F460624

General Info

Members Datasets Scaffolds Average Seq Length
535 270 1070 109

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10157713|Ga0070709_101577132
Length 111
Sequence MVGITDRLEAMLQISENAGRLIRKMTAKNGFPEGGLRVGIKAGGCSGLSYTFAWEPAPRDGDHVFEGPDPKSFTFLDGTTLDYDTSLVSKGFIFNNPNAKSSCGCGTSFSV

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
200 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
201 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
202 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
203 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
206 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
207 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
208 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
227 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
228 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
229 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
230 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
231 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
234 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
235 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
236 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
237 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
238 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
239 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
244 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 0
Rhizoplane 2.43
Rhizosphere 91.4
Stem 0
Stem Tuber 0
Unclassified 20.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10157713 3300005434 Bacteria 1575
2 JGI24033J26618_1064435 3300002155 Unclassified 543
3 JGI24751J29686_10001466 3300002459 Bacteria 4932
4 Ga0007429J51699_1090304 3300003579 Bacteria 769
5 Ga0058863_11905902 3300004799 Bacteria 1367
6 Ga0065704_10008776 3300005289 Unclassified 2306
7 Ga0065704_10325091 3300005289 Bacteria 846
8 Ga0065712_10083822 3300005290 Bacteria 2807
9 Ga0065712_10104173 3300005290 Bacteria 1967
10 Ga0065715_10012974 3300005293 Bacteria 1934
11 Ga0065715_10056330 3300005293 Bacteria 847
12 Ga0065715_10171964 3300005293 Bacteria 1540
13 Ga0065715_10394708 3300005293 Bacteria 889
14 Ga0065707_10094592 3300005295 Bacteria 3478
15 Ga0065707_10474221 3300005295 Bacteria 779
16 Ga0065707_10756313 3300005295 Bacteria 616
17 Ga0070676_10307191 3300005328 Bacteria 1077
18 Ga0070676_11019523 3300005328 Bacteria 622
19 Ga0070683_100000395 3300005329 Bacteria 30161
20 Ga0070670_100001073 3300005331 Bacteria 21719
21 Ga0070670_100020899 3300005331 Bacteria 5630
22 Ga0070670_100138933 3300005331 Bacteria 2101
23 Ga0070670_100401490 3300005331 Bacteria 1210
24 Ga0070677_10295593 3300005333 Bacteria 821
25 Ga0068869_100195378 3300005334 Bacteria 1593
26 Ga0068869_100195640 3300005334 Bacteria 1592
27 Ga0070666_11125314 3300005335 Bacteria 584
28 Ga0070680_100217995 3300005336 Unclassified 1610
29 Ga0070682_100590618 3300005337 Unclassified 875
30 Ga0070682_101341559 3300005337 Unclassified 609
31 Ga0070682_101440500 3300005337 Unclassified 590
32 Ga0070689_100417190 3300005340 Bacteria 1137
33 Ga0070661_100014579 3300005344 Bacteria 5541
34 Ga0070661_101222896 3300005344 Bacteria 629
35 Ga0070668_100291739 3300005347 Bacteria 1365
36 Ga0070668_100740408 3300005347 Bacteria 869
37 Ga0070669_100014851 3300005353 Bacteria 5548
38 Ga0070675_100394325 3300005354 Bacteria 1234
39 Ga0070671_100040881 3300005355 Bacteria 3853
40 Ga0070674_100626652 3300005356 Bacteria 912
41 Ga0070673_101031822 3300005364 Bacteria 767
42 Ga0070667_100418762 3300005367 Bacteria 1221
43 Ga0070667_100627132 3300005367 Bacteria 992
44 Ga0070703_10553193 3300005406 Unclassified 525
45 Ga0070713_100107319 3300005436 Bacteria 2429
46 Ga0070701_10669122 3300005438 Bacteria 695
47 Ga0070705_100561654 3300005440 Bacteria 877
48 Ga0070700_100354647 3300005441 Bacteria 1089
49 Ga0070694_100212446 3300005444 Bacteria 1448
50 Ga0070663_100695244 3300005455 Bacteria 864
51 Ga0070663_100916982 3300005455 Bacteria 758
52 Ga0070662_100067750 3300005457 Bacteria 2622
53 Ga0070662_101990024 3300005457 Unclassified 502
54 Ga0070681_10231209 3300005458 Bacteria 1764
55 Ga0070681_10818028 3300005458 Bacteria 849
56 Ga0070706_100384092 3300005467 Bacteria 1308
57 Ga0070706_101793827 3300005467 Bacteria 558
58 Ga0070699_101756495 3300005518 Unclassified 568
59 Ga0070699_102137038 3300005518 Bacteria 511
60 Ga0070684_100010724 3300005535 Bacteria 7273
61 Ga0070684_100194834 3300005535 Bacteria 1845
62 Ga0070672_100128128 3300005543 Bacteria 2084
63 Ga0070672_100350210 3300005543 Bacteria 1259
64 Ga0070672_101688363 3300005543 Unclassified 569
65 Ga0070686_100481410 3300005544 Bacteria 960
66 Ga0070695_101527711 3300005545 Bacteria 556
67 Ga0070696_101174394 3300005546 Bacteria 648
68 Ga0070693_100020176 3300005547 Bacteria 3510
69 Ga0070665_101666998 3300005548 Bacteria 645
70 Ga0070704_101965004 3300005549 Bacteria 543
71 Ga0070664_100001737 3300005564 Bacteria 17434
72 Ga0070664_100295348 3300005564 Bacteria 1463
73 Ga0070664_101219691 3300005564 Bacteria 710
74 Ga0070664_101356399 3300005564 Bacteria 672
75 Ga0068857_100002325 3300005577 Bacteria 15456
76 Ga0068857_101914056 3300005577 Bacteria 581
77 Ga0068854_100173209 3300005578 Bacteria 1681
78 Ga0070702_100802759 3300005615 Bacteria 728
79 Ga0068852_100776857 3300005616 Bacteria 971
80 Ga0068864_100247100 3300005618 Bacteria 1655
81 Ga0068864_100610685 3300005618 Bacteria 1059
82 Ga0068864_101208195 3300005618 Unclassified 755
83 Ga0068861_100378744 3300005719 Bacteria 1249
84 Ga0068861_100470500 3300005719 Bacteria 1130
85 Ga0068861_100963225 3300005719 Bacteria 812
86 Ga0068861_101802156 3300005719 Unclassified 607
87 Ga0068851_10359268 3300005834 Bacteria 849
88 Ga0068870_10501563 3300005840 Unclassified 809
89 Ga0068863_100469340 3300005841 Bacteria 1237
90 Ga0068863_100680035 3300005841 Bacteria 1022
91 Ga0068860_100863050 3300005843 Bacteria 920
92 Ga0068862_100107508 3300005844 Bacteria 2446
93 Ga0081455_10446930 3300005937 Unclassified 884
94 Ga0070717_10225094 3300006028 Unclassified 1650
95 Ga0075365_10043964 3300006038 Bacteria 2925
96 Ga0075368_10389650 3300006042 Unclassified 611
97 Ga0075368_10510878 3300006042 Unclassified 537
98 Ga0075363_101016679 3300006048 Unclassified 511
99 Ga0075364_10011067 3300006051 Bacteria 5474
100 Ga0075432_10604119 3300006058 Unclassified 502
101 Ga0070712_100997441 3300006175 Bacteria 725
102 Ga0075367_10105704 3300006178 Bacteria 1724
103 Ga0075367_10357734 3300006178 Bacteria 922
104 Ga0075367_11131461 3300006178 Viruses 501
105 Ga0075369_10322488 3300006186 Bacteria 723
106 Ga0075427_10035780 3300006194 Bacteria 826
107 Ga0075366_10064886 3300006195 Bacteria 2171
108 Ga0075366_10649626 3300006195 Bacteria 654
109 Ga0075366_10935963 3300006195 Bacteria 540
110 Ga0097621_102152191 3300006237 Unclassified 533
111 Ga0075370_10630958 3300006353 Bacteria 650
112 Ga0075370_10691525 3300006353 Bacteria 620
113 Ga0075370_10887053 3300006353 Bacteria 545
114 Ga0075428_100000851 3300006844 Bacteria 32103
115 Ga0075428_101543953 3300006844 Unclassified 695
116 Ga0075428_101861095 3300006844 Unclassified 626
117 Ga0075430_100000028 3300006846 Bacteria 74712
118 Ga0075430_100025817 3300006846 Bacteria 4999
119 Ga0075430_100046764 3300006846 Bacteria 3654
120 Ga0075430_100219485 3300006846 Bacteria 1577
121 Ga0075430_100586239 3300006846 Unclassified 920
122 Ga0075430_100828039 3300006846 Unclassified 763
123 Ga0075430_101711805 3300006846 Bacteria 516
124 Ga0075431_100007315 3300006847 Bacteria 10994
125 Ga0075431_100075227 3300006847 Bacteria 3485
126 Ga0075431_100442426 3300006847 Bacteria 1296
127 Ga0075431_100809812 3300006847 Bacteria 909
128 Ga0075431_100946753 3300006847 Bacteria 830
129 Ga0075433_10034853 3300006852 Bacteria 4325
130 Ga0075433_10290971 3300006852 Bacteria 1447
131 Ga0075433_10392167 3300006852 Bacteria 1225
132 Ga0075433_11417453 3300006852 Bacteria 601
133 Ga0075434_100300047 3300006871 Bacteria 1627
134 Ga0075434_101397680 3300006871 Bacteria 710
135 Ga0075429_100002918 3300006880 Bacteria 14503
136 Ga0075429_100019750 3300006880 Bacteria 5841
137 Ga0075429_100315411 3300006880 Bacteria 1368
138 Ga0075429_100650898 3300006880 Unclassified 923
139 Ga0075429_100671230 3300006880 Bacteria 908
140 Ga0075429_101017929 3300006880 Unclassified 724
141 Ga0075429_101761104 3300006880 Unclassified 538
142 Ga0075436_100192529 3300006914 Bacteria 1443
143 Ga0075436_100773336 3300006914 Unclassified 714
144 Ga0075435_100402976 3300007076 Bacteria 1177
145 Ga0075435_101178534 3300007076 Bacteria 670
146 Ga0075435_101245951 3300007076 Bacteria 651
147 Ga0111539_10000166 3300009094 Bacteria 76156
148 Ga0111539_10002921 3300009094 Bacteria 22662
149 Ga0111539_10071185 3300009094 Bacteria 4104
150 Ga0111539_10081117 3300009094 Bacteria 3816
151 Ga0111539_10301063 3300009094 Bacteria 1866
152 Ga0111539_10655915 3300009094 Bacteria 1222
153 Ga0111539_10784813 3300009094 Bacteria 1109
154 Ga0111539_11132129 3300009094 Unclassified 909
155 Ga0105245_11379259 3300009098 Bacteria 755
156 Ga0105245_12283803 3300009098 Unclassified 595
157 Ga0114129_10000148 3300009147 Bacteria 74039
158 Ga0114129_10014377 3300009147 Bacteria 11282
159 Ga0114129_10043337 3300009147 Bacteria 6330
160 Ga0114129_10055286 3300009147 Bacteria 5564
161 Ga0114129_10084102 3300009147 Bacteria 4418
162 Ga0114129_11943484 3300009147 Bacteria 712
163 Ga0114129_12059641 3300009147 Bacteria 689
164 Ga0114129_12941971 3300009147 Bacteria 562
165 Ga0105243_10667357 3300009148 Bacteria 1009
166 Ga0105243_10689260 3300009148 Bacteria 994
167 Ga0105243_13129149 3300009148 Unclassified 501
168 Ga0105242_11969635 3300009176 Bacteria 626
169 Ga0105248_10029727 3300009177 Bacteria 6098
170 Ga0105248_10808262 3300009177 Unclassified 1058
171 Ga0105237_12113646 3300009545 Unclassified 572
172 Ga0105249_10001013 3300009553 Bacteria 24888
173 Ga0105249_10087475 3300009553 Bacteria 2907
174 Ga0105249_10321339 3300009553 Bacteria 1559
175 Ga0105249_10367573 3300009553 Bacteria 1461
176 Ga0105249_11376227 3300009553 Unclassified 778
177 Ga0105249_12328449 3300009553 Bacteria 608
178 Ga0105249_13091704 3300009553 Bacteria 535
179 Ga0105239_10222243 3300010375 Bacteria 2118
180 Ga0105239_11917762 3300010375 Bacteria 687
181 Ga0105239_12514243 3300010375 Bacteria 600
182 Ga0105239_13022984 3300010375 Bacteria 548
183 Ga0105246_10059882 3300011119 Bacteria 2644
184 Ga0105246_10294223 3300011119 Bacteria 1308
185 Ga0105246_10403205 3300011119 Bacteria 1136
186 Ga0105246_12498113 3300011119 Bacteria 508
187 Ga0163162_10331475 3300013306 Bacteria 1654
188 Ga0163163_10071635 3300014325 Bacteria 3454
189 Ga0163163_13230874 3300014325 Unclassified 508
190 Ga0157380_10062071 3300014326 Bacteria 2992
191 Ga0157380_10243395 3300014326 Bacteria 1623
192 Ga0157380_10464914 3300014326 Bacteria 1219
193 Ga0157380_10508447 3300014326 Bacteria 1172
194 Ga0157380_11918688 3300014326 Bacteria 653
195 Ga0182008_10272493 3300014497 Unclassified 878
196 Ga0157377_10038473 3300014745 Unclassified 2641
197 Ga0157377_11455752 3300014745 Bacteria 543
198 Ga0157376_10852387 3300014969 Bacteria 927
199 Ga0157376_11189950 3300014969 Bacteria 790
200 Ga0207697_10020304 3300025315 Bacteria 2720
201 Ga0207653_10322952 3300025885 Unclassified 600
202 Ga0207688_10390393 3300025901 Bacteria 862
203 Ga0207699_10898470 3300025906 Bacteria 653
204 Ga0207645_10105261 3300025907 Bacteria 1823
205 Ga0207643_10259513 3300025908 Bacteria 1073
206 Ga0207684_10382683 3300025910 Bacteria 1210
207 Ga0207707_10152736 3300025912 Bacteria 2019
208 Ga0207707_10787520 3300025912 Bacteria 793
209 Ga0207693_10375026 3300025915 Bacteria 1113
210 Ga0207663_10168607 3300025916 Bacteria 1553
211 Ga0207649_10051034 3300025920 Bacteria 2561
212 Ga0207652_11893428 3300025921 Bacteria 502
213 Ga0207681_10033341 3300025923 Bacteria 3375
214 Ga0207650_10027978 3300025925 Bacteria 4039
215 Ga0207650_10122205 3300025925 Bacteria 2029
216 Ga0207650_10217761 3300025925 Bacteria 1535
217 Ga0207659_11588321 3300025926 Unclassified 558
218 Ga0207687_11426476 3300025927 Unclassified 595
219 Ga0207700_10792643 3300025928 Unclassified 847
220 Ga0207644_10072593 3300025931 Bacteria 2521
221 Ga0207706_10095145 3300025933 Bacteria 2620
222 Ga0207706_10124391 3300025933 Bacteria 2269
223 Ga0207706_11549597 3300025933 Bacteria 539
224 Ga0207670_11018861 3300025936 Bacteria 697
225 Ga0207669_10130974 3300025937 Bacteria 1723
226 Ga0207704_10730830 3300025938 Unclassified 822
227 Ga0207691_10129774 3300025940 Bacteria 2227
228 Ga0207691_10412333 3300025940 Bacteria 1151
229 Ga0207691_10515242 3300025940 Bacteria 1015
230 Ga0207711_10043315 3300025941 Bacteria 3838
231 Ga0207689_10090764 3300025942 Bacteria 2510
232 Ga0207661_10001442 3300025944 Bacteria 16036
233 Ga0207661_10078074 3300025944 Bacteria 2724
234 Ga0207679_10037654 3300025945 Bacteria 3440
235 Ga0207679_10246118 3300025945 Bacteria 1517
236 Ga0207651_11042681 3300025960 Bacteria 732
237 Ga0207712_10019593 3300025961 Bacteria 4422
238 Ga0207712_10544716 3300025961 Unclassified 997
239 Ga0207668_11084179 3300025972 Bacteria 718
240 Ga0207640_10528074 3300025981 Bacteria 987
241 Ga0207658_10125239 3300025986 Bacteria 2055
242 Ga0207639_11026201 3300026041 Bacteria 773
243 Ga0207678_10020493 3300026067 Bacteria 5797
244 Ga0207678_10526881 3300026067 Bacteria 1032
245 Ga0207678_11097466 3300026067 Unclassified 705
246 Ga0207708_10058368 3300026075 Bacteria 2944
247 Ga0207708_10411484 3300026075 Bacteria 1120
248 Ga0207708_10464440 3300026075 Bacteria 1056
249 Ga0207708_11021333 3300026075 Unclassified 719
250 Ga0207641_10776038 3300026088 Bacteria 947
251 Ga0207648_11028099 3300026089 Unclassified 772
252 Ga0207676_10232469 3300026095 Bacteria 1649
253 Ga0207676_10431830 3300026095 Bacteria 1238
254 Ga0207676_11161840 3300026095 Unclassified 764
255 Ga0207676_12055156 3300026095 Unclassified 570
256 Ga0207674_10005663 3300026116 Bacteria 14810
257 Ga0207674_10517479 3300026116 Bacteria 1153
258 Ga0207674_10762167 3300026116 Bacteria 934
259 Ga0207674_11557171 3300026116 Unclassified 630
260 Ga0207675_100742201 3300026118 Bacteria 993
261 Ga0207675_100786543 3300026118 Unclassified 964
262 Ga0207675_101090366 3300026118 Bacteria 818
263 Ga0207675_102316997 3300026118 Bacteria 550
264 Ga0207698_10553956 3300026142 Unclassified 1127
265 Ga0209996_1047199 3300027395 Bacteria 648
266 Ga0209999_1038895 3300027543 Bacteria 890
267 Ga0210002_1087658 3300027617 Unclassified 557
268 Ga0209983_1049745 3300027665 Bacteria 916
269 Ga0209813_10025392 3300027866 Bacteria 1703
270 Ga0209974_10050973 3300027876 Bacteria 1391
271 Ga0207428_10000251 3300027907 Bacteria 73186
272 Ga0207428_10069610 3300027907 Bacteria 2767
273 Ga0207428_10382042 3300027907 Bacteria 1033
274 Ga0207428_10582597 3300027907 Unclassified 807
275 Ga0207428_11308196 3300027907 Unclassified 502
276 Ga0268265_10012615 3300028380 Bacteria 5731
277 Ga0268264_10615161 3300028381 Bacteria 1072
278 Ga0307408_100031130 3300031548 Bacteria 3712
279 Ga0307408_100056330 3300031548 Bacteria 2850
280 Ga0307408_100129686 3300031548 Bacteria 1965
281 Ga0307408_100335122 3300031548 Bacteria 1279
282 Ga0307408_100361683 3300031548 Bacteria 1235
283 Ga0307408_100405885 3300031548 Bacteria 1171
284 Ga0307408_100662393 3300031548 Bacteria 934
285 Ga0307408_100806053 3300031548 Bacteria 853
286 Ga0307408_100936015 3300031548 Unclassified 795
287 Ga0307408_101205897 3300031548 Unclassified 706
288 Ga0307405_10210953 3300031731 Bacteria 1418
289 Ga0307405_10628448 3300031731 Bacteria 880
290 Ga0307405_10780827 3300031731 Unclassified 798
291 Ga0307413_10240297 3300031824 Bacteria 1337
292 Ga0307413_10926977 3300031824 Unclassified 742
293 Ga0307413_11286888 3300031824 Unclassified 639
294 Ga0307410_10029406 3300031852 Bacteria 3499
295 Ga0307410_10548679 3300031852 Bacteria 958
296 Ga0307406_10758888 3300031901 Bacteria 815
297 Ga0307406_10869738 3300031901 Bacteria 765
298 Ga0307406_11975067 3300031901 Unclassified 521
299 Ga0307407_10496424 3300031903 Unclassified 894
300 Ga0307412_10386492 3300031911 Bacteria 1135
301 Ga0307412_10625470 3300031911 Bacteria 915
302 Ga0307409_100042575 3300031995 Bacteria 3402
303 Ga0307409_100324643 3300031995 Bacteria 1442
304 Ga0307409_100746370 3300031995 Bacteria 982
305 Ga0307409_101355318 3300031995 Bacteria 737
306 Ga0307409_101445298 3300031995 Bacteria 714
307 Ga0307416_100047061 3300032002 Bacteria 3410
308 Ga0307416_100056872 3300032002 Bacteria 3160
309 Ga0307416_100322627 3300032002 Bacteria 1547
310 Ga0307416_100481065 3300032002 Bacteria 1302
311 Ga0307416_100588229 3300032002 Bacteria 1191
312 Ga0307416_100860529 3300032002 Bacteria 1005
313 Ga0307416_100994963 3300032002 Bacteria 941
314 Ga0307416_101061754 3300032002 Unclassified 914
315 Ga0307416_102011963 3300032002 Bacteria 680
316 Ga0307416_102186993 3300032002 Unclassified 654
317 Ga0307416_103516041 3300032002 Unclassified 524
318 Ga0307411_10049641 3300032005 Bacteria 2728
319 Ga0307411_10791283 3300032005 Unclassified 834
320 Ga0307411_10839415 3300032005 Bacteria 812
321 Ga0307411_10851524 3300032005 Bacteria 807
322 Ga0307411_10944206 3300032005 Bacteria 769
323 Ga0307411_11701283 3300032005 Unclassified 584
324 Ga0307415_100065827 3300032126 Bacteria 2527
325 Ga0307415_100076134 3300032126 Bacteria 2378
326 Ga0373926_0017533 3300035083 Bacteria 2458
327 Ga0373943_0329220 3300035170 Bacteria 872
328 Ga0373946_0197848 3300035171 Bacteria 961
329 Ga0373931_0076574 3300035691 Bacteria 1838
330 Ga0373935_0939739 3300035692 Bacteria 641
331 Ga0373933_0101084 3300035724 Bacteria 1789
332 Ga0373937_0000242 3300036401 Bacteria 53400
333 Ga0373925_0437051 3300037068 Bacteria 1070
334 Ga0439436_0076939 3300041404 Bacteria 929
335 Ga0451802_0862312 3300041460 Unclassified 626
336 Ga0451839_0196834 3300041496 Bacteria 615
337 Ga0451853_1337635 3300041512 Bacteria 838
338 Ga0451853_3888984 3300041512 Bacteria 958
339 Ga0439431_0019523 3300041997 Bacteria 1612
340 Ga0439431_0042697 3300041997 Bacteria 1159
341 Ga0439433_0012500 3300041999 Bacteria 1862
342 Ga0439443_038360 3300042003 Unclassified 812
343 Ga0439445_0019805 3300042004 Bacteria 1680
344 Ga0439449_0053735 3300042007 Bacteria 1489
345 Ga0439450_132971 3300042008 Unclassified 646
346 Ga0439456_035420 3300042013 Bacteria 1076
347 Ga0439462_0057983 3300042015 Bacteria 1046
348 Ga0450892_006509 3300042130 Bacteria 975
349 Ga0439446_0075291 3300042156 Bacteria 1038
350 Ga0439435_0006814 3300042436 Bacteria 2584
351 Ga0439435_0035448 3300042436 Unclassified 1376
352 Ga0439435_0076013 3300042436 Bacteria 1001
353 Ga0439435_0328583 3300042436 Unclassified 528
354 Ga0439444_0156832 3300042437 Unclassified 553
355 Ga0439464_0072928 3300042439 Bacteria 1017
356 Ga0439460_0012966 3300042461 Bacteria 2173
357 Ga0439460_0029156 3300042461 Bacteria 1561
358 Ga0451577_0026780 3300042876 Bacteria 5221
359 Ga0439440_0261504 3300042993 Unclassified 530
360 Ga0453684_0583540 3300044712 Bacteria 1227
361 Ga0495608_0335301 3300046511 Bacteria 932
362 Ga0495646_0153147 3300046680 Bacteria 1281
363 Ga0495613_0178152 3300046689 Bacteria 1506
364 Ga0496102_0553514 3300048905 Bacteria 1073
365 Ga0496102_1269638 3300048905 Bacteria 656
366 Ga0496104_0010475 3300048907 Bacteria 8282
367 Ga0496104_0170657 3300048907 Bacteria 2086
368 Ga0496105_0082859 3300048908 Bacteria 2649
369 Ga0496106_1330762 3300048909 Unclassified 557
370 Ga0496108_0001262 3300048911 Bacteria 19796
371 Ga0496109_0000421 3300048912 Bacteria 37279
372 Ga0496110_0319331 3300048913 Bacteria 1414
373 Ga0496111_0006141 3300048914 Bacteria 7773
374 Ga0496112_0041222 3300048915 Bacteria 4516
375 Ga0496113_0507820 3300048916 Bacteria 968
376 Ga0501290_047264 3300049513 Unclassified 661
377 Ga0501291_007724 3300049514 Bacteria 1467
378 Ga0501293_009223 3300049516 Bacteria 839
379 Ga0501295_061055 3300049518 Bacteria 825
380 Ga0501296_015698 3300049519 Bacteria 936
381 Ga0501296_067379 3300049519 Bacteria 550
382 Ga0501298_008205 3300049521 Bacteria 1749
383 Ga0501299_015937 3300049522 Bacteria 1325
384 Ga0501300_014495 3300049523 Bacteria 1150
385 Ga0501301_033383 3300049524 Unclassified 555
386 Ga0501313_041846 3300049529 Bacteria 617
387 Ga0501031_0127179 3300049568 Bacteria 1665
388 Ga0501036_0018868 3300049572 Bacteria 5786
389 Ga0501036_0150620 3300049572 Bacteria 1962
390 Ga0501036_0335775 3300049572 Bacteria 1262
391 Ga0501038_0297147 3300049574 Bacteria 1268
392 Ga0501038_0783094 3300049574 Bacteria 710
393 Ga0501039_0127163 3300049575 Bacteria 1999
394 Ga0501039_0196083 3300049575 Bacteria 1588
395 Ga0501040_0472204 3300049576 Bacteria 903
396 Ga0501041_0072762 3300049577 Bacteria 2112
397 Ga0501041_0178704 3300049577 Bacteria 1328
398 Ga0501041_1018436 3300049577 Unclassified 533
399 Ga0501041_1086936 3300049577 Unclassified 515
400 Ga0501042_0060792 3300049578 Bacteria 2699
401 Ga0501042_0098731 3300049578 Bacteria 2099
402 Ga0501043_1271626 3300049579 Bacteria 514
403 Ga0501046_0230763 3300049580 Bacteria 1368
404 Ga0501046_0312490 3300049580 Bacteria 1146
405 Ga0501046_0477594 3300049580 Unclassified 895
406 Ga0501046_1268740 3300049580 Bacteria 504
407 Ga0501048_1100726 3300049582 Bacteria 571
408 Ga0501068_1067405 3300049584 Unclassified 534
409 Ga0501071_0044620 3300049587 Bacteria 3180
410 Ga0501071_0571476 3300049587 Bacteria 869
411 Ga0501071_0754322 3300049587 Unclassified 750
412 Ga0501071_1462062 3300049587 Unclassified 528
413 Ga0501072_0122068 3300049588 Bacteria 2076
414 Ga0501072_0908247 3300049588 Unclassified 688
415 Ga0501074_0063852 3300049590 Bacteria 2652
416 Ga0501074_0110606 3300049590 Bacteria 1966
417 Ga0501074_0198561 3300049590 Bacteria 1430
418 Ga0501075_0048071 3300049591 Bacteria 3206
419 Ga0501075_1178975 3300049591 Bacteria 581
420 Ga0501075_1311175 3300049591 Unclassified 549
421 Ga0501075_1506679 3300049591 Unclassified 509
422 Ga0501076_0144576 3300049592 Bacteria 1933
423 Ga0501076_0490702 3300049592 Bacteria 1012
424 Ga0501076_1554888 3300049592 Unclassified 543
425 Ga0501077_0448697 3300049593 Bacteria 826
426 Ga0501077_0480592 3300049593 Bacteria 796
427 Ga0501077_0722447 3300049593 Bacteria 640
428 Ga0501207_096476 3300049654 Unclassified 588
429 Ga0501208_003459 3300049655 Bacteria 1770
430 Ga0501209_289233 3300049656 Unclassified 515
431 Ga0501214_011466 3300049659 Unclassified 993
432 Ga0501216_057231 3300049660 Bacteria 779
433 Ga0501217_011320 3300049661 Bacteria 1972
434 Ga0501217_263561 3300049661 Unclassified 559
435 Ga0501235_043790 3300049669 Bacteria 1027
436 Ga0501235_102922 3300049669 Unclassified 699
437 Ga0501246_038227 3300049676 Unclassified 565
438 Ga0501247_049806 3300049677 Unclassified 619
439 Ga0501249_141782 3300049679 Bacteria 599
440 Ga0501256_041317 3300049685 Unclassified 548
441 Ga0501257_077136 3300049686 Bacteria 856
442 Ga0501257_095822 3300049686 Unclassified 775
443 Ga0501221_081577 3300049704 Bacteria 779
444 Ga0501225_0046180 3300049705 Bacteria 1207
445 Ga0501079_0127835 3300049741 Bacteria 1977
446 Ga0501079_0153997 3300049741 Bacteria 1792
447 Ga0501079_0510885 3300049741 Bacteria 945
448 Ga0501080_0597609 3300049742 Unclassified 980
449 Ga0501080_1159171 3300049742 Bacteria 666
450 Ga0501080_1171475 3300049742 Bacteria 661
451 Ga0501081_0026527 3300049743 Bacteria 3908
452 Ga0501081_0057876 3300049743 Bacteria 2681
453 Ga0501081_0437916 3300049743 Bacteria 970
454 Ga0501273_012938 3300049770 Unclassified 1058
455 Ga0501273_044654 3300049770 Unclassified 664
456 Ga0501281_14472 3300049777 Unclassified 577
457 Ga0501035_0361597 3300049822 Bacteria 1213
458 Ga0501045_0014233 3300049824 Bacteria 5637
459 Ga0501045_1151894 3300049824 Bacteria 566
460 nmdc:mga03683_367114_c1 3300050489 Bacteria 683
461 nmdc:mga03n38_911031_c1 3300050490 Unclassified 517
462 nmdc:mga00v17_25857_c1 3300050491 Bacteria 3415
463 nmdc:mga0yw44_21313_c1 3300050492 Bacteria 3613
464 nmdc:mga0k408_18861_c1 3300050493 Bacteria 3851
465 nmdc:mga0k408_478432_c1 3300050493 Bacteria 739
466 nmdc:mga0k408_5430_c1 3300050493 Bacteria 2798
467 nmdc:mga0k408_868005_c1 3300050493 Bacteria 524
468 nmdc:mga06z11_213970_c1 3300050494 Bacteria 1124
469 nmdc:mga06z11_914206_c1 3300050494 Bacteria 535
470 nmdc:mga04h51_253925_c1 3300050495 Unclassified 705
471 nmdc:mga07m45_279456_c1 3300050496 Bacteria 971
472 nmdc:mga07m45_384967_c1 3300050496 Bacteria 814
473 nmdc:mga05p37_10683_c1 3300050507 Bacteria 10898
474 nmdc:mga05p37_14275_c1 3300050507 Bacteria 9538
475 nmdc:mga05p37_143537_c1 3300050507 Bacteria 2924
476 nmdc:mga05p37_1586940_c1 3300050507 Bacteria 646
477 nmdc:mga05p37_221_c1 3300050507 Bacteria 57542
478 nmdc:mga05p37_33177_c1 3300050507 Bacteria 5847
479 nmdc:mga05p37_39985_c1 3300050507 Bacteria 5759
480 nmdc:mga05p37_655179_c1 3300050507 Bacteria 1175
481 nmdc:mga05p37_945992_c1 3300050507 Unclassified 923
482 nmdc:mga09592_1129102_c1 3300050508 Bacteria 650
483 nmdc:mga09592_4212_c1 3300050508 Bacteria 11618
484 nmdc:mga09592_429308_c1 3300050508 Bacteria 1141
485 nmdc:mga09592_56000_c1 3300050508 Bacteria 3332
486 nmdc:mga09592_629998_c1 3300050508 Unclassified 917
487 nmdc:mga09592_883535_c1 3300050508 Unclassified 752
488 nmdc:mga0qj67_1456468_c1 3300050509 Bacteria 527
489 nmdc:mga0qj67_22636_c1 3300050509 Bacteria 4828
490 nmdc:mga0qj67_230602_c1 3300050509 Bacteria 1502
491 nmdc:mga0qj67_517817_c1 3300050509 Unclassified 958
492 nmdc:mga0qj67_5533_c1 3300050509 Bacteria 9236
493 nmdc:mga0qj67_6228_c1 3300050509 Bacteria 8759
494 nmdc:mga0qj67_66161_c1 3300050509 Bacteria 2878
495 nmdc:mga0qj67_97369_c1 3300050509 Bacteria 2369
496 nmdc:mga06r32_1801497_c1 3300050510 Unclassified 548
497 nmdc:mga06r32_216845_c1 3300050510 Bacteria 1901
498 nmdc:mga06r32_31449_c1 3300050510 Bacteria 4985
499 nmdc:mga06r32_563026_c1 3300050510 Bacteria 1113
500 nmdc:mga06r32_654_c1 3300050510 Bacteria 30275
501 nmdc:mga06r32_899055_c1 3300050510 Bacteria 842
502 nmdc:mga06r32_95222_c1 3300050510 Bacteria 2914
503 nmdc:mga08y16_109795_c1 3300050511 Bacteria 2872
504 nmdc:mga08y16_1221943_c1 3300050511 Bacteria 721
505 nmdc:mga08y16_1296095_c1 3300050511 Unclassified 695
506 nmdc:mga08y16_134381_c1 3300050511 Bacteria 2571
507 nmdc:mga08y16_21552_c1 3300050511 Bacteria 6804
508 nmdc:mga08y16_464_c1 3300050511 Bacteria 37766
509 nmdc:mga08y16_86300_c1 3300050511 Bacteria 3271
510 nmdc:mga0n895_1250455_c1 3300050512 Bacteria 715
511 nmdc:mga0n895_184060_c1 3300050512 Bacteria 2120
512 nmdc:mga0n895_190957_c1 3300050512 Bacteria 2079
513 nmdc:mga0n895_634770_c1 3300050512 Bacteria 1068
514 nmdc:mga0n895_916717_c1 3300050512 Bacteria 861
515 nmdc:mga0rr50_1014605_c1 3300050513 Bacteria 707
516 nmdc:mga0rr50_321958_c1 3300050513 Bacteria 1296
517 nmdc:mga0rr50_662960_c1 3300050513 Bacteria 890
518 nmdc:mga08x19_209417_c1 3300050514 Bacteria 1338
519 nmdc:mga0a205_206584_c1 3300050515 Bacteria 1853
520 nmdc:mga0a205_337938_c1 3300050515 Bacteria 1375
521 nmdc:mga0a205_478678_c1 3300050515 Bacteria 1103
522 nmdc:mga0a205_55210_c1 3300050515 Bacteria 3837
523 nmdc:mga0sz30_483524_c1 3300050516 Viruses 557
524 Ga0495601_0106201 3300053077 Bacteria 1816
525 Ga0501084_0047631 3300054114 Bacteria 3590
526 Ga0501084_0430417 3300054114 Bacteria 1115
527 Ga0501084_0828490 3300054114 Unclassified 779
528 Ga0590071_004872 3300059421 Bacteria 3240
529 Ga0590071_042873 3300059421 Bacteria 1090
530 Ga0590075_119001 3300059424 Bacteria 691
531 Ga0501082_0187068 3300060353 Bacteria 1802
532 Ga0501082_0198003 3300060353 Bacteria 1748
533 Ga0501082_0584785 3300060353 Unclassified 977
534 Ga0501082_1763094 3300060353 Unclassified 540
535 Ga0530510_0532110 3300061734 Bacteria 892
536 Ga0070709_10157713
537 JGI24033J26618_1064435
538 JGI24751J29686_10001466
539 Ga0007429J51699_1090304
540 Ga0058863_11905902
541 Ga0065704_10008776
542 Ga0065704_10325091
543 Ga0065712_10083822
544 Ga0065712_10104173
545 Ga0065715_10012974
546 Ga0065715_10056330
547 Ga0065715_10171964
548 Ga0065715_10394708
549 Ga0065707_10094592
550 Ga0065707_10474221
551 Ga0065707_10756313
552 Ga0070676_10307191
553 Ga0070676_11019523
554 Ga0070683_100000395
555 Ga0070670_100001073
556 Ga0070670_100020899
557 Ga0070670_100138933
558 Ga0070670_100401490
559 Ga0070677_10295593
560 Ga0068869_100195378
561 Ga0068869_100195640
562 Ga0070666_11125314
563 Ga0070680_100217995
564 Ga0070682_100590618
565 Ga0070682_101341559
566 Ga0070682_101440500
567 Ga0070689_100417190
568 Ga0070661_100014579
569 Ga0070661_101222896
570 Ga0070668_100291739
571 Ga0070668_100740408
572 Ga0070669_100014851
573 Ga0070675_100394325
574 Ga0070671_100040881
575 Ga0070674_100626652
576 Ga0070673_101031822
577 Ga0070667_100418762
578 Ga0070667_100627132
579 Ga0070703_10553193
580 Ga0070713_100107319
581 Ga0070701_10669122
582 Ga0070705_100561654
583 Ga0070700_100354647
584 Ga0070694_100212446
585 Ga0070663_100695244
586 Ga0070663_100916982
587 Ga0070662_100067750
588 Ga0070662_101990024
589 Ga0070681_10231209
590 Ga0070681_10818028
591 Ga0070706_100384092
592 Ga0070706_101793827
593 Ga0070699_101756495
594 Ga0070699_102137038
595 Ga0070684_100010724
596 Ga0070684_100194834
597 Ga0070672_100128128
598 Ga0070672_100350210
599 Ga0070672_101688363
600 Ga0070686_100481410
601 Ga0070695_101527711
602 Ga0070696_101174394
603 Ga0070693_100020176
604 Ga0070665_101666998
605 Ga0070704_101965004
606 Ga0070664_100001737
607 Ga0070664_100295348
608 Ga0070664_101219691
609 Ga0070664_101356399
610 Ga0068857_100002325
611 Ga0068857_101914056
612 Ga0068854_100173209
613 Ga0070702_100802759
614 Ga0068852_100776857
615 Ga0068864_100247100
616 Ga0068864_100610685
617 Ga0068864_101208195
618 Ga0068861_100378744
619 Ga0068861_100470500
620 Ga0068861_100963225
621 Ga0068861_101802156
622 Ga0068851_10359268
623 Ga0068870_10501563
624 Ga0068863_100469340
625 Ga0068863_100680035
626 Ga0068860_100863050
627 Ga0068862_100107508
628 Ga0081455_10446930
629 Ga0070717_10225094
630 Ga0075365_10043964
631 Ga0075368_10389650
632 Ga0075368_10510878
633 Ga0075363_101016679
634 Ga0075364_10011067
635 Ga0075432_10604119
636 Ga0070712_100997441
637 Ga0075367_10105704
638 Ga0075367_10357734
639 Ga0075367_11131461
640 Ga0075369_10322488
641 Ga0075427_10035780
642 Ga0075366_10064886
643 Ga0075366_10649626
644 Ga0075366_10935963
645 Ga0097621_102152191
646 Ga0075370_10630958
647 Ga0075370_10691525
648 Ga0075370_10887053
649 Ga0075428_100000851
650 Ga0075428_101543953
651 Ga0075428_101861095
652 Ga0075430_100000028
653 Ga0075430_100025817
654 Ga0075430_100046764
655 Ga0075430_100219485
656 Ga0075430_100586239
657 Ga0075430_100828039
658 Ga0075430_101711805
659 Ga0075431_100007315
660 Ga0075431_100075227
661 Ga0075431_100442426
662 Ga0075431_100809812
663 Ga0075431_100946753
664 Ga0075433_10034853
665 Ga0075433_10290971
666 Ga0075433_10392167
667 Ga0075433_11417453
668 Ga0075434_100300047
669 Ga0075434_101397680
670 Ga0075429_100002918
671 Ga0075429_100019750
672 Ga0075429_100315411
673 Ga0075429_100650898
674 Ga0075429_100671230
675 Ga0075429_101017929
676 Ga0075429_101761104
677 Ga0075436_100192529
678 Ga0075436_100773336
679 Ga0075435_100402976
680 Ga0075435_101178534
681 Ga0075435_101245951
682 Ga0111539_10000166
683 Ga0111539_10002921
684 Ga0111539_10071185
685 Ga0111539_10081117
686 Ga0111539_10301063
687 Ga0111539_10655915
688 Ga0111539_10784813
689 Ga0111539_11132129
690 Ga0105245_11379259
691 Ga0105245_12283803
692 Ga0114129_10000148
693 Ga0114129_10014377
694 Ga0114129_10043337
695 Ga0114129_10055286
696 Ga0114129_10084102
697 Ga0114129_11943484
698 Ga0114129_12059641
699 Ga0114129_12941971
700 Ga0105243_10667357
701 Ga0105243_10689260
702 Ga0105243_13129149
703 Ga0105242_11969635
704 Ga0105248_10029727
705 Ga0105248_10808262
706 Ga0105237_12113646
707 Ga0105249_10001013
708 Ga0105249_10087475
709 Ga0105249_10321339
710 Ga0105249_10367573
711 Ga0105249_11376227
712 Ga0105249_12328449
713 Ga0105249_13091704
714 Ga0105239_10222243
715 Ga0105239_11917762
716 Ga0105239_12514243
717 Ga0105239_13022984
718 Ga0105246_10059882
719 Ga0105246_10294223
720 Ga0105246_10403205
721 Ga0105246_12498113
722 Ga0163162_10331475
723 Ga0163163_10071635
724 Ga0163163_13230874
725 Ga0157380_10062071
726 Ga0157380_10243395
727 Ga0157380_10464914
728 Ga0157380_10508447
729 Ga0157380_11918688
730 Ga0182008_10272493
731 Ga0157377_10038473
732 Ga0157377_11455752
733 Ga0157376_10852387
734 Ga0157376_11189950
735 Ga0207697_10020304
736 Ga0207653_10322952
737 Ga0207688_10390393
738 Ga0207699_10898470
739 Ga0207645_10105261
740 Ga0207643_10259513
741 Ga0207684_10382683
742 Ga0207707_10152736
743 Ga0207707_10787520
744 Ga0207693_10375026
745 Ga0207663_10168607
746 Ga0207649_10051034
747 Ga0207652_11893428
748 Ga0207681_10033341
749 Ga0207650_10027978
750 Ga0207650_10122205
751 Ga0207650_10217761
752 Ga0207659_11588321
753 Ga0207687_11426476
754 Ga0207700_10792643
755 Ga0207644_10072593
756 Ga0207706_10095145
757 Ga0207706_10124391
758 Ga0207706_11549597
759 Ga0207670_11018861
760 Ga0207669_10130974
761 Ga0207704_10730830
762 Ga0207691_10129774
763 Ga0207691_10412333
764 Ga0207691_10515242
765 Ga0207711_10043315
766 Ga0207689_10090764
767 Ga0207661_10001442
768 Ga0207661_10078074
769 Ga0207679_10037654
770 Ga0207679_10246118
771 Ga0207651_11042681
772 Ga0207712_10019593
773 Ga0207712_10544716
774 Ga0207668_11084179
775 Ga0207640_10528074
776 Ga0207658_10125239
777 Ga0207639_11026201
778 Ga0207678_10020493
779 Ga0207678_10526881
780 Ga0207678_11097466
781 Ga0207708_10058368
782 Ga0207708_10411484
783 Ga0207708_10464440
784 Ga0207708_11021333
785 Ga0207641_10776038
786 Ga0207648_11028099
787 Ga0207676_10232469
788 Ga0207676_10431830
789 Ga0207676_11161840
790 Ga0207676_12055156
791 Ga0207674_10005663
792 Ga0207674_10517479
793 Ga0207674_10762167
794 Ga0207674_11557171
795 Ga0207675_100742201
796 Ga0207675_100786543
797 Ga0207675_101090366
798 Ga0207675_102316997
799 Ga0207698_10553956
800 Ga0209996_1047199
801 Ga0209999_1038895
802 Ga0210002_1087658
803 Ga0209983_1049745
804 Ga0209813_10025392
805 Ga0209974_10050973
806 Ga0207428_10000251
807 Ga0207428_10069610
808 Ga0207428_10382042
809 Ga0207428_10582597
810 Ga0207428_11308196
811 Ga0268265_10012615
812 Ga0268264_10615161
813 Ga0307408_100031130
814 Ga0307408_100056330
815 Ga0307408_100129686
816 Ga0307408_100335122
817 Ga0307408_100361683
818 Ga0307408_100405885
819 Ga0307408_100662393
820 Ga0307408_100806053
821 Ga0307408_100936015
822 Ga0307408_101205897
823 Ga0307405_10210953
824 Ga0307405_10628448
825 Ga0307405_10780827
826 Ga0307413_10240297
827 Ga0307413_10926977
828 Ga0307413_11286888
829 Ga0307410_10029406
830 Ga0307410_10548679
831 Ga0307406_10758888
832 Ga0307406_10869738
833 Ga0307406_11975067
834 Ga0307407_10496424
835 Ga0307412_10386492
836 Ga0307412_10625470
837 Ga0307409_100042575
838 Ga0307409_100324643
839 Ga0307409_100746370
840 Ga0307409_101355318
841 Ga0307409_101445298
842 Ga0307416_100047061
843 Ga0307416_100056872
844 Ga0307416_100322627
845 Ga0307416_100481065
846 Ga0307416_100588229
847 Ga0307416_100860529
848 Ga0307416_100994963
849 Ga0307416_101061754
850 Ga0307416_102011963
851 Ga0307416_102186993
852 Ga0307416_103516041
853 Ga0307411_10049641
854 Ga0307411_10791283
855 Ga0307411_10839415
856 Ga0307411_10851524
857 Ga0307411_10944206
858 Ga0307411_11701283
859 Ga0307415_100065827
860 Ga0307415_100076134
861 Ga0373926_0017533
862 Ga0373943_0329220
863 Ga0373946_0197848
864 Ga0373931_0076574
865 Ga0373935_0939739
866 Ga0373933_0101084
867 Ga0373937_0000242
868 Ga0373925_0437051
869 Ga0439436_0076939
870 Ga0451802_0862312
871 Ga0451839_0196834
872 Ga0451853_1337635
873 Ga0451853_3888984
874 Ga0439431_0019523
875 Ga0439431_0042697
876 Ga0439433_0012500
877 Ga0439443_038360
878 Ga0439445_0019805
879 Ga0439449_0053735
880 Ga0439450_132971
881 Ga0439456_035420
882 Ga0439462_0057983
883 Ga0450892_006509
884 Ga0439446_0075291
885 Ga0439435_0006814
886 Ga0439435_0035448
887 Ga0439435_0076013
888 Ga0439435_0328583
889 Ga0439444_0156832
890 Ga0439464_0072928
891 Ga0439460_0012966
892 Ga0439460_0029156
893 Ga0451577_0026780
894 Ga0439440_0261504
895 Ga0453684_0583540
896 Ga0495608_0335301
897 Ga0495646_0153147
898 Ga0495613_0178152
899 Ga0496102_0553514
900 Ga0496102_1269638
901 Ga0496104_0010475
902 Ga0496104_0170657
903 Ga0496105_0082859
904 Ga0496106_1330762
905 Ga0496108_0001262
906 Ga0496109_0000421
907 Ga0496110_0319331
908 Ga0496111_0006141
909 Ga0496112_0041222
910 Ga0496113_0507820
911 Ga0501290_047264
912 Ga0501291_007724
913 Ga0501293_009223
914 Ga0501295_061055
915 Ga0501296_015698
916 Ga0501296_067379
917 Ga0501298_008205
918 Ga0501299_015937
919 Ga0501300_014495
920 Ga0501301_033383
921 Ga0501313_041846
922 Ga0501031_0127179
923 Ga0501036_0018868
924 Ga0501036_0150620
925 Ga0501036_0335775
926 Ga0501038_0297147
927 Ga0501038_0783094
928 Ga0501039_0127163
929 Ga0501039_0196083
930 Ga0501040_0472204
931 Ga0501041_0072762
932 Ga0501041_0178704
933 Ga0501041_1018436
934 Ga0501041_1086936
935 Ga0501042_0060792
936 Ga0501042_0098731
937 Ga0501043_1271626
938 Ga0501046_0230763
939 Ga0501046_0312490
940 Ga0501046_0477594
941 Ga0501046_1268740
942 Ga0501048_1100726
943 Ga0501068_1067405
944 Ga0501071_0044620
945 Ga0501071_0571476
946 Ga0501071_0754322
947 Ga0501071_1462062
948 Ga0501072_0122068
949 Ga0501072_0908247
950 Ga0501074_0063852
951 Ga0501074_0110606
952 Ga0501074_0198561
953 Ga0501075_0048071
954 Ga0501075_1178975
955 Ga0501075_1311175
956 Ga0501075_1506679
957 Ga0501076_0144576
958 Ga0501076_0490702
959 Ga0501076_1554888
960 Ga0501077_0448697
961 Ga0501077_0480592
962 Ga0501077_0722447
963 Ga0501207_096476
964 Ga0501208_003459
965 Ga0501209_289233
966 Ga0501214_011466
967 Ga0501216_057231
968 Ga0501217_011320
969 Ga0501217_263561
970 Ga0501235_043790
971 Ga0501235_102922
972 Ga0501246_038227
973 Ga0501247_049806
974 Ga0501249_141782
975 Ga0501256_041317
976 Ga0501257_077136
977 Ga0501257_095822
978 Ga0501221_081577
979 Ga0501225_0046180
980 Ga0501079_0127835
981 Ga0501079_0153997
982 Ga0501079_0510885
983 Ga0501080_0597609
984 Ga0501080_1159171
985 Ga0501080_1171475
986 Ga0501081_0026527
987 Ga0501081_0057876
988 Ga0501081_0437916
989 Ga0501273_012938
990 Ga0501273_044654
991 Ga0501281_14472
992 Ga0501035_0361597
993 Ga0501045_0014233
994 Ga0501045_1151894
995 nmdc:mga03683_367114_c1
996 nmdc:mga03n38_911031_c1
997 nmdc:mga00v17_25857_c1
998 nmdc:mga0yw44_21313_c1
999 nmdc:mga0k408_18861_c1
1000 nmdc:mga0k408_478432_c1
1001 nmdc:mga0k408_5430_c1
1002 nmdc:mga0k408_868005_c1
1003 nmdc:mga06z11_213970_c1
1004 nmdc:mga06z11_914206_c1
1005 nmdc:mga04h51_253925_c1
1006 nmdc:mga07m45_279456_c1
1007 nmdc:mga07m45_384967_c1
1008 nmdc:mga05p37_10683_c1
1009 nmdc:mga05p37_14275_c1
1010 nmdc:mga05p37_143537_c1
1011 nmdc:mga05p37_1586940_c1
1012 nmdc:mga05p37_221_c1
1013 nmdc:mga05p37_33177_c1
1014 nmdc:mga05p37_39985_c1
1015 nmdc:mga05p37_655179_c1
1016 nmdc:mga05p37_945992_c1
1017 nmdc:mga09592_1129102_c1
1018 nmdc:mga09592_4212_c1
1019 nmdc:mga09592_429308_c1
1020 nmdc:mga09592_56000_c1
1021 nmdc:mga09592_629998_c1
1022 nmdc:mga09592_883535_c1
1023 nmdc:mga0qj67_1456468_c1
1024 nmdc:mga0qj67_22636_c1
1025 nmdc:mga0qj67_230602_c1
1026 nmdc:mga0qj67_517817_c1
1027 nmdc:mga0qj67_5533_c1
1028 nmdc:mga0qj67_6228_c1
1029 nmdc:mga0qj67_66161_c1
1030 nmdc:mga0qj67_97369_c1
1031 nmdc:mga06r32_1801497_c1
1032 nmdc:mga06r32_216845_c1
1033 nmdc:mga06r32_31449_c1
1034 nmdc:mga06r32_563026_c1
1035 nmdc:mga06r32_654_c1
1036 nmdc:mga06r32_899055_c1
1037 nmdc:mga06r32_95222_c1
1038 nmdc:mga08y16_109795_c1
1039 nmdc:mga08y16_1221943_c1
1040 nmdc:mga08y16_1296095_c1
1041 nmdc:mga08y16_134381_c1
1042 nmdc:mga08y16_21552_c1
1043 nmdc:mga08y16_464_c1
1044 nmdc:mga08y16_86300_c1
1045 nmdc:mga0n895_1250455_c1
1046 nmdc:mga0n895_184060_c1
1047 nmdc:mga0n895_190957_c1
1048 nmdc:mga0n895_634770_c1
1049 nmdc:mga0n895_916717_c1
1050 nmdc:mga0rr50_1014605_c1
1051 nmdc:mga0rr50_321958_c1
1052 nmdc:mga0rr50_662960_c1
1053 nmdc:mga08x19_209417_c1
1054 nmdc:mga0a205_206584_c1
1055 nmdc:mga0a205_337938_c1
1056 nmdc:mga0a205_478678_c1
1057 nmdc:mga0a205_55210_c1
1058 nmdc:mga0sz30_483524_c1
1059 Ga0495601_0106201
1060 Ga0501084_0047631
1061 Ga0501084_0430417
1062 Ga0501084_0828490
1063 Ga0590071_004872
1064 Ga0590071_042873
1065 Ga0590075_119001
1066 Ga0501082_0187068
1067 Ga0501082_0198003
1068 Ga0501082_0584785
1069 Ga0501082_1763094
1070 Ga0530510_0532110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

11

107

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8749 2 96
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8207 1 97
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8188 2 98
2k4z-assembly1.cif.gz_A solution nmr structure of allochromatium vinosum dsrr: northeast structural genomics consortium target op5 0.8092 1 97
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.799 1 97
ID Description Score Start End Superfamily
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8938 1 81 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8752 1 96 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8663 1 96 2.60.300.12
af_D4A4L5_49_154_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8492 1 108 2.60.300.12
af_P77667_17_122_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8431 1 108 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A524JLT7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9591 1 84 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A7W0SQ41-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9332 2 84 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A524JLT7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9266 1 84 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A7K1C811-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.919 1 78 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A1X0R4M4-F1-model_v4 ADP/ATP translocase (ADP,ATP carrier protein) 0.9181 2 85 GO:0005471
GO:0005743
GO:0016226
GO:0051536
GO:0140021
GO:1990544

Map