F460529

General Info

Members Datasets Scaffolds Average Seq Length
534 291 1068 244

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100090667|Ga0075434_1000906672
Length 269
Sequence MAGAAVHGRSVTDSPNLAPPVVRPGRIEWRSATILEVVAETPHSKTLVLDVPGWPGHTAGQHIDVRLTAEDGYQAQRSYSIASEPTRRTLSITIERLDDGEVSPYLTDALGVGDRMELRGPIGGYFVWDPSMGGPLFLVAGGSGIVPLMAMLRARAAAPPALRGAAAATLLYSSRSWNDVIYRDEIAKLSVDPGVRVIHTLTRSQPPGWTGFTRRIDADMLAEVTPAPPLRPQIFICGPTALVETAAQILVDLGHEPSRVKTERFGPTG

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
289 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
290 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
291 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0.37
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 2.81
Rhizosphere 92.7
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100090667 3300006871 Bacteria 3058
2 JGI25407J50210_10054586 3300003373 Bacteria 1010
3 Ga0070676_10010766 3300005328 Bacteria 4962
4 Ga0070683_100001756 3300005329 Bacteria 16878
5 Ga0070683_100179366 3300005329 Bacteria 2010
6 Ga0070683_100260940 3300005329 Bacteria 1648
7 Ga0070690_100123243 3300005330 Bacteria 1742
8 Ga0070690_100223397 3300005330 Bacteria 1321
9 Ga0070670_100007286 3300005331 Bacteria 9383
10 Ga0070670_100008265 3300005331 Bacteria 8862
11 Ga0068869_100012445 3300005334 Bacteria 5623
12 Ga0068869_100056558 3300005334 Bacteria 2861
13 Ga0070666_10164425 3300005335 Bacteria 1552
14 Ga0070680_100084587 3300005336 Bacteria 2620
15 Ga0070680_100779192 3300005336 Bacteria 824
16 Ga0070682_100144814 3300005337 Bacteria 1624
17 Ga0068868_100050648 3300005338 Bacteria 3262
18 Ga0068868_100245733 3300005338 Bacteria 1505
19 Ga0070660_100014112 3300005339 Bacteria 5751
20 Ga0070689_100565515 3300005340 Bacteria 981
21 Ga0070687_100011383 3300005343 Bacteria 3890
22 Ga0070687_100038721 3300005343 Bacteria 2391
23 Ga0070661_100000658 3300005344 Bacteria 25365
24 Ga0070661_100003502 3300005344 Bacteria 10808
25 Ga0070661_100179591 3300005344 Bacteria 1610
26 Ga0070692_10001326 3300005345 Bacteria 8905
27 Ga0070668_100006165 3300005347 Bacteria 8880
28 Ga0070668_100088522 3300005347 Bacteria 2438
29 Ga0070669_100123398 3300005353 Bacteria 1979
30 Ga0070675_100002261 3300005354 Bacteria 14281
31 Ga0070675_100007271 3300005354 Bacteria 8541
32 Ga0070674_100181893 3300005356 Bacteria 1611
33 Ga0070673_100104934 3300005364 Bacteria 2334
34 Ga0070688_100007773 3300005365 Bacteria 5791
35 Ga0070659_100015233 3300005366 Bacteria 5755
36 Ga0070659_100339113 3300005366 Bacteria 1259
37 Ga0070667_100018672 3300005367 Bacteria 5752
38 Ga0070703_10035463 3300005406 Bacteria 1528
39 Ga0070709_10031606 3300005434 Bacteria 3185
40 Ga0070714_100000712 3300005435 Bacteria 23564
41 Ga0070713_100095083 3300005436 Bacteria 2570
42 Ga0070713_100428796 3300005436 Bacteria 1239
43 Ga0070713_100432538 3300005436 Bacteria 1233
44 Ga0070710_10032631 3300005437 Bacteria 2822
45 Ga0070701_10006586 3300005438 Bacteria 4898
46 Ga0070711_100028155 3300005439 Bacteria 3694
47 Ga0070700_100024749 3300005441 Bacteria 3529
48 Ga0070700_100286855 3300005441 Bacteria 1196
49 Ga0070694_100005347 3300005444 Bacteria 7763
50 Ga0070708_100381547 3300005445 Bacteria 1329
51 Ga0070663_100011538 3300005455 Bacteria 5552
52 Ga0070662_100017848 3300005457 Bacteria 4789
53 Ga0070662_100061097 3300005457 Bacteria 2750
54 Ga0070662_100065099 3300005457 Bacteria 2671
55 Ga0070681_10034980 3300005458 Bacteria 5045
56 Ga0070681_10062500 3300005458 Unclassified 3697
57 Ga0070681_10072496 3300005458 Bacteria 3407
58 Ga0070685_10005008 3300005466 Bacteria 6710
59 Ga0070685_10016378 3300005466 Bacteria 3949
60 Ga0070685_10023400 3300005466 Bacteria 3382
61 Ga0070706_100000668 3300005467 Bacteria 38865
62 Ga0070707_100262605 3300005468 Bacteria 1680
63 Ga0070698_100152427 3300005471 Bacteria 2258
64 Ga0070698_100186078 3300005471 Bacteria 2015
65 Ga0070699_100014451 3300005518 Bacteria 6789
66 Ga0070679_100020539 3300005530 Bacteria 6440
67 Ga0070679_100068796 3300005530 Bacteria 3532
68 Ga0070684_100007867 3300005535 Bacteria 8315
69 Ga0070684_100032595 3300005535 Bacteria 4441
70 Ga0070684_100057398 3300005535 Bacteria 3399
71 Ga0070684_100157920 3300005535 Bacteria 2056
72 Ga0068853_100018198 3300005539 Bacteria 5812
73 Ga0070672_100021509 3300005543 Bacteria 4722
74 Ga0070672_100072421 3300005543 Bacteria 2743
75 Ga0070672_100112672 3300005543 Bacteria 2219
76 Ga0070695_100347552 3300005545 Bacteria 1110
77 Ga0070696_100007174 3300005546 Bacteria 7441
78 Ga0070665_100331413 3300005548 Bacteria 1527
79 Ga0070665_100732365 3300005548 Bacteria 1002
80 Ga0068855_100043694 3300005563 Bacteria 5306
81 Ga0070664_100010681 3300005564 Bacteria 7444
82 Ga0070664_100017505 3300005564 Bacteria 5886
83 Ga0070664_100019848 3300005564 Bacteria 5532
84 Ga0070664_100193927 3300005564 Bacteria 1811
85 Ga0068857_100019039 3300005577 Bacteria 6024
86 Ga0068857_100019880 3300005577 Bacteria 5902
87 Ga0068857_100069470 3300005577 Bacteria 3137
88 Ga0068857_100441318 3300005577 Bacteria 1216
89 Ga0068856_100061413 3300005614 Bacteria 3712
90 Ga0068852_100019682 3300005616 Bacteria 5349
91 Ga0068852_100404862 3300005616 Bacteria 1343
92 Ga0068859_100028126 3300005617 Bacteria 5636
93 Ga0068859_100117812 3300005617 Bacteria 2721
94 Ga0068864_100258235 3300005618 Bacteria 1620
95 Ga0068861_100028081 3300005719 Bacteria 4104
96 Ga0068851_10004142 3300005834 Bacteria 6526
97 Ga0068851_10008055 3300005834 Bacteria 4863
98 Ga0068870_10034339 3300005840 Bacteria 2595
99 Ga0068863_100054787 3300005841 Bacteria 3778
100 Ga0068863_100432687 3300005841 Bacteria 1290
101 Ga0068858_100502268 3300005842 Bacteria 1172
102 Ga0068860_100025240 3300005843 Bacteria 5735
103 Ga0068862_100018134 3300005844 Bacteria 5861
104 Ga0068862_100019553 3300005844 Bacteria 5654
105 Ga0068862_100854601 3300005844 Bacteria 892
106 Ga0081455_10008190 3300005937 Bacteria 10901
107 Ga0081455_10024097 3300005937 Bacteria 5645
108 Ga0081455_10024189 3300005937 Bacteria 5632
109 Ga0081538_10005715 3300005981 Bacteria 11121
110 Ga0081538_10005788 3300005981 Bacteria 11027
111 Ga0081538_10007167 3300005981 Bacteria 9680
112 Ga0081538_10029211 3300005981 Bacteria 3773
113 Ga0081538_10033115 3300005981 Bacteria 3446
114 Ga0081538_10038652 3300005981 Bacteria 3075
115 Ga0081538_10062529 3300005981 Bacteria 2122
116 Ga0081539_10000171 3300005985 Bacteria 152572
117 Ga0081539_10018784 3300005985 Bacteria 4771
118 Ga0081539_10054793 3300005985 Bacteria 2223
119 Ga0070717_10013924 3300006028 Bacteria 6178
120 Ga0070717_10025917 3300006028 Bacteria 4672
121 Ga0075363_100108118 3300006048 Bacteria 1544
122 Ga0075432_10021036 3300006058 Bacteria 2232
123 Ga0070712_100004691 3300006175 Bacteria 8451
124 Ga0070712_100062709 3300006175 Bacteria 2629
125 Ga0070712_100145990 3300006175 Bacteria 1811
126 Ga0075428_100027897 3300006844 Bacteria 6246
127 Ga0075428_100059263 3300006844 Bacteria 4192
128 Ga0075428_100290529 3300006844 Bacteria 1758
129 Ga0075430_100008234 3300006846 Bacteria 8807
130 Ga0075430_100008938 3300006846 Bacteria 8460
131 Ga0075431_100050038 3300006847 Bacteria 4309
132 Ga0075431_100067099 3300006847 Bacteria 3704
133 Ga0075431_100129736 3300006847 Bacteria 2601
134 Ga0075431_100182945 3300006847 Bacteria 2150
135 Ga0075433_10017618 3300006852 Bacteria 5923
136 Ga0075434_100007837 3300006871 Bacteria 9894
137 Ga0075434_100010719 3300006871 Bacteria 8607
138 Ga0075434_100063277 3300006871 Bacteria 3682
139 Ga0075434_100261342 3300006871 Bacteria 1750
140 Ga0075434_100682625 3300006871 Bacteria 1045
141 Ga0075429_100155808 3300006880 Bacteria 2000
142 Ga0075429_100267410 3300006880 Bacteria 1497
143 Ga0068865_100015495 3300006881 Bacteria 4863
144 Ga0075436_100182140 3300006914 Bacteria 1485
145 Ga0097620_100028126 3300006931 Bacteria 5636
146 Ga0097620_100117808 3300006931 Bacteria 2721
147 Ga0075435_100013076 3300007076 Bacteria 6164
148 Ga0111539_10071692 3300009094 Bacteria 4087
149 Ga0105245_10009949 3300009098 Bacteria 8281
150 Ga0105245_10731166 3300009098 Bacteria 1024
151 Ga0114129_10065213 3300009147 Bacteria 5083
152 Ga0114129_10091727 3300009147 Bacteria 4208
153 Ga0114129_10137214 3300009147 Bacteria 3355
154 Ga0114129_10382606 3300009147 Bacteria 1858
155 Ga0105243_10092077 3300009148 Bacteria 2498
156 Ga0105242_11113870 3300009176 Bacteria 804
157 Ga0105248_10030578 3300009177 Bacteria 6013
158 Ga0105248_10139171 3300009177 Bacteria 2738
159 Ga0105249_10005088 3300009553 Bacteria 11328
160 Ga0105249_10023201 3300009553 Bacteria 5565
161 Ga0105249_10079060 3300009553 Bacteria 3052
162 Ga0105239_10067284 3300010375 Bacteria 3935
163 Ga0157369_10408400 3300013105 Bacteria 1408
164 Ga0157374_10154479 3300013296 Bacteria 2233
165 Ga0157374_10165167 3300013296 Bacteria 2157
166 Ga0157374_10327260 3300013296 Bacteria 1520
167 Ga0157378_10428974 3300013297 Bacteria 1308
168 Ga0163162_10004814 3300013306 Bacteria 13027
169 Ga0163162_10387893 3300013306 Bacteria 1530
170 Ga0157372_10125855 3300013307 Bacteria 2946
171 Ga0157375_10009943 3300013308 Bacteria 8366
172 Ga0157375_10025329 3300013308 Bacteria 5510
173 Ga0157375_10610301 3300013308 Bacteria 1250
174 Ga0157375_10730454 3300013308 Bacteria 1142
175 Ga0157380_10029120 3300014326 Bacteria 4219
176 Ga0182008_10040075 3300014497 Bacteria 2340
177 Ga0157377_10025551 3300014745 Bacteria 3151
178 Ga0157377_10073256 3300014745 Bacteria 1984
179 Ga0157377_10139656 3300014745 Bacteria 1488
180 Ga0157377_10392712 3300014745 Bacteria 943
181 Ga0157379_10007896 3300014968 Bacteria 9222
182 Ga0157376_10133319 3300014969 Bacteria 2220
183 Ga0163161_10470909 3300017792 Bacteria 1018
184 Ga0206353_10093104 3300020082 Bacteria 1034
185 Ga0213874_10041730 3300021377 Bacteria 1375
186 Ga0213874_10096905 3300021377 Bacteria 976
187 Ga0213876_10061858 3300021384 Bacteria 1975
188 Ga0213875_10004629 3300021388 Bacteria 7502
189 Ga0213875_10010826 3300021388 Bacteria 4560
190 Ga0213875_10027008 3300021388 Bacteria 2731
191 Ga0224712_10039078 3300022467 Bacteria 1777
192 Ga0207697_10000898 3300025315 Bacteria 16842
193 Ga0207656_10093408 3300025321 Bacteria 1369
194 Ga0207692_10235426 3300025898 Bacteria 1091
195 Ga0207688_10027541 3300025901 Bacteria 3126
196 Ga0207680_10078330 3300025903 Bacteria 2070
197 Ga0207699_10042564 3300025906 Bacteria 2632
198 Ga0207645_10000447 3300025907 Bacteria 34363
199 Ga0207643_10030851 3300025908 Bacteria 2986
200 Ga0207643_10290856 3300025908 Bacteria 1015
201 Ga0207684_10000620 3300025910 Bacteria 42221
202 Ga0207707_10379444 3300025912 Bacteria 1215
203 Ga0207707_10396417 3300025912 Bacteria 1185
204 Ga0207693_10006071 3300025915 Bacteria 10005
205 Ga0207693_10007424 3300025915 Bacteria 9015
206 Ga0207693_10068466 3300025915 Bacteria 2778
207 Ga0207663_10017855 3300025916 Bacteria 3962
208 Ga0207660_10043254 3300025917 Bacteria 3165
209 Ga0207662_10032050 3300025918 Bacteria 3056
210 Ga0207657_10052681 3300025919 Bacteria 3530
211 Ga0207649_10003483 3300025920 Bacteria 8599
212 Ga0207649_10078122 3300025920 Bacteria 2135
213 Ga0207649_10324111 3300025920 Bacteria 1133
214 Ga0207649_10394253 3300025920 Bacteria 1034
215 Ga0207652_10010892 3300025921 Bacteria 7329
216 Ga0207646_10209466 3300025922 Bacteria 1761
217 Ga0207646_10244321 3300025922 Bacteria 1621
218 Ga0207681_10067205 3300025923 Bacteria 2484
219 Ga0207650_10001445 3300025925 Bacteria 17110
220 Ga0207650_10006703 3300025925 Bacteria 7852
221 Ga0207650_10036523 3300025925 Bacteria 3575
222 Ga0207659_10006902 3300025926 Bacteria 6978
223 Ga0207659_10147502 3300025926 Bacteria 1833
224 Ga0207659_10481743 3300025926 Bacteria 1048
225 Ga0207687_10144623 3300025927 Bacteria 1808
226 Ga0207700_10298450 3300025928 Bacteria 1390
227 Ga0207664_10011734 3300025929 Bacteria 6244
228 Ga0207664_10088406 3300025929 Bacteria 2535
229 Ga0207690_10002445 3300025932 Bacteria 11223
230 Ga0207690_10469112 3300025932 Bacteria 1014
231 Ga0207706_10000440 3300025933 Bacteria 44385
232 Ga0207706_10042231 3300025933 Bacteria 4041
233 Ga0207706_10207697 3300025933 Bacteria 1717
234 Ga0207709_10188783 3300025935 Bacteria 1462
235 Ga0207670_10123287 3300025936 Bacteria 1887
236 Ga0207670_10527705 3300025936 Bacteria 962
237 Ga0207669_10419108 3300025937 Bacteria 1053
238 Ga0207704_10073591 3300025938 Bacteria 2176
239 Ga0207691_10000391 3300025940 Bacteria 43895
240 Ga0207691_10002912 3300025940 Bacteria 16702
241 Ga0207691_10273211 3300025940 Bacteria 1455
242 Ga0207711_10136760 3300025941 Bacteria 2201
243 Ga0207689_10003907 3300025942 Bacteria 13574
244 Ga0207689_10076084 3300025942 Bacteria 2760
245 Ga0207661_10005073 3300025944 Bacteria 9240
246 Ga0207661_10042984 3300025944 Unclassified 3565
247 Ga0207661_10476774 3300025944 Bacteria 1139
248 Ga0207661_10491860 3300025944 Bacteria 1120
249 Ga0207679_10002220 3300025945 Bacteria 12002
250 Ga0207679_10013215 3300025945 Bacteria 5408
251 Ga0207679_10081472 3300025945 Bacteria 2475
252 Ga0207679_10195121 3300025945 Bacteria 1687
253 Ga0207651_10096299 3300025960 Bacteria 2182
254 Ga0207712_10176845 3300025961 Bacteria 1673
255 Ga0207658_10015784 3300025986 Bacteria 5184
256 Ga0207677_10086456 3300026023 Bacteria 2266
257 Ga0207677_10209137 3300026023 Bacteria 1557
258 Ga0207703_10260028 3300026035 Bacteria 1569
259 Ga0207703_10321401 3300026035 Bacteria 1417
260 Ga0207639_10169737 3300026041 Bacteria 1846
261 Ga0207678_10130419 3300026067 Bacteria 2144
262 Ga0207678_10154721 3300026067 Bacteria 1958
263 Ga0207708_10039461 3300026075 Bacteria 3597
264 Ga0207702_10126930 3300026078 Bacteria 2291
265 Ga0207641_10156503 3300026088 Bacteria 2068
266 Ga0207641_10266799 3300026088 Bacteria 1605
267 Ga0207648_10086800 3300026089 Bacteria 2730
268 Ga0207674_10000530 3300026116 Bacteria 50056
269 Ga0207674_10001224 3300026116 Bacteria 33464
270 Ga0207674_10220594 3300026116 Bacteria 1844
271 Ga0207675_100000151 3300026118 Bacteria 60922
272 Ga0207675_100003257 3300026118 Bacteria 15900
273 Ga0207683_10578938 3300026121 Bacteria 1038
274 Ga0207698_10036200 3300026142 Bacteria 3620
275 Ga0207698_10325577 3300026142 Bacteria 1441
276 Ga0207428_10003776 3300027907 Bacteria 14535
277 Ga0268266_10437794 3300028379 Bacteria 1241
278 Ga0268265_10148526 3300028380 Bacteria 1973
279 Ga0268265_10255609 3300028380 Bacteria 1555
280 Ga0268265_10829074 3300028380 Bacteria 903
281 Ga0268264_10021763 3300028381 Bacteria 5233
282 Ga0265319_1019090 3300028563 Bacteria 2568
283 Ga0265318_10015552 3300028577 Bacteria 3162
284 Ga0265338_10019153 3300028800 Bacteria 7282
285 Ga0265320_10002555 3300031240 Bacteria 12649
286 Ga0307408_100006366 3300031548 Bacteria 7834
287 Ga0307408_100371929 3300031548 Bacteria 1219
288 Ga0265313_10073008 3300031595 Bacteria 1576
289 Ga0265314_10124311 3300031711 Bacteria 1618
290 Ga0307405_10017456 3300031731 Bacteria 3938
291 Ga0307405_10026371 3300031731 Bacteria 3351
292 Ga0307405_10053331 3300031731 Bacteria 2518
293 Ga0307405_10269641 3300031731 Bacteria 1276
294 Ga0307413_10026936 3300031824 Bacteria 3177
295 Ga0307413_10146719 3300031824 Bacteria 1638
296 Ga0307413_10240557 3300031824 Bacteria 1336
297 Ga0307410_10009660 3300031852 Bacteria 5424
298 Ga0307410_10010720 3300031852 Bacteria 5209
299 Ga0307410_10044396 3300031852 Bacteria 2952
300 Ga0307410_10064523 3300031852 Bacteria 2516
301 Ga0307410_10073191 3300031852 Bacteria 2382
302 Ga0307410_10135015 3300031852 Bacteria 1818
303 Ga0307410_10314452 3300031852 Bacteria 1240
304 Ga0307410_10360585 3300031852 Bacteria 1164
305 Ga0307410_10461450 3300031852 Bacteria 1038
306 Ga0326468_10001639 3300031889 Bacteria 1924
307 Ga0307406_10003313 3300031901 Bacteria 8782
308 Ga0307406_10165444 3300031901 Bacteria 1595
309 Ga0307406_10478752 3300031901 Bacteria 1005
310 Ga0307407_10001431 3300031903 Bacteria 8633
311 Ga0307407_10005708 3300031903 Bacteria 5437
312 Ga0307407_10037664 3300031903 Bacteria 2674
313 Ga0307407_10176721 3300031903 Bacteria 1411
314 Ga0307407_10198401 3300031903 Bacteria 1343
315 Ga0307412_10026001 3300031911 Bacteria 3633
316 Ga0307412_10050541 3300031911 Bacteria 2744
317 Ga0307409_100007311 3300031995 Bacteria 6595
318 Ga0307409_100023700 3300031995 Bacteria 4261
319 Ga0307409_100076706 3300031995 Bacteria 2681
320 Ga0307409_100128176 3300031995 Bacteria 2163
321 Ga0307409_100920044 3300031995 Bacteria 889
322 Ga0307416_100007237 3300032002 Bacteria 7032
323 Ga0307416_100013211 3300032002 Bacteria 5604
324 Ga0307416_100017046 3300032002 Bacteria 5068
325 Ga0307416_100104727 3300032002 Bacteria 2474
326 Ga0307416_100109862 3300032002 Bacteria 2426
327 Ga0307416_100148178 3300032002 Bacteria 2147
328 Ga0307416_101095918 3300032002 Bacteria 901
329 Ga0307414_10003093 3300032004 Bacteria 8833
330 Ga0307414_10033067 3300032004 Bacteria 3414
331 Ga0307414_10095566 3300032004 Bacteria 2221
332 Ga0307414_10296919 3300032004 Bacteria 1365
333 Ga0307414_10407647 3300032004 Bacteria 1182
334 Ga0307411_10079757 3300032005 Bacteria 2249
335 Ga0307411_10542963 3300032005 Bacteria 990
336 Ga0307415_100018554 3300032126 Bacteria 4204
337 Ga0307415_100087467 3300032126 Bacteria 2245
338 Ga0307415_100454804 3300032126 Bacteria 1108
339 Ga0373955_0031525 3300035172 Bacteria 2778
340 Ga0373931_0091208 3300035691 Bacteria 1698
341 Ga0373933_0022199 3300035724 Bacteria 3612
342 Ga0373947_0324465 3300035725 Bacteria 1030
343 Ga0373937_0013060 3300036401 Bacteria 7315
344 Ga0373925_0021714 3300037068 Bacteria 4678
345 Ga0373925_0049994 3300037068 Bacteria 3118
346 Ga0395899_0036791 3300037312 Bacteria 3670
347 Ga0395899_0257926 3300037312 Bacteria 1194
348 Ga0395900_0075151 3300037418 Bacteria 3473
349 Ga0395900_0239014 3300037418 Unclassified 1823
350 Ga0395900_0279237 3300037418 Bacteria 1663
351 Ga0395898_0052296 3300037466 Bacteria 3991
352 Ga0395898_0062193 3300037466 Bacteria 3625
353 Ga0395898_0374780 3300037466 Bacteria 1357
354 Ga0395898_0450945 3300037466 Bacteria 1225
355 Ga0395905_0186071 3300037471 Bacteria 1949
356 Ga0395905_0268566 3300037471 Bacteria 1591
357 Ga0395905_0630101 3300037471 Unclassified 974
358 Ga0436364_0282082 3300037853 Bacteria 13841
359 Ga0436364_0440241 3300037853 Bacteria 3104
360 Ga0436364_1260739 3300037853 Bacteria 17238
361 Ga0436364_1536453 3300037853 Bacteria 4881
362 Ga0395901_0009166 3300038443 Bacteria 10025
363 Ga0395901_0064857 3300038443 Bacteria 3802
364 Ga0395901_0293626 3300038443 Bacteria 1686
365 Ga0395901_0434699 3300038443 Bacteria 1344
366 Ga0436365_0207828 3300039437 Bacteria 3383
367 Ga0436365_0813952 3300039437 Bacteria 18562
368 Ga0436365_1353607 3300039437 Bacteria 1959
369 Ga0436365_1613513 3300039437 Bacteria 5271
370 Ga0436365_1884457 3300039437 Bacteria 7851
371 Ga0436363_0060364 3300039450 Bacteria 5734
372 Ga0436363_0099119 3300039450 Bacteria 5537
373 Ga0436363_0445988 3300039450 Bacteria 811
374 Ga0436363_0842663 3300039450 Bacteria 1320
375 Ga0436362_0187069 3300039453 Bacteria 3044
376 Ga0436362_0716449 3300039453 Bacteria 2067
377 Ga0439443_002100 3300042003 Bacteria 2335
378 Ga0439448_0031802 3300042005 Bacteria 1677
379 Ga0439448_0129474 3300042005 Bacteria 869
380 Ga0439463_005498 3300042016 Bacteria 3149
381 Ga0439463_067685 3300042016 Bacteria 914
382 Ga0439464_0003724 3300042439 Bacteria 3868
383 Ga0439464_0052266 3300042439 Bacteria 1184
384 Ga0439460_0033932 3300042461 Bacteria 1468
385 Ga0451577_0256281 3300042876 Bacteria 1584
386 Ga0439440_0010707 3300042993 Bacteria 1922
387 Ga0466965_0084615 3300044683 Bacteria 1607
388 Ga0466966_0336404 3300044684 Bacteria 907
389 Ga0466963_0004101 3300044694 Bacteria 8424
390 Ga0466963_0010604 3300044694 Bacteria 5586
391 Ga0466963_0368395 3300044694 Bacteria 1012
392 Ga0466964_0059845 3300044706 Bacteria 1583
393 Ga0466968_0106029 3300044735 Bacteria 1259
394 Ga0466970_0219228 3300044765 Bacteria 1062
395 Ga0466960_0004994 3300044901 Bacteria 5229
396 Ga0466959_0076217 3300045049 Bacteria 2422
397 Ga0466959_0205861 3300045049 Bacteria 1369
398 Ga0466959_0228075 3300045049 Bacteria 1290
399 Ga0451576_0080471 3300045051 Bacteria 3389
400 Ga0451576_0555798 3300045051 Bacteria 1206
401 Ga0466958_0025085 3300045836 Bacteria 3512
402 Ga0466958_0128620 3300045836 Bacteria 1589
403 Ga0466967_0003457 3300045976 Bacteria 10310
404 Ga0466967_0008076 3300045976 Bacteria 7674
405 Ga0466967_0009632 3300045976 Bacteria 7180
406 Ga0466967_0022837 3300045976 Bacteria 5115
407 Ga0466967_0043548 3300045976 Bacteria 3887
408 Ga0466967_0049594 3300045976 Bacteria 3671
409 Ga0466967_0059575 3300045976 Bacteria 3380
410 Ga0466967_0091707 3300045976 Bacteria 2762
411 Ga0466967_0149322 3300045976 Bacteria 2183
412 Ga0466967_0215275 3300045976 Bacteria 1823
413 Ga0466967_0269170 3300045976 Bacteria 1632
414 Ga0466967_0452096 3300045976 Bacteria 1255
415 Ga0466967_0524505 3300045976 Bacteria 1164
416 Ga0495592_0066368 3300046454 Bacteria 2640
417 Ga0495592_0111471 3300046454 Bacteria 1936
418 Ga0495638_0002894 3300046460 Bacteria 13723
419 Ga0495641_0019769 3300046461 Bacteria 3435
420 Ga0495653_0008568 3300046463 Bacteria 8382
421 Ga0495584_0083179 3300046491 Bacteria 1612
422 Ga0495594_0010022 3300046499 Bacteria 4908
423 Ga0495608_0025179 3300046511 Bacteria 4061
424 Ga0495618_0125057 3300046514 Bacteria 1647
425 Ga0495628_0023133 3300046516 Bacteria 5103
426 Ga0495663_0039644 3300046525 Bacteria 1428
427 Ga0495652_0005199 3300046529 Bacteria 12300
428 Ga0495665_0231375 3300046531 Bacteria 954
429 Ga0495640_0078196 3300046533 Bacteria 2204
430 Ga0495587_0037005 3300046536 Bacteria 2933
431 Ga0495587_0148362 3300046536 Bacteria 1337
432 Ga0495633_0155948 3300046558 Bacteria 1054
433 Ga0495667_0027070 3300046559 Bacteria 3865
434 Ga0495656_0018660 3300046615 Bacteria 2669
435 Ga0495634_0014486 3300046642 Bacteria 5685
436 Ga0495657_0015762 3300046675 Bacteria 5522
437 Ga0495599_0100919 3300046678 Bacteria 1799
438 Ga0495646_0061746 3300046680 Bacteria 2230
439 Ga0495613_0057894 3300046689 Bacteria 2845
440 Ga0495600_0035321 3300046809 Bacteria 3245
441 Ga0495674_0009384 3300047319 Bacteria 9301
442 Ga0495676_0286586 3300047321 Bacteria 1114
443 Ga0495684_0007482 3300047471 Bacteria 8460
444 Ga0495602_0007957 3300048088 Bacteria 11078
445 Ga0496101_0426942 3300048904 Bacteria 1045
446 Ga0496104_0015792 3300048907 Bacteria 6849
447 Ga0496105_0101887 3300048908 Bacteria 2371
448 Ga0496105_0562896 3300048908 Bacteria 888
449 Ga0496108_0009220 3300048911 Bacteria 7988
450 Ga0496108_0120745 3300048911 Bacteria 2247
451 Ga0496108_0431395 3300048911 Bacteria 1151
452 Ga0496109_0047465 3300048912 Bacteria 3905
453 Ga0496110_0005264 3300048913 Bacteria 10126
454 Ga0496110_0610585 3300048913 Bacteria 989
455 Ga0496111_0010883 3300048914 Bacteria 6119
456 Ga0496112_0149216 3300048915 Bacteria 2305
457 Ga0496112_0380126 3300048915 Bacteria 1353
458 Ga0496115_0184917 3300048918 Bacteria 1722
459 Ga0496115_0348657 3300048918 Bacteria 1208
460 Ga0496126_0058595 3300048929 Bacteria 3471
461 Ga0496126_0195813 3300048929 Bacteria 1709
462 Ga0501031_0092059 3300049568 Bacteria 1978
463 Ga0501031_0168266 3300049568 Bacteria 1432
464 Ga0501033_0014629 3300049570 Bacteria 5958
465 Ga0501036_0188896 3300049572 Bacteria 1733
466 Ga0501037_0096009 3300049573 Bacteria 2142
467 Ga0501038_0208152 3300049574 Bacteria 1566
468 Ga0501039_0041502 3300049575 Bacteria 3554
469 Ga0501039_0086958 3300049575 Bacteria 2435
470 Ga0501040_0080882 3300049576 Bacteria 2251
471 Ga0501041_0096614 3300049577 Bacteria 1826
472 Ga0501042_0082354 3300049578 Bacteria 2307
473 Ga0501046_0031577 3300049580 Bacteria 4292
474 Ga0501046_0067810 3300049580 Bacteria 2777
475 Ga0501046_0445026 3300049580 Bacteria 932
476 Ga0501047_0081198 3300049581 Bacteria 3117
477 Ga0501047_0235312 3300049581 Bacteria 1683
478 Ga0501048_0179261 3300049582 Bacteria 1502
479 Ga0501048_0377227 3300049582 Bacteria 1012
480 Ga0501067_0256271 3300049583 Bacteria 974
481 Ga0501070_0020538 3300049586 Bacteria 5539
482 Ga0501072_0062626 3300049588 Bacteria 2934
483 Ga0501072_0207740 3300049588 Bacteria 1561
484 Ga0501072_0301728 3300049588 Bacteria 1273
485 Ga0501073_0052117 3300049589 Bacteria 2865
486 Ga0501074_0067340 3300049590 Bacteria 2575
487 Ga0501074_0187105 3300049590 Bacteria 1476
488 Ga0501075_0278658 3300049591 Bacteria 1274
489 Ga0501077_0186505 3300049593 Bacteria 1318
490 Ga0501202_030508 3300049652 Bacteria 1122
491 Ga0501080_0109580 3300049742 Bacteria 2559
492 Ga0501080_0419229 3300049742 Bacteria 1203
493 Ga0501083_0010832 3300049744 Bacteria 6414
494 Ga0501035_0023947 3300049822 Bacteria 5603
495 Ga0501045_0134227 3300049824 Bacteria 1840
496 Ga0501045_0147991 3300049824 Bacteria 1747
497 nmdc:mga03n38_152902_c1 3300050490 Bacteria 1162
498 nmdc:mga05p37_12682_c1 3300050507 Bacteria 10070
499 nmdc:mga05p37_161444_c1 3300050507 Bacteria 2737
500 nmdc:mga05p37_350343_c1 3300050507 Bacteria 1739
501 nmdc:mga09592_244414_c1 3300050508 Bacteria 1555
502 nmdc:mga09592_362761_c1 3300050508 Bacteria 1254
503 nmdc:mga09592_925_c1 3300050508 Bacteria 23011
504 nmdc:mga0qj67_16340_c1 3300050509 Bacteria 5627
505 nmdc:mga0qj67_1885_c1 3300050509 Bacteria 14865
506 nmdc:mga0qj67_406998_c1 3300050509 Bacteria 1098
507 nmdc:mga0qj67_8565_c1 3300050509 Bacteria 7590
508 nmdc:mga06r32_116307_c1 3300050510 Bacteria 2634
509 nmdc:mga06r32_1890_c1 3300050510 Bacteria 18684
510 nmdc:mga06r32_32772_c1 3300050510 Bacteria 4891
511 nmdc:mga06r32_673402_c1 3300050510 Bacteria 1002
512 nmdc:mga06r32_694856_c1 3300050510 Bacteria 983
513 nmdc:mga06r32_7179_c1 3300050510 Bacteria 10042
514 nmdc:mga08y16_34222_c1 3300050511 Bacteria 5338
515 nmdc:mga0n895_119422_c1 3300050512 Bacteria 2657
516 nmdc:mga0n895_1875_c1 3300050512 Bacteria 16066
517 nmdc:mga0n895_3326_c1 3300050512 Bacteria 12920
518 nmdc:mga0n895_87961_c1 3300050512 Bacteria 3105
519 nmdc:mga08x19_468275_c1 3300050514 Unclassified 888
520 nmdc:mga0a205_11059_c1 3300050515 Bacteria 6082
521 nmdc:mga0a205_219793_c1 3300050515 Bacteria 1786
522 nmdc:mga0a205_363730_c1 3300050515 Bacteria 1313
523 nmdc:mga0a205_5075_c1 3300050515 Bacteria 11837
524 Ga0495601_0044037 3300053077 Bacteria 2805
525 Ga0495655_0072862 3300053083 Bacteria 964
526 Ga0495595_0022910 3300053084 Bacteria 2745
527 Ga0495619_0011193 3300053085 Bacteria 5642
528 Ga0500646_0030676 3300053090 Bacteria 1476
529 Ga0501084_0480732 3300054114 Bacteria 1050
530 Ga0590071_036410 3300059421 Bacteria 1180
531 2819690173 2818991462 Bacteria 4320267
532 2819726285 2818991469 Bacteria 4644110
533 2912758149 2912757875 Bacteria 7940295
534 2932433984 2932431166 Bacteria 4215299
535 Ga0075434_100090667
536 JGI25407J50210_10054586
537 Ga0070676_10010766
538 Ga0070683_100001756
539 Ga0070683_100179366
540 Ga0070683_100260940
541 Ga0070690_100123243
542 Ga0070690_100223397
543 Ga0070670_100007286
544 Ga0070670_100008265
545 Ga0068869_100012445
546 Ga0068869_100056558
547 Ga0070666_10164425
548 Ga0070680_100084587
549 Ga0070680_100779192
550 Ga0070682_100144814
551 Ga0068868_100050648
552 Ga0068868_100245733
553 Ga0070660_100014112
554 Ga0070689_100565515
555 Ga0070687_100011383
556 Ga0070687_100038721
557 Ga0070661_100000658
558 Ga0070661_100003502
559 Ga0070661_100179591
560 Ga0070692_10001326
561 Ga0070668_100006165
562 Ga0070668_100088522
563 Ga0070669_100123398
564 Ga0070675_100002261
565 Ga0070675_100007271
566 Ga0070674_100181893
567 Ga0070673_100104934
568 Ga0070688_100007773
569 Ga0070659_100015233
570 Ga0070659_100339113
571 Ga0070667_100018672
572 Ga0070703_10035463
573 Ga0070709_10031606
574 Ga0070714_100000712
575 Ga0070713_100095083
576 Ga0070713_100428796
577 Ga0070713_100432538
578 Ga0070710_10032631
579 Ga0070701_10006586
580 Ga0070711_100028155
581 Ga0070700_100024749
582 Ga0070700_100286855
583 Ga0070694_100005347
584 Ga0070708_100381547
585 Ga0070663_100011538
586 Ga0070662_100017848
587 Ga0070662_100061097
588 Ga0070662_100065099
589 Ga0070681_10034980
590 Ga0070681_10062500
591 Ga0070681_10072496
592 Ga0070685_10005008
593 Ga0070685_10016378
594 Ga0070685_10023400
595 Ga0070706_100000668
596 Ga0070707_100262605
597 Ga0070698_100152427
598 Ga0070698_100186078
599 Ga0070699_100014451
600 Ga0070679_100020539
601 Ga0070679_100068796
602 Ga0070684_100007867
603 Ga0070684_100032595
604 Ga0070684_100057398
605 Ga0070684_100157920
606 Ga0068853_100018198
607 Ga0070672_100021509
608 Ga0070672_100072421
609 Ga0070672_100112672
610 Ga0070695_100347552
611 Ga0070696_100007174
612 Ga0070665_100331413
613 Ga0070665_100732365
614 Ga0068855_100043694
615 Ga0070664_100010681
616 Ga0070664_100017505
617 Ga0070664_100019848
618 Ga0070664_100193927
619 Ga0068857_100019039
620 Ga0068857_100019880
621 Ga0068857_100069470
622 Ga0068857_100441318
623 Ga0068856_100061413
624 Ga0068852_100019682
625 Ga0068852_100404862
626 Ga0068859_100028126
627 Ga0068859_100117812
628 Ga0068864_100258235
629 Ga0068861_100028081
630 Ga0068851_10004142
631 Ga0068851_10008055
632 Ga0068870_10034339
633 Ga0068863_100054787
634 Ga0068863_100432687
635 Ga0068858_100502268
636 Ga0068860_100025240
637 Ga0068862_100018134
638 Ga0068862_100019553
639 Ga0068862_100854601
640 Ga0081455_10008190
641 Ga0081455_10024097
642 Ga0081455_10024189
643 Ga0081538_10005715
644 Ga0081538_10005788
645 Ga0081538_10007167
646 Ga0081538_10029211
647 Ga0081538_10033115
648 Ga0081538_10038652
649 Ga0081538_10062529
650 Ga0081539_10000171
651 Ga0081539_10018784
652 Ga0081539_10054793
653 Ga0070717_10013924
654 Ga0070717_10025917
655 Ga0075363_100108118
656 Ga0075432_10021036
657 Ga0070712_100004691
658 Ga0070712_100062709
659 Ga0070712_100145990
660 Ga0075428_100027897
661 Ga0075428_100059263
662 Ga0075428_100290529
663 Ga0075430_100008234
664 Ga0075430_100008938
665 Ga0075431_100050038
666 Ga0075431_100067099
667 Ga0075431_100129736
668 Ga0075431_100182945
669 Ga0075433_10017618
670 Ga0075434_100007837
671 Ga0075434_100010719
672 Ga0075434_100063277
673 Ga0075434_100261342
674 Ga0075434_100682625
675 Ga0075429_100155808
676 Ga0075429_100267410
677 Ga0068865_100015495
678 Ga0075436_100182140
679 Ga0097620_100028126
680 Ga0097620_100117808
681 Ga0075435_100013076
682 Ga0111539_10071692
683 Ga0105245_10009949
684 Ga0105245_10731166
685 Ga0114129_10065213
686 Ga0114129_10091727
687 Ga0114129_10137214
688 Ga0114129_10382606
689 Ga0105243_10092077
690 Ga0105242_11113870
691 Ga0105248_10030578
692 Ga0105248_10139171
693 Ga0105249_10005088
694 Ga0105249_10023201
695 Ga0105249_10079060
696 Ga0105239_10067284
697 Ga0157369_10408400
698 Ga0157374_10154479
699 Ga0157374_10165167
700 Ga0157374_10327260
701 Ga0157378_10428974
702 Ga0163162_10004814
703 Ga0163162_10387893
704 Ga0157372_10125855
705 Ga0157375_10009943
706 Ga0157375_10025329
707 Ga0157375_10610301
708 Ga0157375_10730454
709 Ga0157380_10029120
710 Ga0182008_10040075
711 Ga0157377_10025551
712 Ga0157377_10073256
713 Ga0157377_10139656
714 Ga0157377_10392712
715 Ga0157379_10007896
716 Ga0157376_10133319
717 Ga0163161_10470909
718 Ga0206353_10093104
719 Ga0213874_10041730
720 Ga0213874_10096905
721 Ga0213876_10061858
722 Ga0213875_10004629
723 Ga0213875_10010826
724 Ga0213875_10027008
725 Ga0224712_10039078
726 Ga0207697_10000898
727 Ga0207656_10093408
728 Ga0207692_10235426
729 Ga0207688_10027541
730 Ga0207680_10078330
731 Ga0207699_10042564
732 Ga0207645_10000447
733 Ga0207643_10030851
734 Ga0207643_10290856
735 Ga0207684_10000620
736 Ga0207707_10379444
737 Ga0207707_10396417
738 Ga0207693_10006071
739 Ga0207693_10007424
740 Ga0207693_10068466
741 Ga0207663_10017855
742 Ga0207660_10043254
743 Ga0207662_10032050
744 Ga0207657_10052681
745 Ga0207649_10003483
746 Ga0207649_10078122
747 Ga0207649_10324111
748 Ga0207649_10394253
749 Ga0207652_10010892
750 Ga0207646_10209466
751 Ga0207646_10244321
752 Ga0207681_10067205
753 Ga0207650_10001445
754 Ga0207650_10006703
755 Ga0207650_10036523
756 Ga0207659_10006902
757 Ga0207659_10147502
758 Ga0207659_10481743
759 Ga0207687_10144623
760 Ga0207700_10298450
761 Ga0207664_10011734
762 Ga0207664_10088406
763 Ga0207690_10002445
764 Ga0207690_10469112
765 Ga0207706_10000440
766 Ga0207706_10042231
767 Ga0207706_10207697
768 Ga0207709_10188783
769 Ga0207670_10123287
770 Ga0207670_10527705
771 Ga0207669_10419108
772 Ga0207704_10073591
773 Ga0207691_10000391
774 Ga0207691_10002912
775 Ga0207691_10273211
776 Ga0207711_10136760
777 Ga0207689_10003907
778 Ga0207689_10076084
779 Ga0207661_10005073
780 Ga0207661_10042984
781 Ga0207661_10476774
782 Ga0207661_10491860
783 Ga0207679_10002220
784 Ga0207679_10013215
785 Ga0207679_10081472
786 Ga0207679_10195121
787 Ga0207651_10096299
788 Ga0207712_10176845
789 Ga0207658_10015784
790 Ga0207677_10086456
791 Ga0207677_10209137
792 Ga0207703_10260028
793 Ga0207703_10321401
794 Ga0207639_10169737
795 Ga0207678_10130419
796 Ga0207678_10154721
797 Ga0207708_10039461
798 Ga0207702_10126930
799 Ga0207641_10156503
800 Ga0207641_10266799
801 Ga0207648_10086800
802 Ga0207674_10000530
803 Ga0207674_10001224
804 Ga0207674_10220594
805 Ga0207675_100000151
806 Ga0207675_100003257
807 Ga0207683_10578938
808 Ga0207698_10036200
809 Ga0207698_10325577
810 Ga0207428_10003776
811 Ga0268266_10437794
812 Ga0268265_10148526
813 Ga0268265_10255609
814 Ga0268265_10829074
815 Ga0268264_10021763
816 Ga0265319_1019090
817 Ga0265318_10015552
818 Ga0265338_10019153
819 Ga0265320_10002555
820 Ga0307408_100006366
821 Ga0307408_100371929
822 Ga0265313_10073008
823 Ga0265314_10124311
824 Ga0307405_10017456
825 Ga0307405_10026371
826 Ga0307405_10053331
827 Ga0307405_10269641
828 Ga0307413_10026936
829 Ga0307413_10146719
830 Ga0307413_10240557
831 Ga0307410_10009660
832 Ga0307410_10010720
833 Ga0307410_10044396
834 Ga0307410_10064523
835 Ga0307410_10073191
836 Ga0307410_10135015
837 Ga0307410_10314452
838 Ga0307410_10360585
839 Ga0307410_10461450
840 Ga0326468_10001639
841 Ga0307406_10003313
842 Ga0307406_10165444
843 Ga0307406_10478752
844 Ga0307407_10001431
845 Ga0307407_10005708
846 Ga0307407_10037664
847 Ga0307407_10176721
848 Ga0307407_10198401
849 Ga0307412_10026001
850 Ga0307412_10050541
851 Ga0307409_100007311
852 Ga0307409_100023700
853 Ga0307409_100076706
854 Ga0307409_100128176
855 Ga0307409_100920044
856 Ga0307416_100007237
857 Ga0307416_100013211
858 Ga0307416_100017046
859 Ga0307416_100104727
860 Ga0307416_100109862
861 Ga0307416_100148178
862 Ga0307416_101095918
863 Ga0307414_10003093
864 Ga0307414_10033067
865 Ga0307414_10095566
866 Ga0307414_10296919
867 Ga0307414_10407647
868 Ga0307411_10079757
869 Ga0307411_10542963
870 Ga0307415_100018554
871 Ga0307415_100087467
872 Ga0307415_100454804
873 Ga0373955_0031525
874 Ga0373931_0091208
875 Ga0373933_0022199
876 Ga0373947_0324465
877 Ga0373937_0013060
878 Ga0373925_0021714
879 Ga0373925_0049994
880 Ga0395899_0036791
881 Ga0395899_0257926
882 Ga0395900_0075151
883 Ga0395900_0239014
884 Ga0395900_0279237
885 Ga0395898_0052296
886 Ga0395898_0062193
887 Ga0395898_0374780
888 Ga0395898_0450945
889 Ga0395905_0186071
890 Ga0395905_0268566
891 Ga0395905_0630101
892 Ga0436364_0282082
893 Ga0436364_0440241
894 Ga0436364_1260739
895 Ga0436364_1536453
896 Ga0395901_0009166
897 Ga0395901_0064857
898 Ga0395901_0293626
899 Ga0395901_0434699
900 Ga0436365_0207828
901 Ga0436365_0813952
902 Ga0436365_1353607
903 Ga0436365_1613513
904 Ga0436365_1884457
905 Ga0436363_0060364
906 Ga0436363_0099119
907 Ga0436363_0445988
908 Ga0436363_0842663
909 Ga0436362_0187069
910 Ga0436362_0716449
911 Ga0439443_002100
912 Ga0439448_0031802
913 Ga0439448_0129474
914 Ga0439463_005498
915 Ga0439463_067685
916 Ga0439464_0003724
917 Ga0439464_0052266
918 Ga0439460_0033932
919 Ga0451577_0256281
920 Ga0439440_0010707
921 Ga0466965_0084615
922 Ga0466966_0336404
923 Ga0466963_0004101
924 Ga0466963_0010604
925 Ga0466963_0368395
926 Ga0466964_0059845
927 Ga0466968_0106029
928 Ga0466970_0219228
929 Ga0466960_0004994
930 Ga0466959_0076217
931 Ga0466959_0205861
932 Ga0466959_0228075
933 Ga0451576_0080471
934 Ga0451576_0555798
935 Ga0466958_0025085
936 Ga0466958_0128620
937 Ga0466967_0003457
938 Ga0466967_0008076
939 Ga0466967_0009632
940 Ga0466967_0022837
941 Ga0466967_0043548
942 Ga0466967_0049594
943 Ga0466967_0059575
944 Ga0466967_0091707
945 Ga0466967_0149322
946 Ga0466967_0215275
947 Ga0466967_0269170
948 Ga0466967_0452096
949 Ga0466967_0524505
950 Ga0495592_0066368
951 Ga0495592_0111471
952 Ga0495638_0002894
953 Ga0495641_0019769
954 Ga0495653_0008568
955 Ga0495584_0083179
956 Ga0495594_0010022
957 Ga0495608_0025179
958 Ga0495618_0125057
959 Ga0495628_0023133
960 Ga0495663_0039644
961 Ga0495652_0005199
962 Ga0495665_0231375
963 Ga0495640_0078196
964 Ga0495587_0037005
965 Ga0495587_0148362
966 Ga0495633_0155948
967 Ga0495667_0027070
968 Ga0495656_0018660
969 Ga0495634_0014486
970 Ga0495657_0015762
971 Ga0495599_0100919
972 Ga0495646_0061746
973 Ga0495613_0057894
974 Ga0495600_0035321
975 Ga0495674_0009384
976 Ga0495676_0286586
977 Ga0495684_0007482
978 Ga0495602_0007957
979 Ga0496101_0426942
980 Ga0496104_0015792
981 Ga0496105_0101887
982 Ga0496105_0562896
983 Ga0496108_0009220
984 Ga0496108_0120745
985 Ga0496108_0431395
986 Ga0496109_0047465
987 Ga0496110_0005264
988 Ga0496110_0610585
989 Ga0496111_0010883
990 Ga0496112_0149216
991 Ga0496112_0380126
992 Ga0496115_0184917
993 Ga0496115_0348657
994 Ga0496126_0058595
995 Ga0496126_0195813
996 Ga0501031_0092059
997 Ga0501031_0168266
998 Ga0501033_0014629
999 Ga0501036_0188896
1000 Ga0501037_0096009
1001 Ga0501038_0208152
1002 Ga0501039_0041502
1003 Ga0501039_0086958
1004 Ga0501040_0080882
1005 Ga0501041_0096614
1006 Ga0501042_0082354
1007 Ga0501046_0031577
1008 Ga0501046_0067810
1009 Ga0501046_0445026
1010 Ga0501047_0081198
1011 Ga0501047_0235312
1012 Ga0501048_0179261
1013 Ga0501048_0377227
1014 Ga0501067_0256271
1015 Ga0501070_0020538
1016 Ga0501072_0062626
1017 Ga0501072_0207740
1018 Ga0501072_0301728
1019 Ga0501073_0052117
1020 Ga0501074_0067340
1021 Ga0501074_0187105
1022 Ga0501075_0278658
1023 Ga0501077_0186505
1024 Ga0501202_030508
1025 Ga0501080_0109580
1026 Ga0501080_0419229
1027 Ga0501083_0010832
1028 Ga0501035_0023947
1029 Ga0501045_0134227
1030 Ga0501045_0147991
1031 nmdc:mga03n38_152902_c1
1032 nmdc:mga05p37_12682_c1
1033 nmdc:mga05p37_161444_c1
1034 nmdc:mga05p37_350343_c1
1035 nmdc:mga09592_244414_c1
1036 nmdc:mga09592_362761_c1
1037 nmdc:mga09592_925_c1
1038 nmdc:mga0qj67_16340_c1
1039 nmdc:mga0qj67_1885_c1
1040 nmdc:mga0qj67_406998_c1
1041 nmdc:mga0qj67_8565_c1
1042 nmdc:mga06r32_116307_c1
1043 nmdc:mga06r32_1890_c1
1044 nmdc:mga06r32_32772_c1
1045 nmdc:mga06r32_673402_c1
1046 nmdc:mga06r32_694856_c1
1047 nmdc:mga06r32_7179_c1
1048 nmdc:mga08y16_34222_c1
1049 nmdc:mga0n895_119422_c1
1050 nmdc:mga0n895_1875_c1
1051 nmdc:mga0n895_3326_c1
1052 nmdc:mga0n895_87961_c1
1053 nmdc:mga08x19_468275_c1
1054 nmdc:mga0a205_11059_c1
1055 nmdc:mga0a205_219793_c1
1056 nmdc:mga0a205_363730_c1
1057 nmdc:mga0a205_5075_c1
1058 Ga0495601_0044037
1059 Ga0495655_0072862
1060 Ga0495595_0022910
1061 Ga0495619_0011193
1062 Ga0500646_0030676
1063 Ga0501084_0480732
1064 Ga0590071_036410
1065 2819690173
1066 2819726285
1067 2912758149
1068 2932433984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00175

NAD_binding_1

Oxidoreductase NAD-binding domain

138

248

0.92

PF00970

FAD_binding_6

Oxidoreductase FAD-binding domain

34

127

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eh1-assembly1.cif.gz_A crystal structure of the flavohem-like-fad/nad binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor 0.8954 9 242
1gvh-assembly1.cif.gz_A the x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket 0.8889 7 246
7w3o-assembly5.cif.gz_E crystal structure of human cyb5r3 0.8862 7 239
1qfj-assembly4.cif.gz_D crystal structure of nad(p)h:flavin oxidoreductase from escherichia coli 0.8857 7 238
7tnv-assembly1.cif.gz_A crystal structure of human nadh-cytochrome b5 reductase t117s mutant 0.8821 7 239
ID Description Score Start End Superfamily
4eh1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9371 113 242 3.40.50.80
1cnfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9365 112 236 3.40.50.80
af_P39676_264_399_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9175 113 242 3.40.50.80
af_P38626_132_273_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9168 99 233 3.40.50.80
af_Q502I6_386_525_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.916 109 239 3.40.50.80
ID Description Score Start End GO Terms
AF-A0A7Y6CKD3-F1-model_v4 deleted 0.9819 5 182
AF-A0A535YJ12-F1-model_v4 Oxidoreductase 0.9815 2 241 GO:0016020
GO:0016491
GO:0051537
AF-A0A3G8JG57-F1-model_v4 Flavohemoprotein (EC 1.14.12.17) 0.9676 6 242 GO:0008941
GO:0051537
AF-A0A4R4TPI3-F1-model_v4 Oxidoreductase 0.9658 6 245 GO:0016491
GO:0051537
AF-A0A399NSG7-F1-model_v4 Oxidoreductase 0.9657 7 150 GO:0016491
GO:0051537

Map