210
89	iso_pu_bacteria	2765235838	2765568428	210
90	iso_pu_bacteria	2808606386	2808981183	210
91	iso_pu_bacteria	2808606415	2809131764	210
92	iso_pu_bacteria	2808606419	2809151424	210
93	iso_pu_bacteria	2839094727	2839095334	210
94	iso_pu_bacteria	2904530477	2904531091	210
95	iso_pu_bacteria	2904584206	2904587264	210
96	iso_pu_bacteria	2904589729	2904592701	210
97	iso_pu_bacteria	2919079590	2919082338	210
98	iso_pu_bacteria	2923510766	2923515962	210
99	iso_pu_bacteria	2932410948	2932413364	210
100	iso_pu_bacteria	2932416698	2932417424	210
101	3300006038	Ga0075365_10007553	Ga0075365_100075537	211
102	3300006042	Ga0075368_10002260	Ga0075368_100022602	211
103	3300006048	Ga0075363_100003613	Ga0075363_1000036137	211
104	3300006051	Ga0075364_10005797	Ga0075364_100057977	211
105	3300006177	Ga0075362_10008887	Ga0075362_100088873	211
106	3300006178	Ga0075367_10002015	Ga0075367_100020156	211
107	3300006186	Ga0075369_10011342	Ga0075369_100113425	211
108	3300006186	Ga0075369_10026560	Ga0075369_100265601	211
109	3300033179	Ga0307507_10059523	Ga0307507_100595232	211
110	3300044901	Ga0466960_0056664	Ga0466960_0056664_586_1278	211
111	3300050489	nmdc:mga03683_6153_c1	nmdc:mga03683_6153_c1_3340_4071	211
112	3300050490	nmdc:mga03n38_79082_c1	nmdc:mga03n38_79082_c1_781_1512	211
113	3300050491	nmdc:mga00v17_10738_c1	nmdc:mga00v17_10738_c1_2066_2797	211
114	3300050492	nmdc:mga0yw44_1007_c1	nmdc:mga0yw44_1007_c1_5507_6238	211
115	3300050494	nmdc:mga06z11_52010_c1	nmdc:mga06z11_52010_c1_1081_1812	211
116	3300050516	nmdc:mga0sz30_55450_c1	nmdc:mga0sz30_55450_c1_714_1445	211
117	3300050516	nmdc:mga0sz30_8585_c1	nmdc:mga0sz30_8585_c1_2201_2908	211
118	3300053088	Ga0500644_0080232	Ga0500644_0080232_461_1168	211
119	3300053090	Ga0500646_0002464	Ga0500646_0002464_3484_4191	211
120	3300053098	Ga0500650_0090921	Ga0500650_0090921_332_1039	211
121	3300053103	Ga0500555_025257	Ga0500555_025257_609_1316	211
122	3300053130	Ga0500642_0079084	Ga0500642_0079084_748_1455	211
123	3300053133	Ga0500655_002240	Ga0500655_002240_2239_2946	211
124	3300053151	Ga0500604_0006324	Ga0500604_0006324_1281_1988	211
125	3300031548	Ga0307408_100000294	Ga0307408_1000002941	212
126	3300046453	Ga0495627_023646	Ga0495627_023646_738_1376	212
127	3300046457	Ga0495590_0013563	Ga0495590_0013563_1182_1820	212
128	3300046460	Ga0495638_0137311	Ga0495638_0137311_297_935	212
129	3300046471	Ga0495650_0028439	Ga0495650_0028439_1540_2178	212
130	3300046474	Ga0495605_0047984	Ga0495605_0047984_1374_2012	212
131	3300046500	Ga0495596_0032096	Ga0495596_0032096_1166_1804	212
132	3300046501	Ga0495607_0158591	Ga0495607_0158591_435_1073	212
133	3300046506	Ga0495583_0003595	Ga0495583_0003595_724_1362	212
134	3300046506	Ga0495583_0019334	Ga0495583_0019334_724_1362	212
135	3300046506	Ga0495583_0024000	Ga0495583_0024000_763_1401	212
136	3300046506	Ga0495583_0153247	Ga0495583_0153247_56_694	212
137	3300046506	Ga0495583_0212173	Ga0495583_0212173_81_719	212
138	3300046507	Ga0495606_0068443	Ga0495606_0068443_1257_1895	212
139	3300046513	Ga0495616_0021514	Ga0495616_0021514_2750_3388	212
140	3300046513	Ga0495616_0082985	Ga0495616_0082985_764_1402	212
141	3300046513	Ga0495616_0171617	Ga0495616_0171617_58_696	212
142	3300046518	Ga0495631_0050423	Ga0495631_0050423_1155_1793	212
143	3300046519	Ga0495632_0005838	Ga0495632_0005838_3480_4118	212
144	3300046522	Ga0495643_0087382	Ga0495643_0087382_395_1033	212
145	3300046523	Ga0495644_0086974	Ga0495644_0086974_32_670	212
146	3300046523	Ga0495644_0142217	Ga0495644_0142217_233_871	212
147	3300046528	Ga0495642_0104441	Ga0495642_0104441_280_918	212
148	3300046528	Ga0495642_0174828	Ga0495642_0174828_284_922	212
149	3300046530	Ga0495654_0025293	Ga0495654_0025293_1162_1800	212
150	3300046538	Ga0495609_0128833	Ga0495609_0128833_252_890	212
151	3300046542	Ga0495597_0014538	Ga0495597_0014538_2829_3467	212
152	3300046542	Ga0495597_0040274	Ga0495597_0040274_292_930	212
153	3300046542	Ga0495597_0073753	Ga0495597_0073753_277_915	212
154	3300046558	Ga0495633_0094112	Ga0495633_0094112_467_1105	212
155	3300046616	Ga0495668_0002794	Ga0495668_0002794_1276_1914	212
156	3300046616	Ga0495668_0466072	Ga0495668_0466072_38_676	212
157	3300046660	Ga0495625_0072104	Ga0495625_0072104_257_895	212
158	3300046665	Ga0495661_0128769	Ga0495661_0128769_288_926	212
159	3300046665	Ga0495661_0172670	Ga0495661_0172670_79_717	212
160	3300046674	Ga0495588_0056553	Ga0495588_0056553_742_1380	212
161	3300046684	Ga0495669_0000300	Ga0495669_0000300_1235_1873	212
162	3300046691	Ga0495670_0039377	Ga0495670_0039377_1253_1891	212
163	3300046692	Ga0495671_0045634	Ga0495671_0045634_394_1032	212
164	3300046794	Ga0495589_0026665	Ga0495589_0026665_283_921	212
165	3300046794	Ga0495589_0136801	Ga0495589_0136801_502_1140	212
166	3300046810	Ga0495660_0052263	Ga0495660_0052263_337_975	212
167	3300046810	Ga0495660_0054214	Ga0495660_0054214_1045_1683	212
168	3300047323	Ga0495683_0075523	Ga0495683_0075523_738_1376	212
169	3300047443	Ga0495687_010545	Ga0495687_010545_3204_3842	212
170	3300047443	Ga0495687_025311	Ga0495687_025311_275_913	212
171	3300047446	Ga0495679_018541	Ga0495679_018541_1425_2063	212
172	3300047447	Ga0495685_024221	Ga0495685_024221_304_942	212
173	3300047470	Ga0495681_0016324	Ga0495681_0016324_2329_2967	212
174	3300047470	Ga0495681_0129842	Ga0495681_0129842_96_734	212
175	3300047470	Ga0495681_0142862	Ga0495681_0142862_276_914	212
176	3300048903	Ga0496100_0063388	Ga0496100_0063388_933_1571	212
177	3300048904	Ga0496101_0071264	Ga0496101_0071264_1384_2022	212
178	3300048905	Ga0496102_0099041	Ga0496102_0099041_876_1514	212
179	3300048906	Ga0496103_0028205	Ga0496103_0028205_2180_2818	212
180	3300048908	Ga0496105_0107014	Ga0496105_0107014_78_716	212
181	3300048910	Ga0496107_0088394	Ga0496107_0088394_961_1599	212
182	3300048911	Ga0496108_0263227	Ga0496108_0263227_518_1156	212
183	3300048911	Ga0496108_0392629	Ga0496108_0392629_10_648	212
184	3300048912	Ga0496109_0069130	Ga0496109_0069130_1853_2491	212
185	3300048912	Ga0496109_0278255	Ga0496109_0278255_292_930	212
186	3300048913	Ga0496110_0017718	Ga0496110_0017718_1602_2240	212
187	3300048913	Ga0496110_0382513	Ga0496110_0382513_229_867	212
188	3300048914	Ga0496111_0155586	Ga0496111_0155586_353_991	212
189	3300048916	Ga0496113_0200467	Ga0496113_0200467_564_1202	212
190	3300048925	Ga0496122_0032256	Ga0496122_0032256_2657_3295	212
191	3300048926	Ga0496123_0034600	Ga0496123_0034600_1126_1764	212
192	3300048928	Ga0496125_0040174	Ga0496125_0040174_2366_3004	212
193	3300049459	Ga0495678_000769	Ga0495678_000769_26806_27444	212
194	3300049459	Ga0495678_017365	Ga0495678_017365_1865_2503	212
195	3300049459	Ga0495678_021048	Ga0495678_021048_636_1274	212
196	3300049460	Ga0495682_0010283	Ga0495682_0010283_276_914	212
197	3300006038	Ga0075365_10041245	Ga0075365_100412451	213
198	3300050492	nmdc:mga0yw44_30617_c1	nmdc:mga0yw44_30617_c1_2270_2983	213
199	3300050493	nmdc:mga0k408_185636_c1	nmdc:mga0k408_185636_c1_55_768	213
200	3300002704	JGI25155J39150_1000275	JGI25155J39150_100027512	214
201	3300002705	JGI25156J39149_1002838	JGI25156J39149_10028384	214
202	3300002738	JGI25154J39366_1001607	JGI25154J39366_10016074	214
203	3300003320	rootH2_10024853	rootH2_100248531	214
204	3300003759	Ga0055525_1000047	Ga0055525_100004715	214
205	3300003763	Ga0055529_1000125	Ga0055529_100012534	214
206	3300005262	Ga0065165_1019953	Ga0065165_10199534	214
207	3300005288	Ga0065714_10083160	Ga0065714_100831602	214
208	3300005327	Ga0070658_10273733	Ga0070658_102737332	214
209	3300005337	Ga0070682_100438685	Ga0070682_1004386851	214
210	3300005339	Ga0070660_100056401	Ga0070660_1000564013	214
211	3300005339	Ga0070660_100161031	Ga0070660_1001610312	214
212	3300005339	Ga0070660_100606578	Ga0070660_1006065781	214
213	3300005344	Ga0070661_100235102	Ga0070661_1002351021	214
214	3300005344	Ga0070661_100488205	Ga0070661_1004882051	214
215	3300005366	Ga0070659_100267538	Ga0070659_1002675382	214
216	3300005457	Ga0070662_100296908	Ga0070662_1002969081	214
217	3300005563	Ga0068855_100000037	Ga0068855_10000003724	214
218	3300005564	Ga0070664_100594956	Ga0070664_1005949562	214
219	3300005577	Ga0068857_100200958	Ga0068857_1002009582	214
220	3300005718	Ga0068866_10089364	Ga0068866_100893642	214
221	3300006195	Ga0075366_10002475	Ga0075366_100024757	214
222	3300006946	Ga0079104_1003020	Ga0079104_10030203	214
223	3300009036	Ga0105244_10023223	Ga0105244_100232234	214
224	3300009036	Ga0105244_10083964	Ga0105244_100839642	214
225	3300009093	Ga0105240_10227932	Ga0105240_102279322	214
226	3300009148	Ga0105243_10018177	Ga0105243_100181772	214
227	3300009545	Ga0105237_10122054	Ga0105237_101220542	214
228	3300009545	Ga0105237_11000262	Ga0105237_110002621	214
229	3300010375	Ga0105239_10492733	Ga0105239_104927332	214
230	3300011119	Ga0105246_10579956	Ga0105246_105799562	214
231	3300013102	Ga0157371_10000013	Ga0157371_1000001329	214
232	3300013104	Ga0157370_10224539	Ga0157370_102245392	214
233	3300013104	Ga0157370_10620573	Ga0157370_106205732	214
234	3300013296	Ga0157374_10181849	Ga0157374_101818492	214
235	3300013297	Ga0157378_10050117	Ga0157378_100501172	214
236	3300013307	Ga0157372_10434256	Ga0157372_104342562	214
237	3300013307	Ga0157372_10491272	Ga0157372_104912722	214
238	3300014497	Ga0182008_10016736	Ga0182008_100167365	214
239	3300014497	Ga0182008_10400130	Ga0182008_104001301	214
240	3300015261	Ga0182006_1000035	Ga0182006_1000035153	214
241	3300015261	Ga0182006_1000096	Ga0182006_100009693	214
242	3300015261	Ga0182006_1022210	Ga0182006_10222103	214
243	3300015262	Ga0182007_10000040	Ga0182007_1000004047	214
244	3300015265	Ga0182005_1000013	Ga0182005_1000013313	214
245	3300015265	Ga0182005_1000025	Ga0182005_1000025153	214
246	3300017792	Ga0163161_10048114	Ga0163161_100481142	214
247	3300017792	Ga0163161_10211355	Ga0163161_102113551	214
248	3300021361	Ga0213872_10000020	Ga0213872_1000002067	214
249	3300025233	Ga0209437_108904	Ga0209437_1089042	214
250	3300025272	Ga0209455_1000044	Ga0209455_1000044279	214
251	3300025909	Ga0207705_10078474	Ga0207705_100784742	214
252	3300025919	Ga0207657_10091544	Ga0207657_100915441	214
253	3300025919	Ga0207657_10453933	Ga0207657_104539331	214
254	3300025919	Ga0207657_10522609	Ga0207657_105226091	214
255	3300025920	Ga0207649_10100132	Ga0207649_101001323	214
256	3300025932	Ga0207690_10039891	Ga0207690_100398915	214
257	3300025932	Ga0207690_10210151	Ga0207690_102101511	214
258	3300025934	Ga0207686_10187850	Ga0207686_101878502	214
259	3300025935	Ga0207709_10025077	Ga0207709_100250772	214
260	3300025945	Ga0207679_10040399	Ga0207679_100403992	214
261	3300025949	Ga0207667_10000053	Ga0207667_10000053162	214
262	3300026116	Ga0207674_10106065	Ga0207674_101060652	214
263	3300027111	Ga0209281_1007059	Ga0209281_10070592	214
264	3300030744	Ga0316181_1218544	Ga0316181_12185444	214
265	3300030745	Ga0316182_1199092	Ga0316182_11990922	214
266	3300037312	Ga0395899_0005514	Ga0395899_0005514_321_965	214
267	3300037312	Ga0395899_0208194	Ga0395899_0208194_202_846	214
268	3300037312	Ga0395899_0227147	Ga0395899_0227147_560_1207	214
269	3300037418	Ga0395900_0000331	Ga0395900_0000331_1660_2307	214
270	3300037418	Ga0395900_0039845	Ga0395900_0039845_1987_2646	214
271	3300037418	Ga0395900_0116900	Ga0395900_0116900_1941_2588	214
272	3300037418	Ga0395900_0342376	Ga0395900_0342376_288_932	214
273	3300037418	Ga0395900_0376926	Ga0395900_0376926_525_1172	214
274	3300037418	Ga0395900_0424199	Ga0395900_0424199_357_1004	214
275	3300037418	Ga0395900_0703921	Ga0395900_0703921_17_664	214
276	3300037466	Ga0395898_0093570	Ga0395898_0093570_1672_2331	214
277	3300037466	Ga0395898_0339473	Ga0395898_0339473_276_923	214
278	3300037471	Ga0395905_0403751	Ga0395905_0403751_415_1062	214
279	3300038443	Ga0395901_0000097	Ga0395901_0000097_35288_35935	214
280	3300038443	Ga0395901_0028671	Ga0395901_0028671_4835_5494	214
281	3300038443	Ga0395901_0706435	Ga0395901_0706435_163_807	214
282	3300039447	Ga0436361_0314818	Ga0436361_0314818_535_1182	214
283	3300039447	Ga0436361_0498733	Ga0436361_0498733_1853_2497	214
284	3300039447	Ga0436361_0594223	Ga0436361_0594223_14651_15313	214
285	3300042005	Ga0439448_0020276	Ga0439448_0020276_1079_1726	214
286	3300042005	Ga0439448_0091997	Ga0439448_0091997_85_732	214
287	3300042012	Ga0439455_0111585	Ga0439455_0111585_27_674	214
288	3300042157	Ga0439458_0004250	Ga0439458_0004250_699_1346	214
289	3300044656	Ga0466969_0045626	Ga0466969_0045626_1417_2064	214
290	3300044683	Ga0466965_0067998	Ga0466965_0067998_539_1186	214
291	3300044719	Ga0466971_0082169	Ga0466971_0082169_262_909	214
292	3300044735	Ga0466968_0169739	Ga0466968_0169739_117_764	214
293	3300044842	Ga0466957_0317123	Ga0466957_0317123_66_710	214
294	3300045836	Ga0466958_0348328	Ga0466958_0348328_33_680	214
295	3300045836	Ga0466958_0416343	Ga0466958_0416343_33_680	214
296	3300045976	Ga0466967_0307423	Ga0466967_0307423_168_815	214
297	3300046452	Ga0495617_000004	Ga0495617_000004_60792_61484	214
298	3300046452	Ga0495617_000009	Ga0495617_000009_151035_151679	214
299	3300046452	Ga0495617_018168	Ga0495617_018168_1495_2172	214
300	3300046452	Ga0495617_031790	Ga0495617_031790_1075_1752	214
301	3300046453	Ga0495627_000008	Ga0495627_000008_380418_381128	214
302	3300046453	Ga0495627_006670	Ga0495627_006670_2785_3429	214
303	3300046455	Ga0495603_0052996	Ga0495603_0052996_1210_1854	214
304	3300046459	Ga0495629_0006506	Ga0495629_0006506_886_1530	214
305	3300046471	Ga0495650_0000011	Ga0495650_0000011_4623_5309	214
306	3300046471	Ga0495650_0000494	Ga0495650_0000494_21304_21996	214
307	3300046471	Ga0495650_0000593	Ga0495650_0000593_2554_3201	214
308	3300046473	Ga0495582_0021333	Ga0495582_0021333_1210_1854	214
309	3300046474	Ga0495605_0000024	Ga0495605_0000024_73885_74529	214
310	3300046474	Ga0495605_0015140	Ga0495605_0015140_667_1314	214
311	3300046474	Ga0495605_0066053	Ga0495605_0066053_268_915	214
312	3300046474	Ga0495605_0077298	Ga0495605_0077298_857_1501	214
313	3300046491	Ga0495584_0004700	Ga0495584_0004700_680_1324	214
314	3300046491	Ga0495584_0018909	Ga0495584_0018909_789_1436	214
315	3300046491	Ga0495584_0026934	Ga0495584_0026934_662_1309	214
316	3300046491	Ga0495584_0057393	Ga0495584_0057393_1013_1657	214
317	3300046491	Ga0495584_0149034	Ga0495584_0149034_284_928	214
318	3300046491	Ga0495584_0176680	Ga0495584_0176680_29_673	214
319	3300046491	Ga0495584_0201995	Ga0495584_0201995_32_676	214
320	3300046492	Ga0495585_0017853	Ga0495585_0017853_2323_2967	214
321	3300046492	Ga0495585_0021109	Ga0495585_0021109_2173_2817	214
322	3300046492	Ga0495585_0029443	Ga0495585_0029443_1230_1922	214
323	3300046492	Ga0495585_0032805	Ga0495585_0032805_1554_2201	214
324	3300046492	Ga0495585_0055498	Ga0495585_0055498_801_1445	214
325	3300046492	Ga0495585_0158847	Ga0495585_0158847_322_966	214
326	3300046499	Ga0495594_0011814	Ga0495594_0011814_2022_2666	214
327	3300046500	Ga0495596_0011263	Ga0495596_0011263_1034_1678	214
328	3300046500	Ga0495596_0011276	Ga0495596_0011276_1102_1749	214
329	3300046501	Ga0495607_0006535	Ga0495607_0006535_6905_7552	214
330	3300046501	Ga0495607_0036400	Ga0495607_0036400_247_891	214
331	3300046501	Ga0495607_0038773	Ga0495607_0038773_1434_2081	214
332	3300046501	Ga0495607_0044902	Ga0495607_0044902_1376_2059	214
333	3300046501	Ga0495607_0079132	Ga0495607_0079132_476_1120	214
334	3300046501	Ga0495607_0183740	Ga0495607_0183740_304_951	214
335	3300046506	Ga0495583_0014453	Ga0495583_0014453_1148_1834	214
336	3300046506	Ga0495583_0016161	Ga0495583_0016161_1096_1743	214
337	3300046506	Ga0495583_0017569	Ga0495583_0017569_2182_2874	214
338	3300046507	Ga0495606_0000927	Ga0495606_0000927_2604_3296	214
339	3300046507	Ga0495606_0043133	Ga0495606_0043133_97_744	214
340	3300046507	Ga0495606_0143644	Ga0495606_0143644_680_1324	214
341	3300046507	Ga0495606_0215008	Ga0495606_0215008_317_961	214
342	3300046512	Ga0495610_0091031	Ga0495610_0091031_163_855	214
343	3300046512	Ga0495610_0168228	Ga0495610_0168228_26_670	214
344	3300046513	Ga0495616_0000567	Ga0495616_0000567_2831_3517	214
345	3300046513	Ga0495616_0005459	Ga0495616_0005459_5790_6437	214
346	3300046513	Ga0495616_0016582	Ga0495616_0016582_933_1580	214
347	3300046513	Ga0495616_0019296	Ga0495616_0019296_2143_2790	214
348	3300046513	Ga0495616_0027344	Ga0495616_0027344_2130_2774	214
349	3300046513	Ga0495616_0044278	Ga0495616_0044278_227_874	214
350	3300046513	Ga0495616_0051240	Ga0495616_0051240_1139_1783	214
351	3300046513	Ga0495616_0063906	Ga0495616_0063906_800_1444	214
352	3300046513	Ga0495616_0190919	Ga0495616_0190919_111_755	214
353	3300046518	Ga0495631_0014519	Ga0495631_0014519_784_1431	214
354	3300046518	Ga0495631_0029309	Ga0495631_0029309_1228_1872	214
355	3300046518	Ga0495631_0051377	Ga0495631_0051377_35_679	214
356	3300046518	Ga0495631_0062609	Ga0495631_0062609_666_1310	214
357	3300046518	Ga0495631_0099370	Ga0495631_0099370_408_1052	214
358	3300046518	Ga0495631_0218182	Ga0495631_0218182_127_771	214
359	3300046519	Ga0495632_0022036	Ga0495632_0022036_2576_3220	214
360	3300046519	Ga0495632_0024467	Ga0495632_0024467_2223_2870	214
361	3300046519	Ga0495632_0026745	Ga0495632_0026745_1070_1717	214
362	3300046519	Ga0495632_0033167	Ga0495632_0033167_465_1112	214
363	3300046519	Ga0495632_0180746	Ga0495632_0180746_21_665	214
364	3300046522	Ga0495643_0000346	Ga0495643_0000346_4297_4989	214
365	3300046522	Ga0495643_0012630	Ga0495643_0012630_4106_4753	214
366	3300046522	Ga0495643_0030060	Ga0495643_0030060_1647_2294	214
367	3300046522	Ga0495643_0062471	Ga0495643_0062471_81_728	214
368	3300046522	Ga0495643_0176092	Ga0495643_0176092_242_886	214
369	3300046523	Ga0495644_0005136	Ga0495644_0005136_596_1243	214
370	3300046523	Ga0495644_0009052	Ga0495644_0009052_2074_2718	214
371	3300046523	Ga0495644_0009840	Ga0495644_0009840_1898_2542	214
372	3300046523	Ga0495644_0053003	Ga0495644_0053003_236_922	214
373	3300046524	Ga0495648_0000290	Ga0495648_0000290_55883_56527	214
374	3300046524	Ga0495648_0013732	Ga0495648_0013732_4265_4912	214
375	3300046524	Ga0495648_0022393	Ga0495648_0022393_1301_1945	214
376	3300046524	Ga0495648_0031398	Ga0495648_0031398_1930_2577	214
377	3300046524	Ga0495648_0043069	Ga0495648_0043069_891_1583	214
378	3300046524	Ga0495648_0058665	Ga0495648_0058665_448_1134	214
379	3300046525	Ga0495663_0048740	Ga0495663_0048740_62_748	214
380	3300046526	Ga0495666_0019043	Ga0495666_0019043_657_1301	214
381	3300046528	Ga0495642_0003195	Ga0495642_0003195_3761_4405	214
382	3300046528	Ga0495642_0011766	Ga0495642_0011766_513_1160	214
383	3300046528	Ga0495642_0012301	Ga0495642_0012301_1330_1974	214
384	3300046528	Ga0495642_0013208	Ga0495642_0013208_918_1562	214
385	3300046528	Ga0495642_0128939	Ga0495642_0128939_412_1059	214
386	3300046530	Ga0495654_0090123	Ga0495654_0090123_93_737	214
387	3300046530	Ga0495654_0097401	Ga0495654_0097401_430_1074	214
388	3300046530	Ga0495654_0099259	Ga0495654_0099259_682_1326	214
389	3300046530	Ga0495654_0107132	Ga0495654_0107132_408_1052	214
390	3300046531	Ga0495665_0245868	Ga0495665_0245868_65_709	214
391	3300046531	Ga0495665_0400864	Ga0495665_0400864_26_670	214
392	3300046535	Ga0495586_0043652	Ga0495586_0043652_957_1601	214
393	3300046538	Ga0495609_0000030	Ga0495609_0000030_89233_89880	214
394	3300046538	Ga0495609_0010440	Ga0495609_0010440_2772_3482	214
395	3300046538	Ga0495609_0010610	Ga0495609_0010610_1254_1901	214
396	3300046538	Ga0495609_0037046	Ga0495609_0037046_715_1359	214
397	3300046538	Ga0495609_0056762	Ga0495609_0056762_85_729	214
398	3300046538	Ga0495609_0183994	Ga0495609_0183994_36_680	214
399	3300046542	Ga0495597_0026824	Ga0495597_0026824_1983_2627	214
400	3300046542	Ga0495597_0058467	Ga0495597_0058467_363_1049	214
401	3300046542	Ga0495597_0152101	Ga0495597_0152101_33_677	214
402	3300046542	Ga0495597_0153221	Ga0495597_0153221_25_711	214
403	3300046557	Ga0495622_0108602	Ga0495622_0108602_554_1198	214
404	3300046558	Ga0495633_0000271	Ga0495633_0000271_2494_3177	214
405	3300046558	Ga0495633_0012923	Ga0495633_0012923_2481_3173	214
406	3300046558	Ga0495633_0018039	Ga0495633_0018039_2186_2830	214
407	3300046558	Ga0495633_0019858	Ga0495633_0019858_373_1020	214
408	3300046558	Ga0495633_0024173	Ga0495633_0024173_1139_1783	214
409	3300046558	Ga0495633_0176617	Ga0495633_0176617_194_838	214
410	3300046615	Ga0495656_0049916	Ga0495656_0049916_860_1507	214
411	3300046615	Ga0495656_0068480	Ga0495656_0068480_756_1442	214
412	3300046616	Ga0495668_0020751	Ga0495668_0020751_2192_2839	214
413	3300046616	Ga0495668_0022209	Ga0495668_0022209_2176_2868	214
414	3300046616	Ga0495668_0026520	Ga0495668_0026520_616_1260	214
415	3300046648	Ga0495611_0089313	Ga0495611_0089313_249_893	214
416	3300046660	Ga0495625_0159012	Ga0495625_0159012_646_1290	214
417	3300046660	Ga0495625_0318682	Ga0495625_0318682_321_965	214
418	3300046660	Ga0495625_0335045	Ga0495625_0335045_289_933	214
419	3300046660	Ga0495625_0356308	Ga0495625_0356308_249_893	214
420	3300046663	Ga0495635_0001055	Ga0495635_0001055_15263_15907	214
421	3300046665	Ga0495661_0003016	Ga0495661_0003016_7951_8598	214
422	3300046665	Ga0495661_0023036	Ga0495661_0023036_2767_3414	214
423	3300046665	Ga0495661_0026310	Ga0495661_0026310_2069_2713	214
424	3300046665	Ga0495661_0053811	Ga0495661_0053811_1397_2044	214
425	3300046665	Ga0495661_0066768	Ga0495661_0066768_751_1398	214
426	3300046665	Ga0495661_0069649	Ga0495661_0069649_703_1347	214
427	3300046665	Ga0495661_0089806	Ga0495661_0089806_895_1581	214
428	3300046674	Ga0495588_0000078	Ga0495588_0000078_25528_26175	214
429	3300046674	Ga0495588_0021100	Ga0495588_0021100_2246_2890	214
430	3300046674	Ga0495588_0032117	Ga0495588_0032117_1158_1802	214
431	3300046679	Ga0495623_0078531	Ga0495623_0078531_1039_1683	214
432	3300046684	Ga0495669_0000057	Ga0495669_0000057_75801_76445	214
433	3300046684	Ga0495669_0052105	Ga0495669_0052105_1112_1756	214
434	3300046684	Ga0495669_0272872	Ga0495669_0272872_139_786	214
435	3300046689	Ga0495613_0052335	Ga0495613_0052335_971_1615	214
436	3300046689	Ga0495613_0265214	Ga0495613_0265214_99_743	214
437	3300046691	Ga0495670_0031651	Ga0495670_0031651_1045_1731	214
438	3300046691	Ga0495670_0037555	Ga0495670_0037555_348_995	214
439	3300046691	Ga0495670_0037740	Ga0495670_0037740_1093_1737	214
440	3300046691	Ga0495670_0038742	Ga0495670_0038742_348_992	214
441	3300046691	Ga0495670_0123074	Ga0495670_0123074_467_1111	214
442	3300046692	Ga0495671_0014453	Ga0495671_0014453_2532_3176	214
443	3300046692	Ga0495671_0106501	Ga0495671_0106501_447_1094	214
444	3300046692	Ga0495671_0270608	Ga0495671_0270608_149_793	214
445	3300046694	Ga0495649_0016251	Ga0495649_0016251_2193_2840	214
446	3300046694	Ga0495649_0048714	Ga0495649_0048714_123_767	214
447	3300046694	Ga0495649_0054619	Ga0495649_0054619_293_940	214
448	3300046794	Ga0495589_0000021	Ga0495589_0000021_89533_90180	214
449	3300046794	Ga0495589_0015027	Ga0495589_0015027_2207_2854	214
450	3300046794	Ga0495589_0018583	Ga0495589_0018583_464_1108	214
451	3300046794	Ga0495589_0033697	Ga0495589_0033697_1681_2325	214
452	3300046810	Ga0495660_0018126	Ga0495660_0018126_936_1583	214
453	3300046810	Ga0495660_0043715	Ga0495660_0043715_1380_2063	214
454	3300046810	Ga0495660_0048746	Ga0495660_0048746_1271_1981	214
455	3300046810	Ga0495660_0090284	Ga0495660_0090284_248_892	214
456	3300046810	Ga0495660_0100935	Ga0495660_0100935_254_898	214
457	3300046810	Ga0495660_0191465	Ga0495660_0191465_55_702	214
458	3300047315	Ga0495581_0024181	Ga0495581_0024181_974_1618	214
459	3300047317	Ga0495604_0125913	Ga0495604_0125913_539_1183	214
460	3300047318	Ga0495636_0027149	Ga0495636_0027149_429_1115	214
461	3300047318	Ga0495636_0192061	Ga0495636_0192061_260_904	214
462	3300047320	Ga0495672_0000031	Ga0495672_0000031_109179_109862	214
463	3300047320	Ga0495672_0019596	Ga0495672_0019596_2558_3205	214
464	3300047320	Ga0495672_0024609	Ga0495672_0024609_2899_3543	214
465	3300047320	Ga0495672_0114201	Ga0495672_0114201_639_1286	214
466	3300047321	Ga0495676_0037581	Ga0495676_0037581_2445_3089	214
467	3300047321	Ga0495676_0290304	Ga0495676_0290304_380_1027	214
468	3300047322	Ga0495680_0045790	Ga0495680_0045790_794_1438	214
469	3300047323	Ga0495683_0012100	Ga0495683_0012100_519_1166	214
470	3300047323	Ga0495683_0050854	Ga0495683_0050854_1095_1742	214
471	3300047443	Ga0495687_000407	Ga0495687_000407_1303_1950	214
472	3300047443	Ga0495687_017002	Ga0495687_017002_2584_3231	214
473	3300047444	Ga0495675_0023477	Ga0495675_0023477_616_1260	214
474	3300047445	Ga0495677_0000029	Ga0495677_0000029_1302_1949	214
475	3300047445	Ga0495677_0018533	Ga0495677_0018533_656_1300	214
476	3300047445	Ga0495677_0025206	Ga0495677_0025206_1230_1877	214
477	3300047445	Ga0495677_0117602	Ga0495677_0117602_349_996	214
478	3300047446	Ga0495679_022130	Ga0495679_022130_448_1095	214
479	3300047446	Ga0495679_033506	Ga0495679_033506_754_1398	214
480	3300047446	Ga0495679_041958	Ga0495679_041958_494_1138	214
481	3300047446	Ga0495679_071968	Ga0495679_071968_47_691	214
482	3300047447	Ga0495685_017538	Ga0495685_017538_1524_2168	214
483	3300047447	Ga0495685_037146	Ga0495685_037146_736_1380	214
484	3300047447	Ga0495685_046579	Ga0495685_046579_600_1244	214
485	3300047469	Ga0495673_0000026	Ga0495673_0000026_351604_352296	214
486	3300047470	Ga0495681_0017670	Ga0495681_0017670_792_1436	214
487	3300047470	Ga0495681_0020448	Ga0495681_0020448_2447_3094	214
488	3300047470	Ga0495681_0030366	Ga0495681_0030366_1877_2521	214
489	3300047470	Ga0495681_0068128	Ga0495681_0068128_333_1043	214
490	3300047472	Ga0495686_0000738	Ga0495686_0000738_41607_42254	214
491	3300047472	Ga0495686_0125112	Ga0495686_0125112_584_1231	214
492	3300047673	Ga0495593_0015115	Ga0495593_0015115_2569_3213	214
493	3300048089	Ga0495614_0003050	Ga0495614_0003050_4101_4745	214
494	3300048090	Ga0495615_0065675	Ga0495615_0065675_59_745	214
495	3300048091	Ga0495626_0009200	Ga0495626_0009200_4004_4651	214
496	3300048091	Ga0495626_0015845	Ga0495626_0015845_652_1338	214
497	3300048091	Ga0495626_0016880	Ga0495626_0016880_767_1411	214
498	3300048091	Ga0495626_0033977	Ga0495626_0033977_311_958	214
499	3300048091	Ga0495626_0184133	Ga0495626_0184133_104_787	214
500	3300048903	Ga0496100_0367224	Ga0496100_0367224_371_1018	214
501	3300048904	Ga0496101_0020529	Ga0496101_0020529_689_1336	214
502	3300048905	Ga0496102_0000198	Ga0496102_0000198_77248_77892	214
503	3300048905	Ga0496102_0132452	Ga0496102_0132452_911_1558	214
504	3300048907	Ga0496104_0264325	Ga0496104_0264325_86_769	214
505	3300048914	Ga0496111_0027877	Ga0496111_0027877_2648_3331	214
506	3300048914	Ga0496111_0618430	Ga0496111_0618430_123_770	214
507	3300048919	Ga0496116_0017608	Ga0496116_0017608_2105_2788	214
508	3300048920	Ga0496117_0000045	Ga0496117_0000045_68968_69651	214
509	3300048921	Ga0496118_0000041	Ga0496118_0000041_68968_69651	214
510	3300048924	Ga0496121_0079669	Ga0496121_0079669_1260_1943	214
511	3300048924	Ga0496121_0114323	Ga0496121_0114323_1231_1926	214
512	3300048925	Ga0496122_0036552	Ga0496122_0036552_914_1597	214
513	3300048925	Ga0496122_0057424	Ga0496122_0057424_693_1340	214
514	3300048926	Ga0496123_0028191	Ga0496123_0028191_851_1534	214
515	3300048927	Ga0496124_0140028	Ga0496124_0140028_327_974	214
516	3300048927	Ga0496124_0145645	Ga0496124_0145645_169_816	214
517	3300048927	Ga0496124_0239756	Ga0496124_0239756_32_679	214
518	3300048927	Ga0496124_0309645	Ga0496124_0309645_111_803	214
519	3300048927	Ga0496124_0565536	Ga0496124_0565536_74_721	214
520	3300048928	Ga0496125_0056065	Ga0496125_0056065_1037_1720	214
521	3300048928	Ga0496125_0135794	Ga0496125_0135794_570_1265	214
522	3300048928	Ga0496125_0143533	Ga0496125_0143533_538_1185	214
523	3300048928	Ga0496125_0216187	Ga0496125_0216187_356_1003	214
524	3300048929	Ga0496126_0116721	Ga0496126_0116721_1158_1850	214
525	3300049459	Ga0495678_000006	Ga0495678_000006_388020_388730	214
526	3300049459	Ga0495678_019925	Ga0495678_019925_2129_2776	214
527	3300049460	Ga0495682_0012989	Ga0495682_0012989_2431_3114	214
528	3300049581	Ga0501047_0208966	Ga0501047_0208966_94_741	214
529	3300049704	Ga0501221_028769	Ga0501221_028769_407_1054	214
530	3300049707	Ga0501234_041180	Ga0501234_041180_60_707	214
531	3300049775	Ga0501279_024022	Ga0501279_024022_102_749	214
532	3300049823	Ga0501044_0333125	Ga0501044_0333125_485_1132	214
533	3300049823	Ga0501044_0624804	Ga0501044_0624804_45_689	214
534	3300050496	nmdc:mga07m45_196608_c1	nmdc:mga07m45_196608_c1_295_1026	214
535	3300053125	Ga0500618_000274	Ga0500618_000274_38282_38974	214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

38

236

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8esq-assembly1.cif.gz_w	ytm1 associated nascent 60s ribosome state 2	0.9295	17	214
6jpl-assembly2.cif.gz_D	the x-ray structure of yeast trna methyltransferase trm7-trm734 in complex with s-adenosyl-l-methionine	0.9291	17	214
1ej0-assembly1.cif.gz_A	ftsj rna methyltransferase complexed with s-adenosylmethionine, mercury derivative	0.9213	29	211
8etc-assembly1.cif.gz_w	fkbp39 associated nascent 60s ribosome state 4	0.9176	17	214
7o9m-assembly1.cif.gz_n	human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module	0.9119	1	210

ID	Description	Score	Start	End	Superfamily
af_Q5RJT2_23_207_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9389	28	210	3.40.50.150
1ej0A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9213	29	211	3.40.50.150
af_O62251_31_214_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9098	28	212	3.40.50.150
af_Q9VDT6_58_249_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9083	28	214	3.40.50.150
af_Q9VEP1_20_211_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9066	28	214	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A6A5KUH4-F1-model_v4	deleted	0.9961	26	214
AF-A0A7W5B888-F1-model_v4	Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase)	0.9931	12	213	GO:0005737 GO:0008650
AF-A0A519PCG8-F1-model_v4	deleted	0.9902	77	214
AF-A0A840L5Y9-F1-model_v4	Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase)	0.9797	12	214	GO:0005737 GO:0008650
AF-A0A519PCG8-F1-model_v4	deleted	0.9761	77	214

Feature Viewer

pLDDT	pTM	Quality
92.72	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460638

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01728

FtsJ

FtsJ-like methyltransferase

38

236

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map