F460433

General Info

Members Datasets Scaffolds Average Seq Length
533 276 1066 205

Family's Representative Sequence

Representative Sequence 3300035207|Ga0373942_0004168|Ga0373942_0004168_579_1265
Length 228
Sequence MFQDTPMPTITRALRRFLAAAAAVFAIGAAHGQAQAPAPEQVAPDVLVKNVTMEVVDLIAKDKEIQAGSRAKLIDLIEAKVLPNFNFPAMTALALGQSWNKATAEQKKRLVEEFRTLLVRTYASALAAFAGQKFDFRPLRAKATDTDVTVNVRVIQSGAQPVAIDYSMEKTSSGWKVYDVMVGGVSLVANYRTEFTNVVRESGVDGLIKNLQTKNRPPAAAQAGAPKQ

Samples

Sample ID Description Type Environment
1 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
146 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
176 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
224 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
225 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
253 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.19
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373942_0004168 3300035207 Bacteria 3368
2 JGI24742J22300_10053468 3300002244 Bacteria 734
3 rootH1_10348870 3300003323 Unclassified 1440
4 Ga0065704_10258941 3300005289 Bacteria 970
5 Ga0065704_10366569 3300005289 Bacteria 790
6 Ga0065707_10006673 3300005295 Bacteria 2947
7 Ga0065707_10088911 3300005295 Bacteria 4518
8 Ga0070676_10100148 3300005328 Bacteria 1789
9 Ga0070683_100052155 3300005329 Bacteria 3788
10 Ga0070690_100000183 3300005330 Bacteria 32306
11 Ga0070690_100095621 3300005330 Bacteria 1962
12 Ga0070690_100229379 3300005330 Bacteria 1305
13 Ga0070690_100283649 3300005330 Unclassified 1182
14 Ga0070690_100427319 3300005330 Unclassified 978
15 Ga0070690_100630233 3300005330 Bacteria 817
16 Ga0068869_100000139 3300005334 Bacteria 35367
17 Ga0068869_100023856 3300005334 Bacteria 4233
18 Ga0068869_100347206 3300005334 Bacteria 1209
19 Ga0070666_10325395 3300005335 Bacteria 1097
20 Ga0070680_100107748 3300005336 Bacteria 2317
21 Ga0070680_100231726 3300005336 Bacteria 1560
22 Ga0070680_100259186 3300005336 Bacteria 1471
23 Ga0070682_100012632 3300005337 Bacteria 4845
24 Ga0068868_100000115 3300005338 Bacteria 50197
25 Ga0070689_100004069 3300005340 Bacteria 9845
26 Ga0070689_100018105 3300005340 Bacteria 5183
27 Ga0070689_100052483 3300005340 Bacteria 3153
28 Ga0070689_100280607 3300005340 Bacteria 1382
29 Ga0070691_10003942 3300005341 Bacteria 6715
30 Ga0070691_10095485 3300005341 Bacteria 1471
31 Ga0070687_100000091 3300005343 Bacteria 29810
32 Ga0070692_10013362 3300005345 Bacteria 3825
33 Ga0070692_10033053 3300005345 Bacteria 2606
34 Ga0070669_100013100 3300005353 Bacteria 5891
35 Ga0070669_100223503 3300005353 Bacteria 1489
36 Ga0070675_100059424 3300005354 Bacteria 3154
37 Ga0070673_100180392 3300005364 Bacteria 1807
38 Ga0070673_100416663 3300005364 Bacteria 1204
39 Ga0070673_100477345 3300005364 Bacteria 1125
40 Ga0070714_100024564 3300005435 Bacteria 4965
41 Ga0070701_10000914 3300005438 Bacteria 10687
42 Ga0070701_10056986 3300005438 Bacteria 2046
43 Ga0070701_10172700 3300005438 Bacteria 1260
44 Ga0070701_10340229 3300005438 Bacteria 934
45 Ga0070705_100000441 3300005440 Bacteria 23797
46 Ga0070705_100011824 3300005440 Bacteria 4418
47 Ga0070705_100032771 3300005440 Bacteria 2890
48 Ga0070705_100162916 3300005440 Bacteria 1493
49 Ga0070700_100000789 3300005441 Bacteria 15543
50 Ga0070700_100002644 3300005441 Bacteria 9169
51 Ga0070700_100183797 3300005441 Bacteria 1457
52 Ga0070694_100000133 3300005444 Bacteria 37050
53 Ga0070694_100081927 3300005444 Bacteria 2246
54 Ga0070694_100104775 3300005444 Bacteria 2006
55 Ga0070694_100214986 3300005444 Bacteria 1439
56 Ga0070694_100282268 3300005444 Bacteria 1266
57 Ga0070681_10000081 3300005458 Bacteria 71809
58 Ga0070681_10048418 3300005458 Bacteria 4248
59 Ga0068867_100000084 3300005459 Bacteria 58558
60 Ga0068867_100002479 3300005459 Bacteria 12970
61 Ga0068867_101202909 3300005459 Unclassified 696
62 Ga0070706_100319864 3300005467 Bacteria 1447
63 Ga0070706_100760010 3300005467 Bacteria 898
64 Ga0070707_100314155 3300005468 Bacteria 1523
65 Ga0070699_100003701 3300005518 Bacteria 13522
66 Ga0070699_100096601 3300005518 Bacteria 2587
67 Ga0070679_100011998 3300005530 Bacteria 8270
68 Ga0070679_100535843 3300005530 Bacteria 1114
69 Ga0070679_100766522 3300005530 Bacteria 908
70 Ga0070684_100223447 3300005535 Bacteria 1718
71 Ga0070697_100000299 3300005536 Bacteria 39638
72 Ga0070697_100004807 3300005536 Bacteria 10352
73 Ga0070697_100203074 3300005536 Bacteria 1685
74 Ga0068853_100054648 3300005539 Bacteria 3442
75 Ga0070686_100000193 3300005544 Bacteria 42276
76 Ga0070686_100080565 3300005544 Bacteria 2155
77 Ga0070686_100264717 3300005544 Bacteria 1262
78 Ga0070695_100000163 3300005545 Bacteria 31628
79 Ga0070695_100000641 3300005545 Bacteria 18567
80 Ga0070695_100188627 3300005545 Bacteria 1466
81 Ga0070695_100247231 3300005545 Bacteria 1296
82 Ga0070695_100440945 3300005545 Bacteria 996
83 Ga0070696_100000570 3300005546 Bacteria 23539
84 Ga0070696_100077346 3300005546 Bacteria 2351
85 Ga0070696_100226253 3300005546 Bacteria 1406
86 Ga0070693_100000111 3300005547 Bacteria 36381
87 Ga0070693_100095631 3300005547 Bacteria 1799
88 Ga0070693_100207627 3300005547 Bacteria 1276
89 Ga0070693_100512505 3300005547 Bacteria 853
90 Ga0070704_100000008 3300005549 Bacteria 71641
91 Ga0070704_100006181 3300005549 Bacteria 7037
92 Ga0070704_100131492 3300005549 Bacteria 1940
93 Ga0070704_100384233 3300005549 Bacteria 1194
94 Ga0070704_100553611 3300005549 Bacteria 1005
95 Ga0068855_100000242 3300005563 Bacteria 68674
96 Ga0070664_100856794 3300005564 Bacteria 851
97 Ga0068854_100004656 3300005578 Bacteria 8656
98 Ga0068856_100172729 3300005614 Bacteria 2173
99 Ga0068856_100385675 3300005614 Bacteria 1421
100 Ga0068856_100568358 3300005614 Bacteria 1155
101 Ga0070702_100000012 3300005615 Bacteria 58298
102 Ga0070702_100008812 3300005615 Bacteria 4905
103 Ga0070702_100036256 3300005615 Bacteria 2731
104 Ga0068859_100001460 3300005617 Bacteria 24031
105 Ga0068866_10000109 3300005718 Bacteria 35401
106 Ga0068861_100000814 3300005719 Bacteria 18847
107 Ga0068861_100033597 3300005719 Bacteria 3786
108 Ga0068870_10018126 3300005840 Bacteria 3395
109 Ga0068870_10019842 3300005840 Bacteria 3266
110 Ga0068863_100274783 3300005841 Bacteria 1631
111 Ga0068858_100013374 3300005842 Bacteria 7744
112 Ga0068858_100083983 3300005842 Bacteria 2962
113 Ga0068860_100014674 3300005843 Bacteria 7665
114 Ga0068862_100005995 3300005844 Bacteria 10118
115 Ga0068862_100008234 3300005844 Bacteria 8625
116 Ga0081538_10218719 3300005981 Bacteria 758
117 Ga0081539_10004782 3300005985 Bacteria 14603
118 Ga0070716_100288424 3300006173 Bacteria 1136
119 Ga0097621_100005558 3300006237 Bacteria 8887
120 Ga0097621_100044286 3300006237 Bacteria 3590
121 Ga0097621_100124041 3300006237 Bacteria 2193
122 Ga0068871_100000559 3300006358 Bacteria 25362
123 Ga0068871_100002092 3300006358 Bacteria 13508
124 Ga0075428_100001187 3300006844 Bacteria 27861
125 Ga0075428_100587869 3300006844 Unclassified 1189
126 Ga0075428_100671347 3300006844 Bacteria 1105
127 Ga0075430_100020616 3300006846 Bacteria 5607
128 Ga0075430_100095022 3300006846 Bacteria 2492
129 Ga0075430_100536060 3300006846 Unclassified 965
130 Ga0075430_100660830 3300006846 Unclassified 862
131 Ga0075431_100204311 3300006847 Bacteria 2020
132 Ga0075431_100241079 3300006847 Bacteria 1839
133 Ga0075431_100357322 3300006847 Bacteria 1468
134 Ga0075431_100448924 3300006847 Bacteria 1285
135 Ga0075433_10006494 3300006852 Bacteria 9246
136 Ga0075433_10177733 3300006852 Bacteria 1894
137 Ga0075434_100000125 3300006871 Bacteria 45534
138 Ga0075434_100001287 3300006871 Bacteria 20920
139 Ga0075434_100166772 3300006871 Bacteria 2222
140 Ga0075429_100000891 3300006880 Bacteria 23613
141 Ga0075429_100085816 3300006880 Bacteria 2744
142 Ga0075429_100088986 3300006880 Bacteria 2691
143 Ga0075429_100151093 3300006880 Bacteria 2033
144 Ga0068865_100000986 3300006881 Bacteria 16302
145 Ga0068865_100004107 3300006881 Bacteria 8751
146 Ga0075436_100000789 3300006914 Bacteria 21020
147 Ga0075436_100001670 3300006914 Bacteria 15165
148 Ga0075436_100013534 3300006914 Bacteria 5588
149 Ga0075436_100057465 3300006914 Bacteria 2687
150 Ga0075436_100119433 3300006914 Bacteria 1843
151 Ga0075436_100258071 3300006914 Bacteria 1242
152 Ga0097620_100001461 3300006931 Bacteria 24031
153 Ga0075435_100000356 3300007076 Bacteria 28102
154 Ga0075435_100000655 3300007076 Bacteria 21307
155 Ga0075435_100086989 3300007076 Bacteria 2574
156 Ga0099794_10056445 3300007265 Bacteria 1900
157 Ga0099794_10078404 3300007265 Bacteria 1626
158 Ga0111539_10011985 3300009094 Bacteria 10872
159 Ga0111539_10066550 3300009094 Bacteria 4256
160 Ga0111539_10086733 3300009094 Bacteria 3678
161 Ga0111539_10099168 3300009094 Bacteria 3421
162 Ga0111539_10122075 3300009094 Bacteria 3053
163 Ga0111539_11353004 3300009094 Bacteria 826
164 Ga0105245_10000245 3300009098 Bacteria 51952
165 Ga0114129_10010044 3300009147 Bacteria 13495
166 Ga0114129_10076279 3300009147 Bacteria 4667
167 Ga0114129_10231981 3300009147 Bacteria 2485
168 Ga0114129_10237702 3300009147 Bacteria 2450
169 Ga0114129_10408089 3300009147 Bacteria 1789
170 Ga0114129_10417423 3300009147 Bacteria 1766
171 Ga0114129_10437079 3300009147 Bacteria 1718
172 Ga0105243_10000279 3300009148 Bacteria 56997
173 Ga0105243_10250459 3300009148 Bacteria 1581
174 Ga0105243_10798372 3300009148 Bacteria 930
175 Ga0105241_10029613 3300009174 Bacteria 4087
176 Ga0105242_10000480 3300009176 Bacteria 31755
177 Ga0105249_10007151 3300009553 Bacteria 9742
178 Ga0105249_10012644 3300009553 Bacteria 7443
179 Ga0105249_10672582 3300009553 Bacteria 1094
180 Ga0105239_10862372 3300010375 Bacteria 1039
181 Ga0157316_1008954 3300012510 Bacteria 888
182 Ga0157378_10002150 3300013297 Bacteria 17495
183 Ga0163162_10272329 3300013306 Bacteria 1825
184 Ga0157372_11652039 3300013307 Bacteria 737
185 Ga0157375_10707129 3300013308 Bacteria 1161
186 Ga0163163_11061934 3300014325 Bacteria 873
187 Ga0157380_10002974 3300014326 Bacteria 11536
188 Ga0157380_10079990 3300014326 Bacteria 2670
189 Ga0157379_10106004 3300014968 Bacteria 2523
190 Ga0157376_10002130 3300014969 Bacteria 13330
191 Ga0157376_10091782 3300014969 Bacteria 2631
192 Ga0207642_10000702 3300025899 Bacteria 10369
193 Ga0207642_10033122 3300025899 Bacteria 2183
194 Ga0207680_10595933 3300025903 Bacteria 790
195 Ga0207647_10137403 3300025904 Bacteria 1433
196 Ga0207645_10027406 3300025907 Bacteria 3679
197 Ga0207645_10142416 3300025907 Bacteria 1562
198 Ga0207645_10553196 3300025907 Bacteria 781
199 Ga0207643_10040758 3300025908 Bacteria 2615
200 Ga0207643_10054194 3300025908 Bacteria 2279
201 Ga0207643_10210954 3300025908 Bacteria 1185
202 Ga0207654_10292197 3300025911 Unclassified 1106
203 Ga0207707_10001519 3300025912 Bacteria 21403
204 Ga0207707_10054844 3300025912 Bacteria 3469
205 Ga0207660_10002762 3300025917 Bacteria 11505
206 Ga0207660_10298777 3300025917 Bacteria 1282
207 Ga0207662_10000176 3300025918 Bacteria 30450
208 Ga0207662_10101269 3300025918 Bacteria 1785
209 Ga0207652_10016191 3300025921 Bacteria 6083
210 Ga0207652_10447626 3300025921 Bacteria 1164
211 Ga0207652_10789105 3300025921 Bacteria 844
212 Ga0207681_10013747 3300025923 Bacteria 5013
213 Ga0207681_10360911 3300025923 Bacteria 1165
214 Ga0207687_10008984 3300025927 Bacteria 6531
215 Ga0207687_10462681 3300025927 Bacteria 1053
216 Ga0207700_10445366 3300025928 Bacteria 1141
217 Ga0207700_10528219 3300025928 Unclassified 1046
218 Ga0207664_10033998 3300025929 Bacteria 3923
219 Ga0207686_10000627 3300025934 Bacteria 21927
220 Ga0207709_10000549 3300025935 Bacteria 32146
221 Ga0207670_10001899 3300025936 Bacteria 10919
222 Ga0207670_10234929 3300025936 Unclassified 1409
223 Ga0207669_10010567 3300025937 Bacteria 4449
224 Ga0207704_10000329 3300025938 Bacteria 22100
225 Ga0207704_10004972 3300025938 Bacteria 6114
226 Ga0207665_10097065 3300025939 Bacteria 2051
227 Ga0207689_10001276 3300025942 Bacteria 24276
228 Ga0207689_10035397 3300025942 Bacteria 4148
229 Ga0207661_10050220 3300025944 Bacteria 3322
230 Ga0207661_10803801 3300025944 Unclassified 866
231 Ga0207679_10687114 3300025945 Bacteria 928
232 Ga0207651_10142136 3300025960 Bacteria 1855
233 Ga0207651_10404445 3300025960 Bacteria 1162
234 Ga0207712_10046117 3300025961 Bacteria 3020
235 Ga0207640_10008328 3300025981 Bacteria 5759
236 Ga0207677_10000669 3300026023 Bacteria 20376
237 Ga0207703_10008924 3300026035 Bacteria 7897
238 Ga0207703_10151359 3300026035 Bacteria 2024
239 Ga0207708_10000275 3300026075 Bacteria 40312
240 Ga0207708_10003113 3300026075 Bacteria 12208
241 Ga0207708_10121355 3300026075 Bacteria 2037
242 Ga0207708_10230072 3300026075 Bacteria 1488
243 Ga0207702_10098758 3300026078 Bacteria 2572
244 Ga0207702_10310113 3300026078 Bacteria 1500
245 Ga0207641_10242508 3300026088 Bacteria 1680
246 Ga0207648_10000185 3300026089 Bacteria 65925
247 Ga0207648_10001654 3300026089 Bacteria 24445
248 Ga0207648_10526552 3300026089 Bacteria 1083
249 Ga0207648_11152421 3300026089 Unclassified 728
250 Ga0207676_10258412 3300026095 Bacteria 1571
251 Ga0207674_10418050 3300026116 Bacteria 1295
252 Ga0207675_100000150 3300026118 Bacteria 61064
253 Ga0207675_100014097 3300026118 Bacteria 7453
254 Ga0207683_10049728 3300026121 Bacteria 3671
255 Ga0207698_10767925 3300026142 Bacteria 964
256 Ga0209969_1026327 3300027360 Bacteria 879
257 Ga0209967_1000418 3300027364 Bacteria 5601
258 Ga0209981_1001186 3300027378 Bacteria 3303
259 Ga0210000_1003291 3300027462 Bacteria 2328
260 Ga0210000_1006055 3300027462 Bacteria 1762
261 Ga0209995_1001807 3300027471 Bacteria 3336
262 Ga0209995_1003041 3300027471 Bacteria 2660
263 Ga0209968_1009343 3300027526 Bacteria 1501
264 Ga0209999_1001013 3300027543 Bacteria 4764
265 Ga0209970_1002554 3300027614 Bacteria 3083
266 Ga0209588_1006635 3300027671 Bacteria 3373
267 Ga0209588_1038786 3300027671 Bacteria 1535
268 Ga0209971_1006736 3300027682 Bacteria 2720
269 Ga0209971_1071108 3300027682 Bacteria 844
270 Ga0209966_1002160 3300027695 Bacteria 3280
271 Ga0207428_10000290 3300027907 Bacteria 67367
272 Ga0207428_10054350 3300027907 Bacteria 3189
273 Ga0207428_10071057 3300027907 Bacteria 2735
274 Ga0207428_10099810 3300027907 Bacteria 2244
275 Ga0268265_10001010 3300028380 Bacteria 25458
276 Ga0268265_10023096 3300028380 Bacteria 4380
277 Ga0268265_10117637 3300028380 Bacteria 2183
278 Ga0268265_10139708 3300028380 Bacteria 2026
279 Ga0268264_10000903 3300028381 Bacteria 31199
280 Ga0268264_10399261 3300028381 Bacteria 1321
281 Ga0307408_100684312 3300031548 Bacteria 920
282 Ga0307405_10179449 3300031731 Bacteria 1519
283 Ga0307405_10198763 3300031731 Bacteria 1454
284 Ga0307413_10499605 3300031824 Bacteria 976
285 Ga0307410_10186426 3300031852 Bacteria 1575
286 Ga0307412_10272401 3300031911 Bacteria 1325
287 Ga0307412_10611348 3300031911 Bacteria 925
288 Ga0307412_10750308 3300031911 Bacteria 842
289 Ga0307416_100191972 3300032002 Bacteria 1927
290 Ga0307416_100231181 3300032002 Bacteria 1783
291 Ga0307416_100299170 3300032002 Bacteria 1598
292 Ga0307416_100980081 3300032002 Bacteria 948
293 Ga0307416_101545141 3300032002 Bacteria 769
294 Ga0307411_10051530 3300032005 Bacteria 2686
295 Ga0307411_10308453 3300032005 Bacteria 1272
296 Ga0373930_0004227 3300034816 Bacteria 2323
297 Ga0373930_0047257 3300034816 Bacteria 931
298 Ga0373958_0001356 3300034819 Bacteria 3277
299 Ga0373959_0005408 3300034820 Bacteria 2093
300 Ga0373926_0007023 3300035083 Bacteria 3744
301 Ga0373929_0019459 3300035085 Bacteria 1360
302 Ga0373940_0006840 3300035088 Bacteria 2550
303 Ga0373944_0000377 3300035089 Bacteria 10072
304 Ga0373951_0073966 3300035091 Bacteria 872
305 Ga0373952_0003000 3300035092 Bacteria 3048
306 Ga0373932_0006230 3300035112 Bacteria 2818
307 Ga0373939_0013732 3300035114 Bacteria 2089
308 Ga0373939_0056186 3300035114 Bacteria 1238
309 Ga0373939_0064807 3300035114 Bacteria 1174
310 Ga0373941_0008437 3300035115 Bacteria 2558
311 Ga0373941_0024888 3300035115 Bacteria 1723
312 Ga0373941_0207978 3300035115 Bacteria 747
313 Ga0373945_0008166 3300035116 Bacteria 3403
314 Ga0373954_0000088 3300035118 Bacteria 31362
315 Ga0373960_0011786 3300035121 Bacteria 2161
316 Ga0373943_0021022 3300035170 Bacteria 3013
317 Ga0373946_0009285 3300035171 Bacteria 3618
318 Ga0373955_0433053 3300035172 Bacteria 801
319 Ga0373942_0004635 3300035207 Bacteria 3188
320 Ga0373942_0010115 3300035207 Bacteria 2213
321 Ga0373942_0035098 3300035207 Bacteria 1344
322 Ga0373961_0005986 3300035241 Bacteria 2920
323 Ga0373961_0021682 3300035241 Bacteria 1711
324 Ga0373962_0004873 3300035242 Bacteria 3244
325 Ga0373924_0026154 3300035410 Bacteria 2313
326 Ga0373931_0000163 3300035691 Bacteria 29108
327 Ga0373931_0019730 3300035691 Bacteria 3368
328 Ga0373931_0183479 3300035691 Bacteria 1241
329 Ga0373931_0212383 3300035691 Bacteria 1161
330 Ga0373935_0087492 3300035692 Bacteria 2034
331 Ga0373935_0414565 3300035692 Bacteria 969
332 Ga0373927_0030265 3300035695 Bacteria 3532
333 Ga0373933_0002313 3300035724 Bacteria 10829
334 Ga0373947_0036831 3300035725 Bacteria 2901
335 Ga0373937_0001313 3300036401 Bacteria 20818
336 Ga0373937_0037568 3300036401 Bacteria 4414
337 Ga0373937_0186141 3300036401 Bacteria 1950
338 Ga0373925_0017906 3300037068 Bacteria 5142
339 Ga0373925_0260589 3300037068 Unclassified 1393
340 Ga0436360_0824509 3300039438 Bacteria 1954
341 Ga0451807_0812912 3300041486 Bacteria 1802
342 Ga0439441_000242 3300042001 Bacteria 5308
343 Ga0439441_001953 3300042001 Bacteria 2831
344 Ga0439443_000355 3300042003 Bacteria 3859
345 Ga0439443_004196 3300042003 Bacteria 1861
346 Ga0439456_055796 3300042013 Bacteria 865
347 Ga0439446_0007516 3300042156 Bacteria 2866
348 Ga0439434_0029745 3300042435 Bacteria 1656
349 Ga0439435_0000145 3300042436 Bacteria 9631
350 Ga0439435_0002434 3300042436 Bacteria 3695
351 Ga0439444_0000161 3300042437 Bacteria 6042
352 Ga0439444_0000539 3300042437 Bacteria 4305
353 Ga0439459_0104253 3300042438 Bacteria 698
354 Ga0439460_0000684 3300042461 Bacteria 7502
355 Ga0466964_0068278 3300044706 Bacteria 1496
356 Ga0453684_0235879 3300044712 Bacteria 2109
357 Ga0466968_0303071 3300044735 Bacteria 769
358 Ga0451576_0001107 3300045051 Bacteria 49185
359 Ga0451576_0027642 3300045051 Bacteria 6089
360 Ga0451576_0028514 3300045051 Bacteria 5976
361 Ga0451576_0394923 3300045051 Bacteria 1450
362 Ga0466967_0039326 3300045976 Bacteria 4065
363 Ga0495592_0014717 3300046454 Bacteria 5939
364 Ga0495603_0004691 3300046455 Bacteria 8164
365 Ga0495603_0185576 3300046455 Bacteria 1203
366 Ga0495580_0012751 3300046472 Bacteria 6441
367 Ga0495582_0057631 3300046473 Bacteria 2142
368 Ga0495582_0245379 3300046473 Bacteria 1026
369 Ga0495639_0010490 3300046475 Bacteria 3990
370 Ga0495584_0093331 3300046491 Bacteria 1519
371 Ga0495594_0164291 3300046499 Bacteria 1262
372 Ga0495608_0043296 3300046511 Bacteria 3008
373 Ga0495608_0199040 3300046511 Bacteria 1263
374 Ga0495628_0128539 3300046516 Bacteria 1939
375 Ga0495630_0027336 3300046517 Bacteria 4231
376 Ga0495630_0068495 3300046517 Bacteria 2669
377 Ga0495663_0095918 3300046525 Bacteria 972
378 Ga0495666_0090799 3300046526 Bacteria 1441
379 Ga0495642_0130894 3300046528 Bacteria 1080
380 Ga0495652_0143390 3300046529 Bacteria 1876
381 Ga0495665_0074454 3300046531 Bacteria 1788
382 Ga0495640_0101863 3300046533 Bacteria 1884
383 Ga0495586_0000624 3300046535 Bacteria 20417
384 Ga0495586_0036718 3300046535 Bacteria 2630
385 Ga0495587_0234631 3300046536 Bacteria 1033
386 Ga0495645_0078037 3300046543 Bacteria 2381
387 Ga0495667_0048177 3300046559 Bacteria 2814
388 Ga0495667_0298669 3300046559 Bacteria 1020
389 Ga0495634_0037880 3300046642 Bacteria 3292
390 Ga0495635_0192491 3300046663 Bacteria 1384
391 Ga0495588_0047457 3300046674 Bacteria 2205
392 Ga0495599_0057923 3300046678 Bacteria 2424
393 Ga0495647_0000252 3300046681 Bacteria 14640
394 Ga0495658_0008852 3300046683 Bacteria 5004
395 Ga0495658_0011299 3300046683 Bacteria 4487
396 Ga0495669_0003951 3300046684 Bacteria 6104
397 Ga0495669_0070162 3300046684 Bacteria 1596
398 Ga0495613_0112722 3300046689 Bacteria 1958
399 Ga0495624_0082248 3300046690 Bacteria 1993
400 Ga0495624_0154204 3300046690 Bacteria 1404
401 Ga0495600_0094704 3300046809 Bacteria 1947
402 Ga0495581_0093417 3300047315 Bacteria 1746
403 Ga0495604_0003259 3300047317 Bacteria 12969
404 Ga0495636_0002413 3300047318 Bacteria 7168
405 Ga0495674_0232216 3300047319 Bacteria 1522
406 Ga0495684_0324020 3300047471 Bacteria 1101
407 Ga0501291_015091 3300049514 Bacteria 1164
408 Ga0501291_016280 3300049514 Bacteria 1134
409 Ga0501295_045493 3300049518 Bacteria 925
410 Ga0501296_002437 3300049519 Bacteria 1948
411 Ga0501298_006593 3300049521 Bacteria 1902
412 Ga0501303_004559 3300049526 Bacteria 1150
413 Ga0501031_0044304 3300049568 Bacteria 2903
414 Ga0501032_0041811 3300049569 Bacteria 3111
415 Ga0501033_0023943 3300049570 Bacteria 4606
416 Ga0501033_0263627 3300049570 Bacteria 1219
417 Ga0501036_0015965 3300049572 Bacteria 6272
418 Ga0501036_0080707 3300049572 Bacteria 2749
419 Ga0501036_0219826 3300049572 Bacteria 1595
420 Ga0501036_0557911 3300049572 Bacteria 951
421 Ga0501037_0030483 3300049573 Bacteria 3986
422 Ga0501038_0028048 3300049574 Bacteria 5002
423 Ga0501039_0004420 3300049575 Bacteria 10611
424 Ga0501039_0034036 3300049575 Bacteria 3931
425 Ga0501039_0052153 3300049575 Bacteria 3165
426 Ga0501040_0002776 3300049576 Bacteria 11290
427 Ga0501040_0003267 3300049576 Bacteria 10476
428 Ga0501041_0001563 3300049577 Bacteria 12746
429 Ga0501041_0007863 3300049577 Bacteria 6263
430 Ga0501041_0036246 3300049577 Bacteria 2989
431 Ga0501041_0091972 3300049577 Bacteria 1873
432 Ga0501041_0237918 3300049577 Bacteria 1144
433 Ga0501042_0002917 3300049578 Bacteria 10616
434 Ga0501042_0023283 3300049578 Bacteria 4333
435 Ga0501042_0036319 3300049578 Bacteria 3495
436 Ga0501043_0010882 3300049579 Bacteria 7123
437 Ga0501043_0107882 3300049579 Bacteria 2187
438 Ga0501046_0002700 3300049580 Bacteria 16517
439 Ga0501046_0122985 3300049580 Bacteria 1973
440 Ga0501046_0382408 3300049580 Bacteria 1019
441 Ga0501047_0081114 3300049581 Bacteria 3119
442 Ga0501048_0010701 3300049582 Bacteria 6842
443 Ga0501048_0031156 3300049582 Bacteria 3858
444 Ga0501048_0086860 3300049582 Bacteria 2206
445 Ga0501048_0169574 3300049582 Bacteria 1546
446 Ga0501067_0016461 3300049583 Bacteria 4085
447 Ga0501068_0014725 3300049584 Bacteria 4475
448 Ga0501070_0058141 3300049586 Bacteria 3205
449 Ga0501071_0004683 3300049587 Bacteria 8694
450 Ga0501071_0096289 3300049587 Bacteria 2178
451 Ga0501072_0006099 3300049588 Bacteria 9196
452 Ga0501072_0008315 3300049588 Bacteria 7882
453 Ga0501072_0068750 3300049588 Bacteria 2796
454 Ga0501072_0120635 3300049588 Bacteria 2089
455 Ga0501072_0223187 3300049588 Bacteria 1502
456 Ga0501073_0053777 3300049589 Bacteria 2819
457 Ga0501074_0019204 3300049590 Bacteria 4963
458 Ga0501075_0002198 3300049591 Bacteria 12907
459 Ga0501075_0023103 3300049591 Bacteria 4550
460 Ga0501076_0001244 3300049592 Bacteria 16969
461 Ga0501076_0005555 3300049592 Bacteria 9084
462 Ga0501077_0003540 3300049593 Bacteria 9383
463 Ga0501077_0015891 3300049593 Bacteria 4742
464 Ga0501077_0058450 3300049593 Bacteria 2448
465 Ga0501247_039750 3300049677 Bacteria 669
466 Ga0501221_131522 3300049704 Bacteria 648
467 Ga0501079_0002346 3300049741 Bacteria 13734
468 Ga0501079_0004200 3300049741 Bacteria 10676
469 Ga0501079_0169920 3300049741 Bacteria 1700
470 Ga0501079_0551245 3300049741 Bacteria 907
471 Ga0501080_0027376 3300049742 Bacteria 5300
472 Ga0501081_0007514 3300049743 Bacteria 7067
473 Ga0501081_0025233 3300049743 Bacteria 3997
474 Ga0501081_0827162 3300049743 Bacteria 697
475 Ga0501035_0180643 3300049822 Bacteria 1818
476 Ga0501044_0195480 3300049823 Bacteria 1983
477 Ga0501045_0002510 3300049824 Bacteria 12474
478 Ga0501045_0003944 3300049824 Bacteria 10220
479 Ga0501045_0117042 3300049824 Bacteria 1978
480 nmdc:mga05p37_133157_c1 3300050507 Bacteria 3049
481 nmdc:mga05p37_147368_c1 3300050507 Bacteria 2880
482 nmdc:mga05p37_224091_c1 3300050507 Bacteria 2268
483 nmdc:mga05p37_389_c1 3300050507 Bacteria 47594
484 nmdc:mga05p37_682197_c1 3300050507 Unclassified 1145
485 nmdc:mga09592_166_c1 3300050508 Bacteria 46469
486 nmdc:mga09592_79496_c1 3300050508 Bacteria 2792
487 nmdc:mga09592_87228_c1 3300050508 Bacteria 2664
488 nmdc:mga0qj67_220611_c1 3300050509 Bacteria 1539
489 nmdc:mga0qj67_22344_c1 3300050509 Bacteria 4861
490 nmdc:mga0qj67_504331_c1 3300050509 Bacteria 973
491 nmdc:mga06r32_142601_c1 3300050510 Bacteria 2373
492 nmdc:mga06r32_225304_c1 3300050510 Bacteria 1863
493 nmdc:mga06r32_48940_c1 3300050510 Bacteria 4043
494 nmdc:mga08y16_12735_c1 3300050511 Bacteria 8849
495 nmdc:mga08y16_158371_c1 3300050511 Bacteria 2353
496 nmdc:mga08y16_2159_c1 3300050511 Bacteria 20171
497 nmdc:mga08y16_41967_c1 3300050511 Bacteria 4791
498 nmdc:mga08y16_48378_c1 3300050511 Bacteria 4451
499 nmdc:mga08y16_86915_c1 3300050511 Bacteria 3258
500 nmdc:mga0n895_1063477_c1 3300050512 Bacteria 788
501 nmdc:mga0n895_110524_c1 3300050512 Bacteria 2765
502 nmdc:mga0n895_163300_c1 3300050512 Bacteria 2259
503 nmdc:mga0n895_196_c1 3300050512 Bacteria 37551
504 nmdc:mga0rr50_1196_c1 3300050513 Bacteria 14093
505 nmdc:mga0rr50_1513_c1 3300050513 Bacteria 12805
506 nmdc:mga0rr50_24827_c1 3300050513 Bacteria 4158
507 nmdc:mga0rr50_346571_c1 3300050513 Bacteria 1249
508 nmdc:mga08x19_247529_c1 3300050514 Bacteria 1230
509 nmdc:mga08x19_258_c1 3300050514 Bacteria 28365
510 nmdc:mga08x19_46509_c1 3300050514 Bacteria 2776
511 nmdc:mga08x19_48888_c1 3300050514 Bacteria 2711
512 nmdc:mga08x19_516875_c1 3300050514 Bacteria 843
513 nmdc:mga08x19_759_c1 3300050514 Bacteria 20607
514 nmdc:mga08x19_87800_c1 3300050514 Bacteria 2049
515 nmdc:mga0a205_125936_c1 3300050515 Bacteria 2461
516 nmdc:mga0a205_22262_c1 3300050515 Bacteria 6001
517 nmdc:mga0a205_24715_c1 3300050515 Bacteria 5715
518 nmdc:mga0a205_308701_c1 3300050515 Bacteria 1454
519 nmdc:mga0a205_491860_c1 3300050515 Bacteria 1084
520 nmdc:mga0a205_532414_c1 3300050515 Bacteria 1031
521 Ga0495601_0077639 3300053077 Bacteria 2127
522 Ga0495619_0190886 3300053085 Bacteria 1418
523 Ga0500566_0237177 3300053094 Bacteria 896
524 Ga0501084_0008018 3300054114 Bacteria 8696
525 Ga0501084_0114784 3300054114 Bacteria 2264
526 Ga0501084_0174236 3300054114 Bacteria 1816
527 Ga0501084_0338339 3300054114 Bacteria 1271
528 Ga0590071_076284 3300059421 Unclassified 830
529 Ga0590077_033822 3300059426 Bacteria 1122
530 Ga0501082_0002298 3300060353 Bacteria 16717
531 Ga0501082_0017077 3300060353 Bacteria 6252
532 Ga0530510_0000245 3300061734 Bacteria 34065
533 Ga0530510_0004031 3300061734 Bacteria 10140
534 Ga0373942_0004168
535 JGI24742J22300_10053468
536 rootH1_10348870
537 Ga0065704_10258941
538 Ga0065704_10366569
539 Ga0065707_10006673
540 Ga0065707_10088911
541 Ga0070676_10100148
542 Ga0070683_100052155
543 Ga0070690_100000183
544 Ga0070690_100095621
545 Ga0070690_100229379
546 Ga0070690_100283649
547 Ga0070690_100427319
548 Ga0070690_100630233
549 Ga0068869_100000139
550 Ga0068869_100023856
551 Ga0068869_100347206
552 Ga0070666_10325395
553 Ga0070680_100107748
554 Ga0070680_100231726
555 Ga0070680_100259186
556 Ga0070682_100012632
557 Ga0068868_100000115
558 Ga0070689_100004069
559 Ga0070689_100018105
560 Ga0070689_100052483
561 Ga0070689_100280607
562 Ga0070691_10003942
563 Ga0070691_10095485
564 Ga0070687_100000091
565 Ga0070692_10013362
566 Ga0070692_10033053
567 Ga0070669_100013100
568 Ga0070669_100223503
569 Ga0070675_100059424
570 Ga0070673_100180392
571 Ga0070673_100416663
572 Ga0070673_100477345
573 Ga0070714_100024564
574 Ga0070701_10000914
575 Ga0070701_10056986
576 Ga0070701_10172700
577 Ga0070701_10340229
578 Ga0070705_100000441
579 Ga0070705_100011824
580 Ga0070705_100032771
581 Ga0070705_100162916
582 Ga0070700_100000789
583 Ga0070700_100002644
584 Ga0070700_100183797
585 Ga0070694_100000133
586 Ga0070694_100081927
587 Ga0070694_100104775
588 Ga0070694_100214986
589 Ga0070694_100282268
590 Ga0070681_10000081
591 Ga0070681_10048418
592 Ga0068867_100000084
593 Ga0068867_100002479
594 Ga0068867_101202909
595 Ga0070706_100319864
596 Ga0070706_100760010
597 Ga0070707_100314155
598 Ga0070699_100003701
599 Ga0070699_100096601
600 Ga0070679_100011998
601 Ga0070679_100535843
602 Ga0070679_100766522
603 Ga0070684_100223447
604 Ga0070697_100000299
605 Ga0070697_100004807
606 Ga0070697_100203074
607 Ga0068853_100054648
608 Ga0070686_100000193
609 Ga0070686_100080565
610 Ga0070686_100264717
611 Ga0070695_100000163
612 Ga0070695_100000641
613 Ga0070695_100188627
614 Ga0070695_100247231
615 Ga0070695_100440945
616 Ga0070696_100000570
617 Ga0070696_100077346
618 Ga0070696_100226253
619 Ga0070693_100000111
620 Ga0070693_100095631
621 Ga0070693_100207627
622 Ga0070693_100512505
623 Ga0070704_100000008
624 Ga0070704_100006181
625 Ga0070704_100131492
626 Ga0070704_100384233
627 Ga0070704_100553611
628 Ga0068855_100000242
629 Ga0070664_100856794
630 Ga0068854_100004656
631 Ga0068856_100172729
632 Ga0068856_100385675
633 Ga0068856_100568358
634 Ga0070702_100000012
635 Ga0070702_100008812
636 Ga0070702_100036256
637 Ga0068859_100001460
638 Ga0068866_10000109
639 Ga0068861_100000814
640 Ga0068861_100033597
641 Ga0068870_10018126
642 Ga0068870_10019842
643 Ga0068863_100274783
644 Ga0068858_100013374
645 Ga0068858_100083983
646 Ga0068860_100014674
647 Ga0068862_100005995
648 Ga0068862_100008234
649 Ga0081538_10218719
650 Ga0081539_10004782
651 Ga0070716_100288424
652 Ga0097621_100005558
653 Ga0097621_100044286
654 Ga0097621_100124041
655 Ga0068871_100000559
656 Ga0068871_100002092
657 Ga0075428_100001187
658 Ga0075428_100587869
659 Ga0075428_100671347
660 Ga0075430_100020616
661 Ga0075430_100095022
662 Ga0075430_100536060
663 Ga0075430_100660830
664 Ga0075431_100204311
665 Ga0075431_100241079
666 Ga0075431_100357322
667 Ga0075431_100448924
668 Ga0075433_10006494
669 Ga0075433_10177733
670 Ga0075434_100000125
671 Ga0075434_100001287
672 Ga0075434_100166772
673 Ga0075429_100000891
674 Ga0075429_100085816
675 Ga0075429_100088986
676 Ga0075429_100151093
677 Ga0068865_100000986
678 Ga0068865_100004107
679 Ga0075436_100000789
680 Ga0075436_100001670
681 Ga0075436_100013534
682 Ga0075436_100057465
683 Ga0075436_100119433
684 Ga0075436_100258071
685 Ga0097620_100001461
686 Ga0075435_100000356
687 Ga0075435_100000655
688 Ga0075435_100086989
689 Ga0099794_10056445
690 Ga0099794_10078404
691 Ga0111539_10011985
692 Ga0111539_10066550
693 Ga0111539_10086733
694 Ga0111539_10099168
695 Ga0111539_10122075
696 Ga0111539_11353004
697 Ga0105245_10000245
698 Ga0114129_10010044
699 Ga0114129_10076279
700 Ga0114129_10231981
701 Ga0114129_10237702
702 Ga0114129_10408089
703 Ga0114129_10417423
704 Ga0114129_10437079
705 Ga0105243_10000279
706 Ga0105243_10250459
707 Ga0105243_10798372
708 Ga0105241_10029613
709 Ga0105242_10000480
710 Ga0105249_10007151
711 Ga0105249_10012644
712 Ga0105249_10672582
713 Ga0105239_10862372
714 Ga0157316_1008954
715 Ga0157378_10002150
716 Ga0163162_10272329
717 Ga0157372_11652039
718 Ga0157375_10707129
719 Ga0163163_11061934
720 Ga0157380_10002974
721 Ga0157380_10079990
722 Ga0157379_10106004
723 Ga0157376_10002130
724 Ga0157376_10091782
725 Ga0207642_10000702
726 Ga0207642_10033122
727 Ga0207680_10595933
728 Ga0207647_10137403
729 Ga0207645_10027406
730 Ga0207645_10142416
731 Ga0207645_10553196
732 Ga0207643_10040758
733 Ga0207643_10054194
734 Ga0207643_10210954
735 Ga0207654_10292197
736 Ga0207707_10001519
737 Ga0207707_10054844
738 Ga0207660_10002762
739 Ga0207660_10298777
740 Ga0207662_10000176
741 Ga0207662_10101269
742 Ga0207652_10016191
743 Ga0207652_10447626
744 Ga0207652_10789105
745 Ga0207681_10013747
746 Ga0207681_10360911
747 Ga0207687_10008984
748 Ga0207687_10462681
749 Ga0207700_10445366
750 Ga0207700_10528219
751 Ga0207664_10033998
752 Ga0207686_10000627
753 Ga0207709_10000549
754 Ga0207670_10001899
755 Ga0207670_10234929
756 Ga0207669_10010567
757 Ga0207704_10000329
758 Ga0207704_10004972
759 Ga0207665_10097065
760 Ga0207689_10001276
761 Ga0207689_10035397
762 Ga0207661_10050220
763 Ga0207661_10803801
764 Ga0207679_10687114
765 Ga0207651_10142136
766 Ga0207651_10404445
767 Ga0207712_10046117
768 Ga0207640_10008328
769 Ga0207677_10000669
770 Ga0207703_10008924
771 Ga0207703_10151359
772 Ga0207708_10000275
773 Ga0207708_10003113
774 Ga0207708_10121355
775 Ga0207708_10230072
776 Ga0207702_10098758
777 Ga0207702_10310113
778 Ga0207641_10242508
779 Ga0207648_10000185
780 Ga0207648_10001654
781 Ga0207648_10526552
782 Ga0207648_11152421
783 Ga0207676_10258412
784 Ga0207674_10418050
785 Ga0207675_100000150
786 Ga0207675_100014097
787 Ga0207683_10049728
788 Ga0207698_10767925
789 Ga0209969_1026327
790 Ga0209967_1000418
791 Ga0209981_1001186
792 Ga0210000_1003291
793 Ga0210000_1006055
794 Ga0209995_1001807
795 Ga0209995_1003041
796 Ga0209968_1009343
797 Ga0209999_1001013
798 Ga0209970_1002554
799 Ga0209588_1006635
800 Ga0209588_1038786
801 Ga0209971_1006736
802 Ga0209971_1071108
803 Ga0209966_1002160
804 Ga0207428_10000290
805 Ga0207428_10054350
806 Ga0207428_10071057
807 Ga0207428_10099810
808 Ga0268265_10001010
809 Ga0268265_10023096
810 Ga0268265_10117637
811 Ga0268265_10139708
812 Ga0268264_10000903
813 Ga0268264_10399261
814 Ga0307408_100684312
815 Ga0307405_10179449
816 Ga0307405_10198763
817 Ga0307413_10499605
818 Ga0307410_10186426
819 Ga0307412_10272401
820 Ga0307412_10611348
821 Ga0307412_10750308
822 Ga0307416_100191972
823 Ga0307416_100231181
824 Ga0307416_100299170
825 Ga0307416_100980081
826 Ga0307416_101545141
827 Ga0307411_10051530
828 Ga0307411_10308453
829 Ga0373930_0004227
830 Ga0373930_0047257
831 Ga0373958_0001356
832 Ga0373959_0005408
833 Ga0373926_0007023
834 Ga0373929_0019459
835 Ga0373940_0006840
836 Ga0373944_0000377
837 Ga0373951_0073966
838 Ga0373952_0003000
839 Ga0373932_0006230
840 Ga0373939_0013732
841 Ga0373939_0056186
842 Ga0373939_0064807
843 Ga0373941_0008437
844 Ga0373941_0024888
845 Ga0373941_0207978
846 Ga0373945_0008166
847 Ga0373954_0000088
848 Ga0373960_0011786
849 Ga0373943_0021022
850 Ga0373946_0009285
851 Ga0373955_0433053
852 Ga0373942_0004635
853 Ga0373942_0010115
854 Ga0373942_0035098
855 Ga0373961_0005986
856 Ga0373961_0021682
857 Ga0373962_0004873
858 Ga0373924_0026154
859 Ga0373931_0000163
860 Ga0373931_0019730
861 Ga0373931_0183479
862 Ga0373931_0212383
863 Ga0373935_0087492
864 Ga0373935_0414565
865 Ga0373927_0030265
866 Ga0373933_0002313
867 Ga0373947_0036831
868 Ga0373937_0001313
869 Ga0373937_0037568
870 Ga0373937_0186141
871 Ga0373925_0017906
872 Ga0373925_0260589
873 Ga0436360_0824509
874 Ga0451807_0812912
875 Ga0439441_000242
876 Ga0439441_001953
877 Ga0439443_000355
878 Ga0439443_004196
879 Ga0439456_055796
880 Ga0439446_0007516
881 Ga0439434_0029745
882 Ga0439435_0000145
883 Ga0439435_0002434
884 Ga0439444_0000161
885 Ga0439444_0000539
886 Ga0439459_0104253
887 Ga0439460_0000684
888 Ga0466964_0068278
889 Ga0453684_0235879
890 Ga0466968_0303071
891 Ga0451576_0001107
892 Ga0451576_0027642
893 Ga0451576_0028514
894 Ga0451576_0394923
895 Ga0466967_0039326
896 Ga0495592_0014717
897 Ga0495603_0004691
898 Ga0495603_0185576
899 Ga0495580_0012751
900 Ga0495582_0057631
901 Ga0495582_0245379
902 Ga0495639_0010490
903 Ga0495584_0093331
904 Ga0495594_0164291
905 Ga0495608_0043296
906 Ga0495608_0199040
907 Ga0495628_0128539
908 Ga0495630_0027336
909 Ga0495630_0068495
910 Ga0495663_0095918
911 Ga0495666_0090799
912 Ga0495642_0130894
913 Ga0495652_0143390
914 Ga0495665_0074454
915 Ga0495640_0101863
916 Ga0495586_0000624
917 Ga0495586_0036718
918 Ga0495587_0234631
919 Ga0495645_0078037
920 Ga0495667_0048177
921 Ga0495667_0298669
922 Ga0495634_0037880
923 Ga0495635_0192491
924 Ga0495588_0047457
925 Ga0495599_0057923
926 Ga0495647_0000252
927 Ga0495658_0008852
928 Ga0495658_0011299
929 Ga0495669_0003951
930 Ga0495669_0070162
931 Ga0495613_0112722
932 Ga0495624_0082248
933 Ga0495624_0154204
934 Ga0495600_0094704
935 Ga0495581_0093417
936 Ga0495604_0003259
937 Ga0495636_0002413
938 Ga0495674_0232216
939 Ga0495684_0324020
940 Ga0501291_015091
941 Ga0501291_016280
942 Ga0501295_045493
943 Ga0501296_002437
944 Ga0501298_006593
945 Ga0501303_004559
946 Ga0501031_0044304
947 Ga0501032_0041811
948 Ga0501033_0023943
949 Ga0501033_0263627
950 Ga0501036_0015965
951 Ga0501036_0080707
952 Ga0501036_0219826
953 Ga0501036_0557911
954 Ga0501037_0030483
955 Ga0501038_0028048
956 Ga0501039_0004420
957 Ga0501039_0034036
958 Ga0501039_0052153
959 Ga0501040_0002776
960 Ga0501040_0003267
961 Ga0501041_0001563
962 Ga0501041_0007863
963 Ga0501041_0036246
964 Ga0501041_0091972
965 Ga0501041_0237918
966 Ga0501042_0002917
967 Ga0501042_0023283
968 Ga0501042_0036319
969 Ga0501043_0010882
970 Ga0501043_0107882
971 Ga0501046_0002700
972 Ga0501046_0122985
973 Ga0501046_0382408
974 Ga0501047_0081114
975 Ga0501048_0010701
976 Ga0501048_0031156
977 Ga0501048_0086860
978 Ga0501048_0169574
979 Ga0501067_0016461
980 Ga0501068_0014725
981 Ga0501070_0058141
982 Ga0501071_0004683
983 Ga0501071_0096289
984 Ga0501072_0006099
985 Ga0501072_0008315
986 Ga0501072_0068750
987 Ga0501072_0120635
988 Ga0501072_0223187
989 Ga0501073_0053777
990 Ga0501074_0019204
991 Ga0501075_0002198
992 Ga0501075_0023103
993 Ga0501076_0001244
994 Ga0501076_0005555
995 Ga0501077_0003540
996 Ga0501077_0015891
997 Ga0501077_0058450
998 Ga0501247_039750
999 Ga0501221_131522
1000 Ga0501079_0002346
1001 Ga0501079_0004200
1002 Ga0501079_0169920
1003 Ga0501079_0551245
1004 Ga0501080_0027376
1005 Ga0501081_0007514
1006 Ga0501081_0025233
1007 Ga0501081_0827162
1008 Ga0501035_0180643
1009 Ga0501044_0195480
1010 Ga0501045_0002510
1011 Ga0501045_0003944
1012 Ga0501045_0117042
1013 nmdc:mga05p37_133157_c1
1014 nmdc:mga05p37_147368_c1
1015 nmdc:mga05p37_224091_c1
1016 nmdc:mga05p37_389_c1
1017 nmdc:mga05p37_682197_c1
1018 nmdc:mga09592_166_c1
1019 nmdc:mga09592_79496_c1
1020 nmdc:mga09592_87228_c1
1021 nmdc:mga0qj67_220611_c1
1022 nmdc:mga0qj67_22344_c1
1023 nmdc:mga0qj67_504331_c1
1024 nmdc:mga06r32_142601_c1
1025 nmdc:mga06r32_225304_c1
1026 nmdc:mga06r32_48940_c1
1027 nmdc:mga08y16_12735_c1
1028 nmdc:mga08y16_158371_c1
1029 nmdc:mga08y16_2159_c1
1030 nmdc:mga08y16_41967_c1
1031 nmdc:mga08y16_48378_c1
1032 nmdc:mga08y16_86915_c1
1033 nmdc:mga0n895_1063477_c1
1034 nmdc:mga0n895_110524_c1
1035 nmdc:mga0n895_163300_c1
1036 nmdc:mga0n895_196_c1
1037 nmdc:mga0rr50_1196_c1
1038 nmdc:mga0rr50_1513_c1
1039 nmdc:mga0rr50_24827_c1
1040 nmdc:mga0rr50_346571_c1
1041 nmdc:mga08x19_247529_c1
1042 nmdc:mga08x19_258_c1
1043 nmdc:mga08x19_46509_c1
1044 nmdc:mga08x19_48888_c1
1045 nmdc:mga08x19_516875_c1
1046 nmdc:mga08x19_759_c1
1047 nmdc:mga08x19_87800_c1
1048 nmdc:mga0a205_125936_c1
1049 nmdc:mga0a205_22262_c1
1050 nmdc:mga0a205_24715_c1
1051 nmdc:mga0a205_308701_c1
1052 nmdc:mga0a205_491860_c1
1053 nmdc:mga0a205_532414_c1
1054 Ga0495601_0077639
1055 Ga0495619_0190886
1056 Ga0500566_0237177
1057 Ga0501084_0008018
1058 Ga0501084_0114784
1059 Ga0501084_0174236
1060 Ga0501084_0338339
1061 Ga0590071_076284
1062 Ga0590077_033822
1063 Ga0501082_0002298
1064 Ga0501082_0017077
1065 Ga0530510_0000245
1066 Ga0530510_0004031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05494

MlaC

MlaC protein

49

213

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uwa-assembly2.cif.gz_B structure of e. coli phospholipid binding protein mlac 0.9043 9 178
2qgu-assembly1.cif.gz_A three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 0.8835 6 181
8dte-assembly1.cif.gz_A crystal structure of a toluene tolerance periplasmic transport protein from neisseria gonorrhoeae 0.8768 10 177
2qgu-assembly1.cif.gz_A three-dimensional structure of the phospholipid-binding protein from ralstonia solanacearum q8xv73_ralsq in complex with a phospholipid at the resolution 1.53 a. northeast structural genomics consortium target rsr89 0.8654 6 181
5uwa-assembly2.cif.gz_B structure of e. coli phospholipid binding protein mlac 0.8316 9 178
ID Description Score Start End Superfamily
af_P0ADV7_24_204_3.10.450.710 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.9068 9 178 3.10.450.710
2qguA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8542 6 147 3.10.450.50
af_P0ADV7_24_204_3.10.450.710 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Tgt2/MlaC 0.8509 9 178 3.10.450.710
2qguA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8235 6 147 3.10.450.50
af_Q3U821_383_636_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7742 94 144 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A536ZTA7-F1-model_v4 ABC transporter substrate-binding protein 0.9594 7 178
AF-A0A3L6LT02-F1-model_v4 ABC transporter substrate-binding protein 0.9539 7 181
AF-A0A1N6T3Q2-F1-model_v4 Phospholipid transport system substrate-binding protein 0.9484 7 183
AF-A0A363SNT6-F1-model_v4 Toluene tolerance protein 0.9483 7 181
AF-C7RLS0-F1-model_v4 Toluene tolerance family protein 0.9477 7 181 GO:0016020

Map