F460462

General Info

Members Datasets Scaffolds Average Seq Length
533 368 1066 310

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0544196|Ga0496102_0544196_66_1040
Length 324
Sequence MASIEVPMPAITSPAPSQPDLDQEVAAVRGFNRFYTRKLGVLDQHLLDSPFSLSEARVMYELAHRDDAAAKEIGTELGLDAGYLSRMVQNFEENGLITRKPLPTDRRQYQLSLTAKGRQAFARLDRRSHDEVGAMLGQLGAAERARVVSAMRTIEHVLGPPTGARPGFLLRSHRPGDIGWVVSRHGAIYAQEYGWDISFEALVAEITAQFIRSFDPSREHCWIADIDGEPVGSIFLVKATDELAKLRLLQVEKKARGLGVGRVLVEQCIQGARERGYKRMTLWTQSILVAARGIYKSAGFELVATKPHHSFGHDLVGETWEMDL

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
51 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
52 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
73 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
74 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
75 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
118 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
119 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
120 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
235 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
236 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
237 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
238 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
241 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
242 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
243 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
244 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
245 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
246 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
247 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
248 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
249 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
250 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
251 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
252 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
253 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
254 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
255 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
256 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
257 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
258 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
259 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
260 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
261 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
262 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
263 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
264 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
265 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
266 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
267 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
268 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
269 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
270 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
271 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
272 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
273 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
274 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
275 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
276 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
277 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
278 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
279 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
280 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
281 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
282 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
283 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
284 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
285 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
286 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
287 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
288 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
289 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
290 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
291 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
292 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
293 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
294 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
295 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
296 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
297 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
298 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
299 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
300 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
301 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
302 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
303 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
304 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
305 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
306 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
307 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
308 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
309 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
310 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
311 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
312 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
313 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
314 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
315 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
316 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
317 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
318 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
319 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
320 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
321 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
322 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
323 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
324 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
325 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
326 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
327 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
328 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
329 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
330 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
331 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
332 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
333 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
334 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
335 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
336 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
337 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
338 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
339 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
340 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
341 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
342 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
343 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
344 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
345 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
346 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
347 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
348 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
349 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
350 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
351 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
352 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
353 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
354 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
355 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
356 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
357 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
358 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
359 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
360 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
361 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
362 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
363 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
364 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
365 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
366 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
367 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
368 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.98
Metatranscriptomes 0
Isolates 24.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.26
Nodule 19.14
Rhizoplane 5.63
Rhizosphere 49.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0544196 3300048905 Bacteria 1084
2 JGI25165J46597_1008727 3300003214 Bacteria 1568
3 JGI25153J46596_10002690 3300003215 Bacteria 10142
4 JGI25153J46596_10005318 3300003215 Bacteria 6769
5 JGI25153J46596_10007004 3300003215 Bacteria 5613
6 JGI25153J46596_10008189 3300003215 Bacteria 5033
7 JGI25160J50197_1000468 3300003354 Bacteria 24863
8 JGI25160J50197_1003938 3300003354 Bacteria 6496
9 Ga0055529_1005090 3300003763 Bacteria 1941
10 Ga0055531_10001950 3300003794 Bacteria 14425
11 Ga0055543_1015516 3300004625 Bacteria 1465
12 Ga0065165_1001418 3300005262 Bacteria 26076
13 Ga0065165_1003007 3300005262 Bacteria 12752
14 Ga0065165_1008554 3300005262 Bacteria 4762
15 Ga0065165_1022526 3300005262 Bacteria 2157
16 Ga0070683_100040801 3300005329 Bacteria 4267
17 Ga0070683_100427685 3300005329 Bacteria 1263
18 Ga0070680_100013533 3300005336 Bacteria 6356
19 Ga0070680_100115613 3300005336 Bacteria 2235
20 Ga0070680_100252988 3300005336 Bacteria 1490
21 Ga0070682_100262852 3300005337 Bacteria 1250
22 Ga0070660_100009423 3300005339 Bacteria 6867
23 Ga0070660_100370817 3300005339 Bacteria 1181
24 Ga0070668_100368537 3300005347 Bacteria 1220
25 Ga0070671_100032774 3300005355 Bacteria 4294
26 Ga0070659_100220881 3300005366 Bacteria 1564
27 Ga0070667_100140052 3300005367 Bacteria 2118
28 Ga0070709_10086587 3300005434 Bacteria 2057
29 Ga0070714_100159281 3300005435 Bacteria 2041
30 Ga0070714_100200758 3300005435 Bacteria 1824
31 Ga0070713_100127842 3300005436 Bacteria 2237
32 Ga0070713_100163147 3300005436 Bacteria 1991
33 Ga0070713_100198050 3300005436 Bacteria 1813
34 Ga0070710_10068433 3300005437 Bacteria 2040
35 Ga0070711_100004210 3300005439 Bacteria 8454
36 Ga0070711_100056276 3300005439 Bacteria 2719
37 Ga0070678_100145107 3300005456 Bacteria 1904
38 Ga0070662_100143186 3300005457 Bacteria 1855
39 Ga0070662_100172183 3300005457 Bacteria 1701
40 Ga0070681_10036625 3300005458 Bacteria 4926
41 Ga0070681_10124088 3300005458 Bacteria 2515
42 Ga0070681_10163352 3300005458 Bacteria 2150
43 Ga0070681_10397856 3300005458 Bacteria 1289
44 Ga0070698_100048887 3300005471 Bacteria 4321
45 Ga0070679_100040300 3300005530 Bacteria 4647
46 Ga0070679_100067092 3300005530 Bacteria 3577
47 Ga0070679_100067834 3300005530 Bacteria 3558
48 Ga0070684_100049560 3300005535 Bacteria 3645
49 Ga0070684_100131188 3300005535 Bacteria 2261
50 Ga0068853_100001044 3300005539 Bacteria 19587
51 Ga0068853_100035321 3300005539 Bacteria 4246
52 Ga0068853_100138085 3300005539 Bacteria 2187
53 Ga0070693_100018934 3300005547 Bacteria 3603
54 Ga0068855_100115195 3300005563 Bacteria 3082
55 Ga0068855_100135460 3300005563 Bacteria 2810
56 Ga0068855_100155712 3300005563 Bacteria 2596
57 Ga0070664_100244086 3300005564 Bacteria 1613
58 Ga0068857_100050461 3300005577 Bacteria 3691
59 Ga0068857_100061863 3300005577 Bacteria 3326
60 Ga0068857_100170760 3300005577 Bacteria 1977
61 Ga0068857_100238944 3300005577 Bacteria 1663
62 Ga0068856_100250048 3300005614 Bacteria 1788
63 Ga0068852_100046705 3300005616 Bacteria 3691
64 Ga0068852_100099984 3300005616 Bacteria 2615
65 Ga0068852_100162979 3300005616 Bacteria 2083
66 Ga0068852_100175679 3300005616 Bacteria 2011
67 Ga0068866_10038801 3300005718 Bacteria 2348
68 Ga0068863_100447412 3300005841 Bacteria 1268
69 Ga0068860_100000668 3300005843 Bacteria 39654
70 Ga0068860_100140058 3300005843 Bacteria 2325
71 Ga0081540_1008953 3300005983 Bacteria 6931
72 Ga0081540_1022271 3300005983 Bacteria 3744
73 Ga0070717_10570957 3300006028 Bacteria 1025
74 Ga0075365_10065555 3300006038 Bacteria 2434
75 Ga0075368_10022739 3300006042 Bacteria 2388
76 Ga0070716_100030719 3300006173 Bacteria 2918
77 Ga0070712_100010696 3300006175 Bacteria 5796
78 Ga0075362_10145408 3300006177 Bacteria 1135
79 Ga0075367_10020435 3300006178 Bacteria 3687
80 Ga0075366_10074988 3300006195 Bacteria 2018
81 Ga0097621_100155999 3300006237 Bacteria 1959
82 Ga0075370_10006165 3300006353 Bacteria 6014
83 Ga0075370_10021625 3300006353 Bacteria 3524
84 Ga0068865_100282559 3300006881 Bacteria 1322
85 Ga0099824_1018135 3300006942 Bacteria 5865
86 Ga0099822_1000953 3300006943 Bacteria 31277
87 Ga0099823_1037882 3300006944 Bacteria 3623
88 Ga0105240_10031642 3300009093 Bacteria 6856
89 Ga0105240_10061621 3300009093 Bacteria 4675
90 Ga0105240_10128878 3300009093 Bacteria 3037
91 Ga0105240_10375401 3300009093 Bacteria 1607
92 Ga0105245_10360826 3300009098 Bacteria 1442
93 Ga0105247_10210820 3300009101 Bacteria 1310
94 Ga0105241_10031923 3300009174 Bacteria 3944
95 Ga0105241_10077862 3300009174 Bacteria 2590
96 Ga0105241_10279595 3300009174 Bacteria 1425
97 Ga0105242_10031768 3300009176 Bacteria 4220
98 Ga0105248_10088532 3300009177 Bacteria 3484
99 Ga0105248_10139071 3300009177 Bacteria 2739
100 Ga0105237_10005466 3300009545 Bacteria 14335
101 Ga0105237_10024741 3300009545 Bacteria 6142
102 Ga0105237_10118001 3300009545 Bacteria 2647
103 Ga0105237_10364978 3300009545 Bacteria 1448
104 Ga0105237_10366035 3300009545 Bacteria 1446
105 Ga0105238_10003901 3300009551 Bacteria 14807
106 Ga0105238_10067956 3300009551 Bacteria 3564
107 Ga0105238_10378808 3300009551 Bacteria 1406
108 Ga0105239_10013152 3300010375 Bacteria 9196
109 Ga0105239_10015204 3300010375 Bacteria 8530
110 Ga0105239_10065825 3300010375 Bacteria 3981
111 Ga0105239_10084110 3300010375 Bacteria 3504
112 Ga0105239_10318426 3300010375 Bacteria 1754
113 Ga0105239_10323268 3300010375 Bacteria 1740
114 Ga0105246_10043894 3300011119 Bacteria 3036
115 Ga0105246_10108384 3300011119 Bacteria 2036
116 Ga0157370_10487588 3300013104 Bacteria 1132
117 Ga0157369_10005875 3300013105 Bacteria 14258
118 Ga0157369_10017808 3300013105 Bacteria 7974
119 Ga0157369_10071665 3300013105 Bacteria 3719
120 Ga0157374_10008030 3300013296 Bacteria 9022
121 Ga0157378_10007433 3300013297 Bacteria 9571
122 Ga0163162_10106064 3300013306 Bacteria 2905
123 Ga0157372_10682106 3300013307 Bacteria 1196
124 Ga0163163_10119729 3300014325 Bacteria 2666
125 Ga0157380_10192554 3300014326 Bacteria 1802
126 Ga0157376_10499981 3300014969 Bacteria 1195
127 Ga0214544_1000026 3300021320 Bacteria 161530
128 Ga0214544_1018524 3300021320 Bacteria 5736
129 Ga0214542_1000025 3300021321 Bacteria 183588
130 Ga0214542_1018644 3300021321 Bacteria 5788
131 Ga0214545_1000014 3300021324 Bacteria 183588
132 Ga0214545_1019592 3300021324 Bacteria 5734
133 Ga0214543_1000034 3300021327 Bacteria 183712
134 Ga0214543_1023923 3300021327 Bacteria 3912
135 Ga0213876_10090952 3300021384 Bacteria 1616
136 Ga0213876_10193352 3300021384 Bacteria 1082
137 Ga0209677_106546 3300025253 Bacteria 2729
138 Ga0209148_1001016 3300025254 Bacteria 17684
139 Ga0209148_1003767 3300025254 Bacteria 3992
140 Ga0209233_1008693 3300025261 Bacteria 3123
141 Ga0209233_1016371 3300025261 Bacteria 2044
142 Ga0209455_1007162 3300025272 Bacteria 3185
143 Ga0209455_1011800 3300025272 Bacteria 2130
144 Ga0209564_1011256 3300025295 Bacteria 4026
145 Ga0209564_1032801 3300025295 Bacteria 1556
146 Ga0209758_1000011 3300025297 Bacteria 1049685
147 Ga0209758_1001661 3300025297 Bacteria 25177
148 Ga0209758_1001693 3300025297 Bacteria 24822
149 Ga0209758_1003535 3300025297 Bacteria 14083
150 Ga0209758_1028472 3300025297 Bacteria 2361
151 Ga0209256_1003503 3300025299 Bacteria 10940
152 Ga0207426_1000669 3300025302 Bacteria 41627
153 Ga0207426_1001272 3300025302 Bacteria 22005
154 Ga0207426_1007264 3300025302 Bacteria 4665
155 Ga0207426_1013246 3300025302 Bacteria 3062
156 Ga0209257_1005136 3300025304 Bacteria 9464
157 Ga0209257_1007139 3300025304 Bacteria 6867
158 Ga0207692_10072401 3300025898 Bacteria 1820
159 Ga0207647_10026881 3300025904 Bacteria 3759
160 Ga0207699_10025192 3300025906 Bacteria 3264
161 Ga0207699_10082493 3300025906 Bacteria 1997
162 Ga0207654_10026622 3300025911 Bacteria 3134
163 Ga0207707_10015930 3300025912 Bacteria 6558
164 Ga0207707_10077463 3300025912 Bacteria 2902
165 Ga0207707_10130785 3300025912 Bacteria 2195
166 Ga0207707_10339642 3300025912 Bacteria 1295
167 Ga0207695_10000503 3300025913 Bacteria 83026
168 Ga0207695_10075006 3300025913 Bacteria 3442
169 Ga0207695_10098378 3300025913 Bacteria 2925
170 Ga0207695_10265316 3300025913 Bacteria 1614
171 Ga0207671_10009324 3300025914 Bacteria 8216
172 Ga0207671_10032433 3300025914 Bacteria 3889
173 Ga0207671_10055429 3300025914 Bacteria 2936
174 Ga0207671_10191981 3300025914 Bacteria 1593
175 Ga0207663_10012615 3300025916 Bacteria 4575
176 Ga0207660_10023146 3300025917 Bacteria 4192
177 Ga0207657_10008150 3300025919 Bacteria 10680
178 Ga0207657_10336546 3300025919 Bacteria 1192
179 Ga0207652_10028530 3300025921 Bacteria 4657
180 Ga0207652_10036609 3300025921 Bacteria 4148
181 Ga0207652_10053798 3300025921 Bacteria 3458
182 Ga0207652_10085314 3300025921 Bacteria 2767
183 Ga0207681_10309643 3300025923 Bacteria 1252
184 Ga0207694_10021500 3300025924 Bacteria 4889
185 Ga0207694_10087669 3300025924 Bacteria 2452
186 Ga0207694_10124488 3300025924 Bacteria 2061
187 Ga0207700_10086932 3300025928 Bacteria 2458
188 Ga0207700_10338483 3300025928 Bacteria 1308
189 Ga0207664_10192168 3300025929 Bacteria 1758
190 Ga0207644_10141742 3300025931 Bacteria 1851
191 Ga0207690_10194107 3300025932 Bacteria 1538
192 Ga0207706_10069061 3300025933 Bacteria 3107
193 Ga0207665_10006306 3300025939 Bacteria 7862
194 Ga0207665_10129888 3300025939 Bacteria 1787
195 Ga0207661_10038440 3300025944 Bacteria 3750
196 Ga0207661_10048655 3300025944 Bacteria 3371
197 Ga0207679_10140262 3300025945 Bacteria 1953
198 Ga0207667_10053100 3300025949 Bacteria 4265
199 Ga0207668_10401889 3300025972 Bacteria 1158
200 Ga0207640_10094878 3300025981 Bacteria 2076
201 Ga0207658_10110341 3300025986 Bacteria 2173
202 Ga0207639_10003041 3300026041 Bacteria 11295
203 Ga0207639_10141632 3300026041 Bacteria 2004
204 Ga0207639_10181363 3300026041 Bacteria 1791
205 Ga0207639_10354288 3300026041 Bacteria 1312
206 Ga0207678_10303553 3300026067 Bacteria 1372
207 Ga0207702_10576611 3300026078 Bacteria 1102
208 Ga0207674_10027144 3300026116 Bacteria 6063
209 Ga0207674_10042995 3300026116 Bacteria 4661
210 Ga0207674_10312559 3300026116 Bacteria 1520
211 Ga0207674_10439296 3300026116 Bacteria 1261
212 Ga0207683_10038343 3300026121 Bacteria 4176
213 Ga0207698_10185292 3300026142 Bacteria 1848
214 Ga0207698_10267722 3300026142 Bacteria 1573
215 Ga0209389_1000009 3300027296 Bacteria 226873
216 Ga0209389_1000088 3300027296 Bacteria 83578
217 Ga0209589_1010781 3300027357 Bacteria 13175
218 Ga0209489_100050 3300027361 Bacteria 154669
219 Ga0209489_100085 3300027361 Bacteria 126199
220 Ga0209700_100016 3300027363 Bacteria 252567
221 Ga0268266_10057936 3300028379 Bacteria 3335
222 Ga0268264_10000168 3300028381 Bacteria 146056
223 Ga0268264_10399719 3300028381 Bacteria 1320
224 Ga0307511_10083100 3300030521 Bacteria 2233
225 Ga0307509_10133117 3300031507 Bacteria 2437
226 Ga0307509_10206785 3300031507 Bacteria 1792
227 Ga0307508_10000008 3300031616 Bacteria 265023
228 Ga0316578_10014902 3300031728 Bacteria 4168
229 Ga0307516_10015047 3300031730 Bacteria 8155
230 Ga0307516_10055950 3300031730 Bacteria 3848
231 Ga0307406_10399663 3300031901 Bacteria 1089
232 Ga0307507_10026887 3300033179 Bacteria 6187
233 Ga0373926_0065474 3300035083 Bacteria 1329
234 Ga0373923_0079953 3300035111 Bacteria 1416
235 Ga0373932_0053318 3300035112 Bacteria 1207
236 Ga0373945_0034827 3300035116 Bacteria 1796
237 Ga0316574_0001368 3300035398 Bacteria 11484
238 Ga0373931_0001468 3300035691 Bacteria 10152
239 Ga0373931_0107396 3300035691 Bacteria 1579
240 Ga0373935_0046010 3300035692 Bacteria 2755
241 Ga0373935_0436040 3300035692 Bacteria 945
242 Ga0373927_0058058 3300035695 Bacteria 2502
243 Ga0373927_0153156 3300035695 Bacteria 1509
244 Ga0373933_0175131 3300035724 Bacteria 1366
245 Ga0316582_0003850 3300036647 Bacteria 7463
246 Ga0316584_0023798 3300036712 Bacteria 4475
247 Ga0373925_0059446 3300037068 Bacteria 2867
248 Ga0373925_0097849 3300037068 Bacteria 2251
249 Ga0373925_0113092 3300037068 Bacteria 2099
250 Ga0395900_0000134 3300037418 Bacteria 124444
251 Ga0395900_0110328 3300037418 Bacteria 2826
252 Ga0395900_0345290 3300037418 Bacteria 1463
253 Ga0395900_0546838 3300037418 Bacteria 1103
254 Ga0395898_0049199 3300037466 Bacteria 4131
255 Ga0395898_0102240 3300037466 Bacteria 2751
256 Ga0395898_0117851 3300037466 Bacteria 2544
257 Ga0395905_0012021 3300037471 Bacteria 8347
258 Ga0395905_0123219 3300037471 Bacteria 2437
259 Ga0395905_0217055 3300037471 Bacteria 1791
260 Ga0436364_0451849 3300037853 Bacteria 1237
261 Ga0395901_0028400 3300038443 Bacteria 5753
262 Ga0395901_0056764 3300038443 Bacteria 4073
263 Ga0436365_0348041 3300039437 Bacteria 2262
264 Ga0436365_0478888 3300039437 Bacteria 2660
265 Ga0436365_0487882 3300039437 Bacteria 1125
266 Ga0436365_1233704 3300039437 Bacteria 3828
267 Ga0436365_1397753 3300039437 Bacteria 1518
268 Ga0451789_0429479 3300041443 Bacteria 1081
269 Ga0451853_1443546 3300041512 Bacteria 1085
270 Ga0466972_0000575 3300044658 Bacteria 17829
271 Ga0466972_0001695 3300044658 Bacteria 10785
272 Ga0466965_0039191 3300044683 Bacteria 2329
273 Ga0466966_0003840 3300044684 Bacteria 9916
274 Ga0466961_0000060 3300044693 Bacteria 65360
275 Ga0466961_0092492 3300044693 Bacteria 1909
276 Ga0466964_0007947 3300044706 Bacteria 3971
277 Ga0466968_0006925 3300044735 Bacteria 4292
278 Ga0466968_0067015 3300044735 Bacteria 1556
279 Ga0466957_0220867 3300044842 Bacteria 1251
280 Ga0466960_0036467 3300044901 Bacteria 2302
281 Ga0466959_0176183 3300045049 Bacteria 1498
282 Ga0466958_0079287 3300045836 Bacteria 2019
283 Ga0466967_0285160 3300045976 Bacteria 1585
284 Ga0466967_0404247 3300045976 Bacteria 1329
285 Ga0495629_0001342 3300046459 Bacteria 19369
286 Ga0495651_0018460 3300046462 Bacteria 5402
287 Ga0495580_0007058 3300046472 Bacteria 9054
288 Ga0495662_0031357 3300046476 Bacteria 2568
289 Ga0495606_0047665 3300046507 Bacteria 2823
290 Ga0495606_0113257 3300046507 Bacteria 1633
291 Ga0495606_0160477 3300046507 Bacteria 1312
292 Ga0495608_0024113 3300046511 Bacteria 4163
293 Ga0495610_0129156 3300046512 Bacteria 1099
294 Ga0495628_0136414 3300046516 Bacteria 1875
295 Ga0495630_0129997 3300046517 Bacteria 1912
296 Ga0495643_0045359 3300046522 Bacteria 2386
297 Ga0495648_0068478 3300046524 Bacteria 2070
298 Ga0495648_0109313 3300046524 Bacteria 1508
299 Ga0495652_0141126 3300046529 Bacteria 1894
300 Ga0495652_0204025 3300046529 Bacteria 1498
301 Ga0495665_0140305 3300046531 Bacteria 1263
302 Ga0495640_0004327 3300046533 Bacteria 11338
303 Ga0495640_0071501 3300046533 Bacteria 2328
304 Ga0495597_0017246 3300046542 Bacteria 3402
305 Ga0495645_0096023 3300046543 Bacteria 2112
306 Ga0495622_0014766 3300046557 Bacteria 3628
307 Ga0495622_0052280 3300046557 Bacteria 1895
308 Ga0495668_0081500 3300046616 Bacteria 1775
309 Ga0495634_0063411 3300046642 Bacteria 2453
310 Ga0495634_0195256 3300046642 Bacteria 1260
311 Ga0495635_0006063 3300046663 Bacteria 8433
312 Ga0495635_0140285 3300046663 Bacteria 1646
313 Ga0495657_0026719 3300046675 Bacteria 4085
314 Ga0495599_0088303 3300046678 Bacteria 1936
315 Ga0495599_0117168 3300046678 Bacteria 1657
316 Ga0495658_0016846 3300046683 Bacteria 3766
317 Ga0495658_0180716 3300046683 Bacteria 1309
318 Ga0495613_0073115 3300046689 Bacteria 2499
319 Ga0495613_0077835 3300046689 Bacteria 2413
320 Ga0495624_0146844 3300046690 Bacteria 1443
321 Ga0495649_0016186 3300046694 Bacteria 4230
322 Ga0495581_0060775 3300047315 Bacteria 2183
323 Ga0495604_0003446 3300047317 Bacteria 12612
324 Ga0495604_0200349 3300047317 Bacteria 1385
325 Ga0495674_0318907 3300047319 Bacteria 1266
326 Ga0495683_0058354 3300047323 Bacteria 1917
327 Ga0495687_016651 3300047443 Bacteria 3692
328 Ga0495687_037896 3300047443 Bacteria 2144
329 Ga0495684_0267395 3300047471 Bacteria 1238
330 Ga0496100_0073755 3300048903 Bacteria 2285
331 Ga0496101_0051620 3300048904 Bacteria 2963
332 Ga0496102_0019548 3300048905 Bacteria 5967
333 Ga0496102_0044351 3300048905 Bacteria 4035
334 Ga0496103_0061981 3300048906 Bacteria 2327
335 Ga0496103_0162375 3300048906 Bacteria 1433
336 Ga0496104_0001719 3300048907 Bacteria 18899
337 Ga0496104_0025964 3300048907 Bacteria 5402
338 Ga0496104_0080491 3300048907 Bacteria 3106
339 Ga0496105_0010180 3300048908 Bacteria 7389
340 Ga0496105_0048425 3300048908 Bacteria 3508
341 Ga0496106_0004456 3300048909 Bacteria 10383
342 Ga0496108_0211775 3300048911 Bacteria 1682
343 Ga0496109_0064889 3300048912 Bacteria 3342
344 Ga0496109_0131357 3300048912 Bacteria 2337
345 Ga0496110_0007162 3300048913 Bacteria 8880
346 Ga0496110_0120123 3300048913 Bacteria 2367
347 Ga0496111_0110609 3300048914 Bacteria 2023
348 Ga0496112_0019836 3300048915 Bacteria 6360
349 Ga0496112_0037257 3300048915 Bacteria 4747
350 Ga0496112_0196645 3300048915 Bacteria 1977
351 Ga0496113_0020841 3300048916 Bacteria 4616
352 Ga0496113_0097605 3300048916 Bacteria 2273
353 Ga0496114_0012803 3300048917 Bacteria 6716
354 Ga0496114_0248290 3300048917 Bacteria 1566
355 Ga0496115_0158650 3300048918 Bacteria 1869
356 Ga0496115_0181213 3300048918 Bacteria 1741
357 Ga0496115_0461620 3300048918 Bacteria 1024
358 Ga0496117_0033933 3300048920 Bacteria 3853
359 Ga0496117_0234478 3300048920 Bacteria 1012
360 Ga0496118_0004541 3300048921 Bacteria 16380
361 Ga0496118_0031629 3300048921 Bacteria 4381
362 Ga0496119_0008149 3300048922 Bacteria 9273
363 Ga0496120_0016484 3300048923 Bacteria 4830
364 Ga0496120_0062648 3300048923 Bacteria 2071
365 Ga0496121_0000506 3300048924 Bacteria 74537
366 Ga0496121_0010429 3300048924 Bacteria 10482
367 Ga0496121_0091192 3300048924 Bacteria 2380
368 Ga0496121_0139605 3300048924 Bacteria 1800
369 Ga0496121_0143098 3300048924 Bacteria 1771
370 Ga0496124_0001588 3300048927 Bacteria 32724
371 Ga0496125_0029039 3300048928 Bacteria 4979
372 Ga0496125_0032282 3300048928 Bacteria 4653
373 Ga0496125_0127158 3300048928 Bacteria 1803
374 Ga0495682_0007639 3300049460 Bacteria 4290
375 Ga0501047_0062505 3300049581 Bacteria 3591
376 Ga0501070_0037245 3300049586 Bacteria 4061
377 Ga0501073_0123712 3300049589 Bacteria 1793
378 Ga0501074_0035114 3300049590 Bacteria 3633
379 Ga0501080_0132493 3300049742 Bacteria 2307
380 Ga0501035_0378848 3300049822 Bacteria 1180
381 Ga0501044_0057000 3300049823 Bacteria 4010
382 nmdc:mga03n38_58224_c1 3300050490 Bacteria 1750
383 nmdc:mga0yw44_17376_c1 3300050492 Bacteria 3913
384 nmdc:mga0yw44_383509_c1 3300050492 Bacteria 949
385 nmdc:mga07m45_16915_c1 3300050496 Bacteria 3909
386 nmdc:mga0sz30_117342_c1 3300050516 Bacteria 1169
387 nmdc:mga0sz30_28867_c1 3300050516 Bacteria 2284
388 Ga0495601_0180049 3300053077 Bacteria 1382
389 Ga0495601_0200276 3300053077 Bacteria 1305
390 Ga0495612_0013325 3300053078 Bacteria 3312
391 Ga0495612_0070486 3300053078 Bacteria 1457
392 Ga0495655_0004964 3300053083 Bacteria 2317
393 Ga0495619_0055028 3300053085 Bacteria 2635
394 Ga0500651_0242794 3300053093 Bacteria 1050
395 Ga0500648_094733 3300053097 Bacteria 1667
396 Ga0500595_018537 3300053119 Bacteria 2543
397 Ga0500559_0043895 3300053136 Bacteria 1954
398 Ga0500588_0034366 3300053146 Bacteria 1485
399 Ga0500590_066289 3300053148 Bacteria 1803
400 Ga0500603_058219 3300053150 Bacteria 1075
401 Ga0500638_140780 3300053162 Bacteria 1084
402 Ga0500639_095995 3300053163 Bacteria 1468
403 Ga0500637_0023955 3300053178 Bacteria 3343
404 Ga0500601_000284 3300053737 Bacteria 9607
405 Ga0500661_003957 3300055283 Bacteria 2773
406 2507507236 2507262055 Bacteria 8048963
407 2508541288 2508501009 Bacteria 7784016
408 2508693381 2508501042 Bacteria 8719808
409 2513626422 2513237092 Bacteria 8341956
410 2513637136 2513237094 Bacteria 8789602
411 2513876702 2513237139 Bacteria 8737671
412 2514012253 2513237161 Bacteria 8871253
413 2515628743 2515154112 Bacteria 8294334
414 2517104837 2517093001 Bacteria 9002274
415 2524440645 2524023205 Bacteria 8918781
416 2617347955 2617270735 Bacteria 9163226
417 2617377820 2617270741 Bacteria 8201522
418 2728750896 2728368998 Bacteria 8720350
419 2793065556 2791355196 Bacteria 7323613
420 2805918682 2802429603 Bacteria 8777136
421 2824607790 2824600985 Bacteria 8488197
422 2824617243 2824609381 Bacteria 8672835
423 2824625018 2824617872 Bacteria 8814715
424 2824633928 2824626560 Bacteria 8813858
425 2824641340 2824635225 Bacteria 8785348
426 2824650018 2824644064 Bacteria 8743947
427 2824659389 2824653114 Bacteria 8493680
428 2824677471 2824671348 Bacteria 8369588
429 2824684568 2824679649 Bacteria 8248951
430 2824693903 2824687955 Bacteria 8360029
431 2824702335 2824696289 Bacteria 8335049
432 2824709122 2824704595 Bacteria 9667483
433 2824720245 2824714736 Bacteria 8717648
434 2824730361 2824723954 Bacteria 8758240
435 2824737258 2824732956 Bacteria 7810675
436 2824752300 2824746037 Bacteria 7911610
437 2824761713 2824753945 Bacteria 9787441
438 2824770708 2824763712 Bacteria 9792355
439 2824776068 2824773399 Bacteria 8360218
440 2838127077 2838122688 Bacteria 8803140
441 2841947318 2841941048 Bacteria 8688029
442 2841955896 2841949485 Bacteria 8680857
443 2841961658 2841957949 Bacteria 8652217
444 2841973966 2841966195 Bacteria 8673214
445 2841980641 2841974524 Bacteria 8931498
446 2841987178 2841983080 Bacteria 8395090
447 2842041188 2842038055 Bacteria 8002051
448 2842045867 2842045827 Bacteria 8006841
449 2844320436 2844315083 Bacteria 8138177
450 2847937972 2847930680 Bacteria 9342022
451 2847939907 2847939898 Bacteria 8606328
452 2847948207 2847939898 Bacteria 8606328
453 2849077885 2849076700 Bacteria 7039503
454 2857511082 2857509624 Bacteria 7472071
455 2874596027 2874590934 Bacteria 8299676
456 2874619547 2874612657 Bacteria 8252029
457 2874625786 2874620515 Bacteria 8290088
458 2874632878 2874628541 Bacteria 8630250
459 2874650851 2874645413 Bacteria 8214782
460 2876776145 2876771140 Bacteria 8287509
461 2876822105 2876818435 Bacteria 8274608
462 2879080234 2879074833 Bacteria 8279565
463 2879084480 2879083081 Bacteria 8587928
464 2879129168 2879127579 Bacteria 8294491
465 2879147486 2879142872 Bacteria 8267021
466 2881370395 2881364244 Bacteria 7710352
467 2881668773 2881665667 Bacteria 8175609
468 2885368398 2885366525 Bacteria 8326213
469 2885409900 2885409591 Bacteria 9235467
470 2888392360 2888388044 Bacteria 7304136
471 2888426050 2888419890 Bacteria 7857137
472 2903732903 2903727486 Bacteria 8281579
473 2904673853 2904666416 Bacteria 8226587
474 2904698708 2904690495 Bacteria 9412302
475 2904711449 2904711408 Bacteria 9771557
476 2906607026 2906602504 Bacteria 8295279
477 2906651542 2906643746 Bacteria 8722424
478 2908763155 2908756301 Bacteria 8864324
479 2908782127 2908775508 Bacteria 8092255
480 2922393890 2922393267 Bacteria 8285685
481 2932797755 2932794094 Bacteria 7915132
482 2932804273 2932801729 Bacteria 7987968
483 2935610386 2935608549 Bacteria 8203142
484 2935651362 2935648319 Bacteria 8801166
485 2935659542 2935656913 Bacteria 8965014
486 2935771080 2935769743 Bacteria 7878163
487 2935781248 2935777560 Bacteria 8077691
488 2935786219 2935785616 Bacteria 7962367
489 2935793984 2935793552 Bacteria 8012592
490 2935823547 2935819856 Bacteria 8261050
491 2935849072 2935847175 Bacteria 8228321
492 2935888299 2935883170 Bacteria 7964738
493 2935912839 2935908558 Bacteria 8568796
494 2935922842 2935916978 Bacteria 9113783
495 2935930267 2935926038 Bacteria 8601059
496 2935939168 2935934488 Bacteria 8602579
497 2935946115 2935942939 Bacteria 8599779
498 2935955452 2935951376 Bacteria 8602333
499 2935972177 2935967501 Bacteria 8603075
500 2935976103 2935975950 Bacteria 8347125
501 2935986404 2935984226 Bacteria 8302647
502 2936013957 2936011229 Bacteria 8801034
503 2936022519 2936019824 Bacteria 8804134
504 2936035562 2936028420 Bacteria 8965941
505 2936049063 2936046547 Bacteria 8903709
506 2936060359 2936055302 Bacteria 8785755
507 2941531650 2941531003 Bacteria 7653939
508 3005485653 3005483717 Bacteria 7877331
509 3005511594 3005506211 Bacteria 6943378
510 3005594477 3005587118 Bacteria 7794411
511 3005600818 3005594810 Bacteria 8716512
512 3005716230 3005710791 Bacteria 7622528
513 3005723608 3005718088 Bacteria 8283608
514 8016528058 8016522445 Bacteria 8156687
515 8016533180 8016530956 Bacteria 8155261
516 8016546424 8016539877 Bacteria 8155419
517 8016555707 8016548790 Bacteria 8155074
518 8016601766 8016595262 Bacteria 8149947
519 8016608488 8016603502 Bacteria 8731218
520 8016616380 8016613128 Bacteria 8794220
521 8016624754 8016622563 Bacteria 7999408
522 8016638249 8016630954 Bacteria 9217207
523 8019532978 8019530166 Bacteria 8155624
524 8019546870 8019538911 Bacteria 7872763
525 8019551795 8019547302 Bacteria 7996444
526 8019620266 8019619141 Bacteria 9218857
527 8019632836 8019629233 Bacteria 8687553
528 8019647094 8019638758 Bacteria 9062356
529 8019655606 8019648815 Bacteria 10014479
530 8019660696 8019659431 Bacteria 8577854
531 8019685984 8019678201 Bacteria 8863603
532 8019692145 8019687851 Bacteria 8712826
533 8056971889 8056967851 Bacteria 9038162
534 Ga0496102_0544196
535 JGI25165J46597_1008727
536 JGI25153J46596_10002690
537 JGI25153J46596_10005318
538 JGI25153J46596_10007004
539 JGI25153J46596_10008189
540 JGI25160J50197_1000468
541 JGI25160J50197_1003938
542 Ga0055529_1005090
543 Ga0055531_10001950
544 Ga0055543_1015516
545 Ga0065165_1001418
546 Ga0065165_1003007
547 Ga0065165_1008554
548 Ga0065165_1022526
549 Ga0070683_100040801
550 Ga0070683_100427685
551 Ga0070680_100013533
552 Ga0070680_100115613
553 Ga0070680_100252988
554 Ga0070682_100262852
555 Ga0070660_100009423
556 Ga0070660_100370817
557 Ga0070668_100368537
558 Ga0070671_100032774
559 Ga0070659_100220881
560 Ga0070667_100140052
561 Ga0070709_10086587
562 Ga0070714_100159281
563 Ga0070714_100200758
564 Ga0070713_100127842
565 Ga0070713_100163147
566 Ga0070713_100198050
567 Ga0070710_10068433
568 Ga0070711_100004210
569 Ga0070711_100056276
570 Ga0070678_100145107
571 Ga0070662_100143186
572 Ga0070662_100172183
573 Ga0070681_10036625
574 Ga0070681_10124088
575 Ga0070681_10163352
576 Ga0070681_10397856
577 Ga0070698_100048887
578 Ga0070679_100040300
579 Ga0070679_100067092
580 Ga0070679_100067834
581 Ga0070684_100049560
582 Ga0070684_100131188
583 Ga0068853_100001044
584 Ga0068853_100035321
585 Ga0068853_100138085
586 Ga0070693_100018934
587 Ga0068855_100115195
588 Ga0068855_100135460
589 Ga0068855_100155712
590 Ga0070664_100244086
591 Ga0068857_100050461
592 Ga0068857_100061863
593 Ga0068857_100170760
594 Ga0068857_100238944
595 Ga0068856_100250048
596 Ga0068852_100046705
597 Ga0068852_100099984
598 Ga0068852_100162979
599 Ga0068852_100175679
600 Ga0068866_10038801
601 Ga0068863_100447412
602 Ga0068860_100000668
603 Ga0068860_100140058
604 Ga0081540_1008953
605 Ga0081540_1022271
606 Ga0070717_10570957
607 Ga0075365_10065555
608 Ga0075368_10022739
609 Ga0070716_100030719
610 Ga0070712_100010696
611 Ga0075362_10145408
612 Ga0075367_10020435
613 Ga0075366_10074988
614 Ga0097621_100155999
615 Ga0075370_10006165
616 Ga0075370_10021625
617 Ga0068865_100282559
618 Ga0099824_1018135
619 Ga0099822_1000953
620 Ga0099823_1037882
621 Ga0105240_10031642
622 Ga0105240_10061621
623 Ga0105240_10128878
624 Ga0105240_10375401
625 Ga0105245_10360826
626 Ga0105247_10210820
627 Ga0105241_10031923
628 Ga0105241_10077862
629 Ga0105241_10279595
630 Ga0105242_10031768
631 Ga0105248_10088532
632 Ga0105248_10139071
633 Ga0105237_10005466
634 Ga0105237_10024741
635 Ga0105237_10118001
636 Ga0105237_10364978
637 Ga0105237_10366035
638 Ga0105238_10003901
639 Ga0105238_10067956
640 Ga0105238_10378808
641 Ga0105239_10013152
642 Ga0105239_10015204
643 Ga0105239_10065825
644 Ga0105239_10084110
645 Ga0105239_10318426
646 Ga0105239_10323268
647 Ga0105246_10043894
648 Ga0105246_10108384
649 Ga0157370_10487588
650 Ga0157369_10005875
651 Ga0157369_10017808
652 Ga0157369_10071665
653 Ga0157374_10008030
654 Ga0157378_10007433
655 Ga0163162_10106064
656 Ga0157372_10682106
657 Ga0163163_10119729
658 Ga0157380_10192554
659 Ga0157376_10499981
660 Ga0214544_1000026
661 Ga0214544_1018524
662 Ga0214542_1000025
663 Ga0214542_1018644
664 Ga0214545_1000014
665 Ga0214545_1019592
666 Ga0214543_1000034
667 Ga0214543_1023923
668 Ga0213876_10090952
669 Ga0213876_10193352
670 Ga0209677_106546
671 Ga0209148_1001016
672 Ga0209148_1003767
673 Ga0209233_1008693
674 Ga0209233_1016371
675 Ga0209455_1007162
676 Ga0209455_1011800
677 Ga0209564_1011256
678 Ga0209564_1032801
679 Ga0209758_1000011
680 Ga0209758_1001661
681 Ga0209758_1001693
682 Ga0209758_1003535
683 Ga0209758_1028472
684 Ga0209256_1003503
685 Ga0207426_1000669
686 Ga0207426_1001272
687 Ga0207426_1007264
688 Ga0207426_1013246
689 Ga0209257_1005136
690 Ga0209257_1007139
691 Ga0207692_10072401
692 Ga0207647_10026881
693 Ga0207699_10025192
694 Ga0207699_10082493
695 Ga0207654_10026622
696 Ga0207707_10015930
697 Ga0207707_10077463
698 Ga0207707_10130785
699 Ga0207707_10339642
700 Ga0207695_10000503
701 Ga0207695_10075006
702 Ga0207695_10098378
703 Ga0207695_10265316
704 Ga0207671_10009324
705 Ga0207671_10032433
706 Ga0207671_10055429
707 Ga0207671_10191981
708 Ga0207663_10012615
709 Ga0207660_10023146
710 Ga0207657_10008150
711 Ga0207657_10336546
712 Ga0207652_10028530
713 Ga0207652_10036609
714 Ga0207652_10053798
715 Ga0207652_10085314
716 Ga0207681_10309643
717 Ga0207694_10021500
718 Ga0207694_10087669
719 Ga0207694_10124488
720 Ga0207700_10086932
721 Ga0207700_10338483
722 Ga0207664_10192168
723 Ga0207644_10141742
724 Ga0207690_10194107
725 Ga0207706_10069061
726 Ga0207665_10006306
727 Ga0207665_10129888
728 Ga0207661_10038440
729 Ga0207661_10048655
730 Ga0207679_10140262
731 Ga0207667_10053100
732 Ga0207668_10401889
733 Ga0207640_10094878
734 Ga0207658_10110341
735 Ga0207639_10003041
736 Ga0207639_10141632
737 Ga0207639_10181363
738 Ga0207639_10354288
739 Ga0207678_10303553
740 Ga0207702_10576611
741 Ga0207674_10027144
742 Ga0207674_10042995
743 Ga0207674_10312559
744 Ga0207674_10439296
745 Ga0207683_10038343
746 Ga0207698_10185292
747 Ga0207698_10267722
748 Ga0209389_1000009
749 Ga0209389_1000088
750 Ga0209589_1010781
751 Ga0209489_100050
752 Ga0209489_100085
753 Ga0209700_100016
754 Ga0268266_10057936
755 Ga0268264_10000168
756 Ga0268264_10399719
757 Ga0307511_10083100
758 Ga0307509_10133117
759 Ga0307509_10206785
760 Ga0307508_10000008
761 Ga0316578_10014902
762 Ga0307516_10015047
763 Ga0307516_10055950
764 Ga0307406_10399663
765 Ga0307507_10026887
766 Ga0373926_0065474
767 Ga0373923_0079953
768 Ga0373932_0053318
769 Ga0373945_0034827
770 Ga0316574_0001368
771 Ga0373931_0001468
772 Ga0373931_0107396
773 Ga0373935_0046010
774 Ga0373935_0436040
775 Ga0373927_0058058
776 Ga0373927_0153156
777 Ga0373933_0175131
778 Ga0316582_0003850
779 Ga0316584_0023798
780 Ga0373925_0059446
781 Ga0373925_0097849
782 Ga0373925_0113092
783 Ga0395900_0000134
784 Ga0395900_0110328
785 Ga0395900_0345290
786 Ga0395900_0546838
787 Ga0395898_0049199
788 Ga0395898_0102240
789 Ga0395898_0117851
790 Ga0395905_0012021
791 Ga0395905_0123219
792 Ga0395905_0217055
793 Ga0436364_0451849
794 Ga0395901_0028400
795 Ga0395901_0056764
796 Ga0436365_0348041
797 Ga0436365_0478888
798 Ga0436365_0487882
799 Ga0436365_1233704
800 Ga0436365_1397753
801 Ga0451789_0429479
802 Ga0451853_1443546
803 Ga0466972_0000575
804 Ga0466972_0001695
805 Ga0466965_0039191
806 Ga0466966_0003840
807 Ga0466961_0000060
808 Ga0466961_0092492
809 Ga0466964_0007947
810 Ga0466968_0006925
811 Ga0466968_0067015
812 Ga0466957_0220867
813 Ga0466960_0036467
814 Ga0466959_0176183
815 Ga0466958_0079287
816 Ga0466967_0285160
817 Ga0466967_0404247
818 Ga0495629_0001342
819 Ga0495651_0018460
820 Ga0495580_0007058
821 Ga0495662_0031357
822 Ga0495606_0047665
823 Ga0495606_0113257
824 Ga0495606_0160477
825 Ga0495608_0024113
826 Ga0495610_0129156
827 Ga0495628_0136414
828 Ga0495630_0129997
829 Ga0495643_0045359
830 Ga0495648_0068478
831 Ga0495648_0109313
832 Ga0495652_0141126
833 Ga0495652_0204025
834 Ga0495665_0140305
835 Ga0495640_0004327
836 Ga0495640_0071501
837 Ga0495597_0017246
838 Ga0495645_0096023
839 Ga0495622_0014766
840 Ga0495622_0052280
841 Ga0495668_0081500
842 Ga0495634_0063411
843 Ga0495634_0195256
844 Ga0495635_0006063
845 Ga0495635_0140285
846 Ga0495657_0026719
847 Ga0495599_0088303
848 Ga0495599_0117168
849 Ga0495658_0016846
850 Ga0495658_0180716
851 Ga0495613_0073115
852 Ga0495613_0077835
853 Ga0495624_0146844
854 Ga0495649_0016186
855 Ga0495581_0060775
856 Ga0495604_0003446
857 Ga0495604_0200349
858 Ga0495674_0318907
859 Ga0495683_0058354
860 Ga0495687_016651
861 Ga0495687_037896
862 Ga0495684_0267395
863 Ga0496100_0073755
864 Ga0496101_0051620
865 Ga0496102_0019548
866 Ga0496102_0044351
867 Ga0496103_0061981
868 Ga0496103_0162375
869 Ga0496104_0001719
870 Ga0496104_0025964
871 Ga0496104_0080491
872 Ga0496105_0010180
873 Ga0496105_0048425
874 Ga0496106_0004456
875 Ga0496108_0211775
876 Ga0496109_0064889
877 Ga0496109_0131357
878 Ga0496110_0007162
879 Ga0496110_0120123
880 Ga0496111_0110609
881 Ga0496112_0019836
882 Ga0496112_0037257
883 Ga0496112_0196645
884 Ga0496113_0020841
885 Ga0496113_0097605
886 Ga0496114_0012803
887 Ga0496114_0248290
888 Ga0496115_0158650
889 Ga0496115_0181213
890 Ga0496115_0461620
891 Ga0496117_0033933
892 Ga0496117_0234478
893 Ga0496118_0004541
894 Ga0496118_0031629
895 Ga0496119_0008149
896 Ga0496120_0016484
897 Ga0496120_0062648
898 Ga0496121_0000506
899 Ga0496121_0010429
900 Ga0496121_0091192
901 Ga0496121_0139605
902 Ga0496121_0143098
903 Ga0496124_0001588
904 Ga0496125_0029039
905 Ga0496125_0032282
906 Ga0496125_0127158
907 Ga0495682_0007639
908 Ga0501047_0062505
909 Ga0501070_0037245
910 Ga0501073_0123712
911 Ga0501074_0035114
912 Ga0501080_0132493
913 Ga0501035_0378848
914 Ga0501044_0057000
915 nmdc:mga03n38_58224_c1
916 nmdc:mga0yw44_17376_c1
917 nmdc:mga0yw44_383509_c1
918 nmdc:mga07m45_16915_c1
919 nmdc:mga0sz30_117342_c1
920 nmdc:mga0sz30_28867_c1
921 Ga0495601_0180049
922 Ga0495601_0200276
923 Ga0495612_0013325
924 Ga0495612_0070486
925 Ga0495655_0004964
926 Ga0495619_0055028
927 Ga0500651_0242794
928 Ga0500648_094733
929 Ga0500595_018537
930 Ga0500559_0043895
931 Ga0500588_0034366
932 Ga0500590_066289
933 Ga0500603_058219
934 Ga0500638_140780
935 Ga0500639_095995
936 Ga0500637_0023955
937 Ga0500601_000284
938 Ga0500661_003957
939 2507507236
940 2508541288
941 2508693381
942 2513626422
943 2513637136
944 2513876702
945 2514012253
946 2515628743
947 2517104837
948 2524440645
949 2617347955
950 2617377820
951 2728750896
952 2793065556
953 2805918682
954 2824607790
955 2824617243
956 2824625018
957 2824633928
958 2824641340
959 2824650018
960 2824659389
961 2824677471
962 2824684568
963 2824693903
964 2824702335
965 2824709122
966 2824720245
967 2824730361
968 2824737258
969 2824752300
970 2824761713
971 2824770708
972 2824776068
973 2838127077
974 2841947318
975 2841955896
976 2841961658
977 2841973966
978 2841980641
979 2841987178
980 2842041188
981 2842045867
982 2844320436
983 2847937972
984 2847939907
985 2847948207
986 2849077885
987 2857511082
988 2874596027
989 2874619547
990 2874625786
991 2874632878
992 2874650851
993 2876776145
994 2876822105
995 2879080234
996 2879084480
997 2879129168
998 2879147486
999 2881370395
1000 2881668773
1001 2885368398
1002 2885409900
1003 2888392360
1004 2888426050
1005 2903732903
1006 2904673853
1007 2904698708
1008 2904711449
1009 2906607026
1010 2906651542
1011 2908763155
1012 2908782127
1013 2922393890
1014 2932797755
1015 2932804273
1016 2935610386
1017 2935651362
1018 2935659542
1019 2935771080
1020 2935781248
1021 2935786219
1022 2935793984
1023 2935823547
1024 2935849072
1025 2935888299
1026 2935912839
1027 2935922842
1028 2935930267
1029 2935939168
1030 2935946115
1031 2935955452
1032 2935972177
1033 2935976103
1034 2935986404
1035 2936013957
1036 2936022519
1037 2936035562
1038 2936049063
1039 2936060359
1040 2941531650
1041 3005485653
1042 3005511594
1043 3005594477
1044 3005600818
1045 3005716230
1046 3005723608
1047 8016528058
1048 8016533180
1049 8016546424
1050 8016555707
1051 8016601766
1052 8016608488
1053 8016616380
1054 8016624754
1055 8016638249
1056 8019532978
1057 8019546870
1058 8019551795
1059 8019620266
1060 8019632836
1061 8019647094
1062 8019655606
1063 8019660696
1064 8019685984
1065 8019692145
1066 8056971889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

51

109

0.97

PF12802

MarR_2

MarR family

49

108

0.97

PF13601

HTH_34

Winged helix DNA-binding domain

55

126

0.92

PF13463

HTH_27

Winged helix DNA-binding domain

51

117

0.91

PF13480

Acetyltransf_6

Acetyltransferase (GNAT) domain

163

291

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

187

300

0.85

PF08445

FR47

FR47-like protein

233

308

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

217

302

0.82

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

196

316

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9345 40 98
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.93 40 99
4rs8-assembly1.cif.gz_B apo structure of novel pnob8 plasmid centromere binding protein 0.9287 36 117
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9194 39 99
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9025 40 98
ID Description Score Start End Superfamily
af_Q54BP5_22_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9421 168 297 3.40.630.30
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 37 98 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9375 39 99 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.936 40 99 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9309 36 111 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C0YQ57-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9367 197 298 GO:0004596
GO:0031415
AF-A0A357LH61-F1-model_v4 N-acetyltransferase domain-containing protein 0.9347 212 298 GO:0016747
AF-A0A229HHA5-F1-model_v4 GNAT family N-acetyltransferase 0.9249 195 298 GO:0016747
AF-A0A522NY24-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9234 203 297 GO:0008080
AF-A0A7V2LEI0-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.921 205 297 GO:0005737
GO:0005840
GO:0008080

Map