F460406

General Info

Members Datasets Scaffolds Average Seq Length
533 272 1066 206

Family's Representative Sequence

Representative Sequence 3300015265|Ga0182005_1000002|Ga0182005_1000002709
Length 239
Sequence MTTRRTSSPIPSHIPSATFSPGAASSFQAEPAKRARCPVCLRAAASCICHWIVPVAHAVEVLILQHPLEVHNAKGSARLLHLSLPNSRLLTGEQFAPDALAELLAGKHNVLLYPDTPGDRSLGIAPPPALGPAILLDPARLATQLRLVVLDATWRKSRKMLYLNPALQQLPRLPLRDTPASHYLIRKAHAPDQLSTLEATCYALTQLEQDASRFVPLITAFDGFVAQQLSYVMPHGEKA

Samples

Sample ID Description Type Environment
1 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
126 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
144 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
239 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
247 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
248 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
249 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
250 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
251 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
252 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
253 2643221638 Duganella sp. Root336D2 Isolate Unclassified
254 2643221645 Massilia sp. Root351 Isolate Unclassified
255 2643221664 Massilia sp. Root418 Isolate Unclassified
256 2721755523 Delftia sp. HK171 Isolate Unclassified
257 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
258 2738541280 Massilia sp. GV090 Isolate Unclassified
259 2738541300 Massilia sp. GV016 Isolate Unclassified
260 2738543018 Massilia sp. GV045 Isolate Unclassified
261 2738543030 Massilia sp. GV097 Isolate Unclassified
262 2818991436 Collimonas arenae 515 Isolate Unclassified
263 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
264 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
265 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
266 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
267 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
268 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
269 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
270 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
271 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
272 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.45
Nodule 1.5
Rhizoplane 1.88
Rhizosphere 68.86
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182005_1000002 3300015265 Bacteria 908499
2 JGI25155J39150_1000257 3300002704 Bacteria 20200
3 JGI25155J39150_1000947 3300002704 Bacteria 3622
4 JGI25156J39149_1000426 3300002705 Bacteria 26196
5 JGI25156J39149_1003974 3300002705 Bacteria 4666
6 JGI25162J39368_1000271 3300002737 Bacteria 49990
7 JGI25154J39366_1000473 3300002738 Bacteria 21060
8 JGI25154J39366_1000493 3300002738 Bacteria 20237
9 JGI25158J39367_1000757 3300002739 Bacteria 6196
10 JGI25157J39369_1000450 3300002741 Bacteria 26192
11 JGI25152J39213_1000176 3300002773 Bacteria 43027
12 JGI25152J39213_1028305 3300002773 Bacteria 892
13 JGI25150J39212_1000543 3300002774 Bacteria 15287
14 JGI25159J45721_1009223 3300002987 Bacteria 2623
15 JGI25165J46597_1000373 3300003214 Bacteria 49990
16 JGI25153J46596_10021834 3300003215 Bacteria 2377
17 JGI25161J50226_1001463 3300003374 Bacteria 7068
18 JGI25161J50226_1001792 3300003374 Bacteria 6050
19 Ga0055538_1000144 3300003751 Bacteria 49990
20 Ga0055539_1000195 3300003752 Bacteria 49990
21 Ga0055533_1000196 3300003756 Bacteria 49990
22 Ga0055532_1000101 3300003758 Bacteria 92881
23 Ga0055525_1000263 3300003759 Bacteria 49990
24 Ga0055535_1005964 3300003761 Bacteria 2555
25 Ga0055526_1000415 3300003771 Bacteria 34412
26 Ga0055526_1005360 3300003771 Bacteria 7401
27 Ga0055526_1032258 3300003771 Bacteria 1482
28 Ga0055537_1002229 3300003773 Bacteria 6690
29 Ga0055537_1003260 3300003773 Bacteria 5052
30 Ga0055524_1000021 3300003775 Bacteria 227578
31 Ga0055524_1000756 3300003775 Bacteria 21882
32 Ga0055524_1003341 3300003775 Bacteria 7823
33 Ga0055524_1009643 3300003775 Bacteria 3904
34 Ga0055534_1001919 3300003784 Bacteria 7667
35 Ga0055534_1010501 3300003784 Bacteria 1937
36 Ga0055528_1036685 3300003790 Bacteria 1166
37 Ga0055530_10000283 3300003791 Bacteria 46150
38 Ga0055531_10000410 3300003794 Bacteria 41297
39 Ga0055531_10058685 3300003794 Bacteria 955
40 Ga0055531_10065416 3300003794 Bacteria 864
41 Ga0055541_1000128 3300003841 Bacteria 49990
42 Ga0055543_1001424 3300004625 Bacteria 9509
43 Ga0065165_1000766 3300005262 Bacteria 43430
44 Ga0065165_1001842 3300005262 Bacteria 20684
45 Ga0065165_1083215 3300005262 Bacteria 827
46 Ga0065165_1104501 3300005262 Bacteria 704
47 Ga0065715_10124491 3300005293 Bacteria 2153
48 Ga0070658_10169938 3300005327 Bacteria 1831
49 Ga0070658_10516568 3300005327 Bacteria 1032
50 Ga0070658_10829446 3300005327 Bacteria 803
51 Ga0070670_100000010 3300005331 Bacteria 277365
52 Ga0070666_10028071 3300005335 Bacteria 3691
53 Ga0070660_100224491 3300005339 Bacteria 1527
54 Ga0070660_100528014 3300005339 Bacteria 983
55 Ga0070661_100209862 3300005344 Bacteria 1490
56 Ga0070669_100000387 3300005353 Bacteria 33852
57 Ga0070671_100000012 3300005355 Bacteria 196420
58 Ga0070659_100595715 3300005366 Bacteria 949
59 Ga0070667_100000124 3300005367 Bacteria 98412
60 Ga0068855_100098317 3300005563 Bacteria 3371
61 Ga0068855_100160670 3300005563 Bacteria 2550
62 Ga0070664_100371693 3300005564 Bacteria 1303
63 Ga0070664_100577931 3300005564 Bacteria 1041
64 Ga0068856_100024067 3300005614 Bacteria 5926
65 Ga0068856_100678925 3300005614 Bacteria 1050
66 Ga0068852_100152309 3300005616 Bacteria 2151
67 Ga0068852_100764124 3300005616 Bacteria 979
68 Ga0068864_100000018 3300005618 Bacteria 277365
69 Ga0068851_10421685 3300005834 Bacteria 788
70 Ga0068863_100029645 3300005841 Bacteria 5223
71 Ga0068858_100406514 3300005842 Unclassified 1308
72 Ga0068860_100325067 3300005843 Bacteria 1510
73 Ga0075370_10221164 3300006353 Bacteria 1119
74 Ga0079104_1000072 3300006946 Bacteria 152567
75 Ga0079104_1005199 3300006946 Bacteria 5270
76 Ga0099826_10000041 3300006948 Bacteria 96536
77 Ga0105251_10064675 3300009011 Eukaryota 1714
78 Ga0105244_10040121 3300009036 Bacteria 2433
79 Ga0105250_10000407 3300009092 Bacteria 31544
80 Ga0105240_10000569 3300009093 Bacteria 68389
81 Ga0105240_10432746 3300009093 Bacteria 1476
82 Ga0105240_10441930 3300009093 Bacteria 1457
83 Ga0105245_10149078 3300009098 Bacteria 2210
84 Ga0105247_10210092 3300009101 Unclassified 1312
85 Ga0105243_10905851 3300009148 Bacteria 877
86 Ga0105243_11043305 3300009148 Bacteria 823
87 Ga0105242_11013301 3300009176 Bacteria 839
88 Ga0105237_10153552 3300009545 Bacteria 2299
89 Ga0105237_10611729 3300009545 Bacteria 1096
90 Ga0105238_10063491 3300009551 Bacteria 3693
91 Ga0105238_10203612 3300009551 Bacteria 1955
92 Ga0105249_10019065 3300009553 Bacteria 6119
93 Ga0105239_10154171 3300010375 Bacteria 2565
94 Ga0157326_1014352 3300012513 Bacteria 921
95 Ga0157372_11371613 3300013307 Bacteria 815
96 Ga0163163_10000069 3300014325 Bacteria 114043
97 Ga0182008_10000796 3300014497 Bacteria 22066
98 Ga0182008_10027858 3300014497 Bacteria 2859
99 Ga0182008_10058168 3300014497 Bacteria 1909
100 Ga0182006_1000002 3300015261 Bacteria 887990
101 Ga0182007_10000124 3300015262 Bacteria 53804
102 Ga0182007_10015023 3300015262 Bacteria 2902
103 Ga0163161_10101310 3300017792 Bacteria 2144
104 Ga0209435_100016 3300025206 Bacteria 305566
105 Ga0209435_100038 3300025206 Bacteria 120273
106 Ga0209435_100322 3300025206 Bacteria 11517
107 Ga0209436_100243 3300025208 Bacteria 25107
108 Ga0209436_106693 3300025208 Bacteria 2495
109 Ga0209436_108927 3300025208 Bacteria 1948
110 Ga0209784_100010 3300025224 Bacteria 683664
111 Ga0209566_100008 3300025225 Bacteria 683664
112 Ga0209674_100019 3300025226 Bacteria 683664
113 Ga0209672_104007 3300025228 Bacteria 2850
114 Ga0209147_100023 3300025229 Bacteria 437803
115 Ga0209563_100021 3300025230 Bacteria 683764
116 Ga0207427_102510 3300025231 Bacteria 4865
117 Ga0209437_100019 3300025233 Bacteria 683764
118 Ga0209437_100166 3300025233 Bacteria 144787
119 Ga0209258_100345 3300025242 Bacteria 67870
120 Ga0207425_1000001 3300025245 Bacteria 2525432
121 Ga0207425_1000089 3300025245 Bacteria 91267
122 Ga0209646_1000033 3300025246 Bacteria 369507
123 Ga0209646_1000093 3300025246 Bacteria 183840
124 Ga0209026_1000031 3300025250 Bacteria 325747
125 Ga0209026_1002287 3300025250 Bacteria 7316
126 Ga0209677_100011 3300025253 Bacteria 683664
127 Ga0209148_1000575 3300025254 Bacteria 34103
128 Ga0209759_1000045 3300025256 Bacteria 235654
129 Ga0209759_1000565 3300025256 Bacteria 37312
130 Ga0209129_1000001 3300025258 Bacteria 1452436
131 Ga0209129_1002496 3300025258 Bacteria 8971
132 Ga0209233_1000025 3300025261 Bacteria 683764
133 Ga0209565_1006140 3300025263 Bacteria 3408
134 Ga0209565_1008388 3300025263 Bacteria 2705
135 Ga0209565_1030762 3300025263 Bacteria 1047
136 Ga0209673_1027318 3300025273 Bacteria 1858
137 Ga0209130_1000407 3300025284 Bacteria 47012
138 Ga0209130_1006880 3300025284 Bacteria 3612
139 Ga0209675_1001579 3300025291 Bacteria 12900
140 Ga0209675_1012485 3300025291 Bacteria 2732
141 Ga0209675_1047260 3300025291 Bacteria 906
142 Ga0209564_1000178 3300025295 Bacteria 151982
143 Ga0209564_1000443 3300025295 Bacteria 71364
144 Ga0209564_1004540 3300025295 Bacteria 8429
145 Ga0209564_1006177 3300025295 Bacteria 6562
146 Ga0209758_1000116 3300025297 Bacteria 198356
147 Ga0209050_1000271 3300025298 Bacteria 110802
148 Ga0209050_1000480 3300025298 Bacteria 70176
149 Ga0209050_1000844 3300025298 Bacteria 41993
150 Ga0209050_1004805 3300025298 Bacteria 8890
151 Ga0209050_1009486 3300025298 Bacteria 4972
152 Ga0209256_1000044 3300025299 Bacteria 337264
153 Ga0209256_1000297 3300025299 Bacteria 86973
154 Ga0209256_1000515 3300025299 Bacteria 56806
155 Ga0209256_1000635 3300025299 Bacteria 47967
156 Ga0207426_1001973 3300025302 Bacteria 14566
157 Ga0209051_1030807 3300025303 Bacteria 2076
158 Ga0209257_1000293 3300025304 Bacteria 110422
159 Ga0209257_1010322 3300025304 Bacteria 4752
160 Ga0207713_1071627 3300025735 Eukaryota 1278
161 Ga0207680_10012563 3300025903 Bacteria 4318
162 Ga0207705_10001883 3300025909 Bacteria 16463
163 Ga0207705_10173529 3300025909 Bacteria 1624
164 Ga0207705_10484436 3300025909 Bacteria 960
165 Ga0207654_10108150 3300025911 Bacteria 1725
166 Ga0207695_10002789 3300025913 Bacteria 25429
167 Ga0207657_10463832 3300025919 Bacteria 994
168 Ga0207657_10502172 3300025919 Bacteria 950
169 Ga0207649_10047166 3300025920 Bacteria 2650
170 Ga0207649_10589720 3300025920 Bacteria 854
171 Ga0207681_10001220 3300025923 Bacteria 16562
172 Ga0207694_10083573 3300025924 Bacteria 2511
173 Ga0207650_10000003 3300025925 Bacteria 1123235
174 Ga0207687_10082934 3300025927 Bacteria 2320
175 Ga0207644_10000036 3300025931 Bacteria 128383
176 Ga0207690_10413960 3300025932 Bacteria 1077
177 Ga0207706_10755758 3300025933 Bacteria 828
178 Ga0207709_10000104 3300025935 Bacteria 130964
179 Ga0207679_10679309 3300025945 Bacteria 933
180 Ga0207667_10010303 3300025949 Bacteria 10936
181 Ga0207667_10036930 3300025949 Bacteria 5229
182 Ga0207667_10690259 3300025949 Bacteria 1024
183 Ga0207712_10009809 3300025961 Bacteria 6068
184 Ga0207658_10000007 3300025986 Bacteria 329651
185 Ga0207703_10303114 3300026035 Unclassified 1458
186 Ga0207702_10027822 3300026078 Bacteria 4697
187 Ga0207641_10005798 3300026088 Bacteria 10482
188 Ga0207641_10714397 3300026088 Unclassified 987
189 Ga0207676_10000003 3300026095 Bacteria 1123235
190 Ga0207698_10563603 3300026142 Bacteria 1118
191 Ga0209281_1000002 3300027111 Bacteria 1924012
192 Ga0209281_1029355 3300027111 Bacteria 993
193 Ga0209282_1000001 3300027666 Bacteria 2450367
194 Ga0265337_1110318 3300028556 Unclassified 747
195 Ga0265332_10000015 3300031238 Bacteria 243944
196 Ga0265331_10014963 3300031250 Bacteria 4114
197 Ga0265327_10001967 3300031251 Bacteria 23494
198 Ga0307408_100000098 3300031548 Bacteria 95689
199 Ga0307408_100000526 3300031548 Bacteria 33024
200 Ga0307408_100000767 3300031548 Bacteria 25788
201 Ga0307408_100000792 3300031548 Bacteria 25286
202 Ga0307408_100000870 3300031548 Bacteria 23712
203 Ga0307408_100040915 3300031548 Bacteria 3284
204 Ga0307408_100573230 3300031548 Bacteria 999
205 Ga0307406_10003341 3300031901 Bacteria 8742
206 Ga0395899_0000028 3300037312 Bacteria 334378
207 Ga0395899_0005629 3300037312 Bacteria 9723
208 Ga0395899_0009053 3300037312 Bacteria 7651
209 Ga0395900_0121094 3300037418 Bacteria 2684
210 Ga0395900_0139355 3300037418 Bacteria 2484
211 Ga0395900_0150603 3300037418 Bacteria 2376
212 Ga0395900_0321618 3300037418 Bacteria 1527
213 Ga0395900_0656114 3300037418 Bacteria 985
214 Ga0395898_0062725 3300037466 Bacteria 3609
215 Ga0395898_0363701 3300037466 Bacteria 1379
216 Ga0395898_0458667 3300037466 Bacteria 1213
217 Ga0395898_1061194 3300037466 Bacteria 744
218 Ga0395905_0774001 3300037471 Bacteria 862
219 Ga0395901_0269699 3300038443 Bacteria 1770
220 Ga0395901_0316192 3300038443 Bacteria 1616
221 Ga0436361_1000267 3300039447 Bacteria 3274
222 Ga0451800_0905081 3300041459 Bacteria 738
223 Ga0439448_0098524 3300042005 Bacteria 992
224 Ga0439450_007782 3300042008 Bacteria 1976
225 Ga0439455_0005105 3300042012 Bacteria 2647
226 Ga0450891_000369 3300042129 Bacteria 4713
227 Ga0450893_0007413 3300042532 Bacteria 1783
228 Ga0451577_0162651 3300042876 Bacteria 2010
229 Ga0466972_0000088 3300044658 Bacteria 84167
230 Ga0453683_0004388 3300044673 Bacteria 10027
231 Ga0466965_0139818 3300044683 Bacteria 1260
232 Ga0466965_0285404 3300044683 Bacteria 892
233 Ga0466964_0000385 3300044706 Bacteria 13369
234 Ga0453684_0288650 3300044712 Bacteria 1868
235 Ga0453684_0623094 3300044712 Bacteria 1180
236 Ga0453684_1674768 3300044712 Bacteria 650
237 Ga0466970_0060096 3300044765 Bacteria 2035
238 Ga0466957_0347860 3300044842 Bacteria 1005
239 Ga0451576_0003846 3300045051 Bacteria 20162
240 Ga0466958_0014209 3300045836 Bacteria 4545
241 Ga0466958_0081857 3300045836 Bacteria 1987
242 Ga0466967_0043572 3300045976 Bacteria 3886
243 Ga0466967_0120667 3300045976 Bacteria 2421
244 Ga0466967_0530302 3300045976 Bacteria 1158
245 Ga0495617_000632 3300046452 Bacteria 17654
246 Ga0495617_008094 3300046452 Bacteria 3632
247 Ga0495617_008275 3300046452 Bacteria 3588
248 Ga0495617_015404 3300046452 Bacteria 2591
249 Ga0495617_103789 3300046452 Bacteria 922
250 Ga0495617_120415 3300046452 Bacteria 845
251 Ga0495592_0160716 3300046454 Bacteria 1546
252 Ga0495603_0004623 3300046455 Bacteria 8219
253 Ga0495603_0030825 3300046455 Bacteria 3230
254 Ga0495629_0010794 3300046459 Bacteria 6644
255 Ga0495638_0002326 3300046460 Bacteria 15651
256 Ga0495638_0052370 3300046460 Bacteria 2542
257 Ga0495651_0012702 3300046462 Bacteria 6500
258 Ga0495651_0082827 3300046462 Bacteria 2420
259 Ga0495653_0045323 3300046463 Bacteria 3409
260 Ga0495653_0172272 3300046463 Bacteria 1493
261 Ga0495650_0000048 3300046471 Bacteria 334427
262 Ga0495650_0003786 3300046471 Bacteria 10777
263 Ga0495650_0071794 3300046471 Bacteria 1356
264 Ga0495584_0000059 3300046491 Bacteria 79769
265 Ga0495584_0000082 3300046491 Bacteria 67262
266 Ga0495584_0000479 3300046491 Bacteria 27467
267 Ga0495584_0004260 3300046491 Bacteria 7712
268 Ga0495584_0008513 3300046491 Bacteria 5311
269 Ga0495584_0010316 3300046491 Bacteria 4801
270 Ga0495584_0044297 3300046491 Bacteria 2246
271 Ga0495584_0086890 3300046491 Bacteria 1576
272 Ga0495584_0153440 3300046491 Bacteria 1170
273 Ga0495584_0286058 3300046491 Bacteria 837
274 Ga0495584_0307711 3300046491 Bacteria 805
275 Ga0495585_0000084 3300046492 Bacteria 98839
276 Ga0495585_0000522 3300046492 Bacteria 36273
277 Ga0495585_0012225 3300046492 Bacteria 5058
278 Ga0495585_0018079 3300046492 Bacteria 4067
279 Ga0495585_0032311 3300046492 Bacteria 2965
280 Ga0495585_0033317 3300046492 Bacteria 2917
281 Ga0495585_0040681 3300046492 Bacteria 2609
282 Ga0495585_0089671 3300046492 Bacteria 1657
283 Ga0495585_0147645 3300046492 Bacteria 1228
284 Ga0495585_0157047 3300046492 Bacteria 1182
285 Ga0495585_0266041 3300046492 Bacteria 851
286 Ga0495596_0000100 3300046500 Bacteria 60871
287 Ga0495596_0021053 3300046500 Bacteria 2664
288 Ga0495596_0129271 3300046500 Bacteria 980
289 Ga0495596_0146084 3300046500 Bacteria 918
290 Ga0495607_0004990 3300046501 Bacteria 9626
291 Ga0495607_0006726 3300046501 Bacteria 8043
292 Ga0495607_0007342 3300046501 Bacteria 7635
293 Ga0495607_0035365 3300046501 Bacteria 3022
294 Ga0495607_0054496 3300046501 Bacteria 2304
295 Ga0495583_0000295 3300046506 Bacteria 79005
296 Ga0495583_0000492 3300046506 Bacteria 57414
297 Ga0495583_0027011 3300046506 Bacteria 2837
298 Ga0495583_0032089 3300046506 Bacteria 2538
299 Ga0495583_0075667 3300046506 Bacteria 1472
300 Ga0495606_0004777 3300046507 Bacteria 13321
301 Ga0495606_0005115 3300046507 Bacteria 12736
302 Ga0495606_0014387 3300046507 Bacteria 6181
303 Ga0495606_0019794 3300046507 Bacteria 4987
304 Ga0495606_0046470 3300046507 Bacteria 2869
305 Ga0495608_0028589 3300046511 Bacteria 3788
306 Ga0495616_0001679 3300046513 Bacteria 15102
307 Ga0495616_0008907 3300046513 Bacteria 5897
308 Ga0495616_0029146 3300046513 Bacteria 2916
309 Ga0495616_0054308 3300046513 Bacteria 1987
310 Ga0495616_0108982 3300046513 Bacteria 1288
311 Ga0495628_0000580 3300046516 Bacteria 33596
312 Ga0495628_0151617 3300046516 Bacteria 1765
313 Ga0495631_0058374 3300046518 Bacteria 1678
314 Ga0495632_0042208 3300046519 Bacteria 2287
315 Ga0495643_0084635 3300046522 Bacteria 1645
316 Ga0495644_0000120 3300046523 Bacteria 37418
317 Ga0495644_0000716 3300046523 Bacteria 13744
318 Ga0495644_0017708 3300046523 Bacteria 2722
319 Ga0495648_0000118 3300046524 Bacteria 95878
320 Ga0495648_0000674 3300046524 Bacteria 36462
321 Ga0495663_0001754 3300046525 Bacteria 6727
322 Ga0495642_0005080 3300046528 Bacteria 5069
323 Ga0495642_0023047 3300046528 Bacteria 2456
324 Ga0495642_0035763 3300046528 Bacteria 2005
325 Ga0495642_0044221 3300046528 Bacteria 1817
326 Ga0495642_0078290 3300046528 Bacteria 1389
327 Ga0495642_0117596 3300046528 Bacteria 1139
328 Ga0495652_0006010 3300046529 Bacteria 11356
329 Ga0495652_0028657 3300046529 Bacteria 4897
330 Ga0495652_0126712 3300046529 Bacteria 2027
331 Ga0495652_0323350 3300046529 Bacteria 1113
332 Ga0495654_0013967 3300046530 Bacteria 4284
333 Ga0495654_0030214 3300046530 Bacteria 2758
334 Ga0495654_0098652 3300046530 Bacteria 1347
335 Ga0495609_0000140 3300046538 Bacteria 76163
336 Ga0495609_0002519 3300046538 Bacteria 11243
337 Ga0495609_0009035 3300046538 Bacteria 4845
338 Ga0495609_0016063 3300046538 Bacteria 3493
339 Ga0495609_0024706 3300046538 Bacteria 2755
340 Ga0495597_0005712 3300046542 Bacteria 6540
341 Ga0495597_0006221 3300046542 Bacteria 6191
342 Ga0495597_0009378 3300046542 Bacteria 4841
343 Ga0495597_0020246 3300046542 Bacteria 3101
344 Ga0495597_0047325 3300046542 Bacteria 1904
345 Ga0495597_0107428 3300046542 Bacteria 1172
346 Ga0495597_0123003 3300046542 Bacteria 1080
347 Ga0495645_0053834 3300046543 Bacteria 2924
348 Ga0495645_0490461 3300046543 Bacteria 769
349 Ga0495633_0001076 3300046558 Bacteria 22086
350 Ga0495633_0001601 3300046558 Bacteria 17159
351 Ga0495633_0002254 3300046558 Bacteria 13809
352 Ga0495633_0002663 3300046558 Bacteria 12431
353 Ga0495633_0017259 3300046558 Bacteria 3696
354 Ga0495633_0030668 3300046558 Bacteria 2610
355 Ga0495656_0000887 3300046615 Bacteria 9672
356 Ga0495656_0066731 3300046615 Bacteria 1586
357 Ga0495656_0073663 3300046615 Bacteria 1523
358 Ga0495656_0086249 3300046615 Bacteria 1428
359 Ga0495656_0438399 3300046615 Bacteria 687
360 Ga0495668_0002654 3300046616 Bacteria 14375
361 Ga0495668_0010062 3300046616 Bacteria 5754
362 Ga0495668_0131528 3300046616 Bacteria 1369
363 Ga0495668_0372850 3300046616 Bacteria 784
364 Ga0495668_0377451 3300046616 Bacteria 778
365 Ga0495634_0141238 3300046642 Bacteria 1529
366 Ga0495611_0000751 3300046648 Bacteria 18295
367 Ga0495611_0000954 3300046648 Bacteria 15457
368 Ga0495611_0006033 3300046648 Bacteria 5168
369 Ga0495611_0009763 3300046648 Bacteria 4057
370 Ga0495625_0001407 3300046660 Bacteria 29458
371 Ga0495625_0007167 3300046660 Bacteria 9783
372 Ga0495625_0011692 3300046660 Bacteria 7139
373 Ga0495625_0023982 3300046660 Bacteria 4652
374 Ga0495625_0044096 3300046660 Bacteria 3230
375 Ga0495625_0190604 3300046660 Bacteria 1358
376 Ga0495625_0415789 3300046660 Bacteria 837
377 Ga0495659_0000014 3300046664 Bacteria 78730
378 Ga0495659_0000246 3300046664 Bacteria 22349
379 Ga0495659_0001927 3300046664 Bacteria 6838
380 Ga0495659_0005366 3300046664 Bacteria 4032
381 Ga0495661_0008728 3300046665 Bacteria 6994
382 Ga0495661_0039934 3300046665 Bacteria 2913
383 Ga0495661_0041631 3300046665 Bacteria 2840
384 Ga0495661_0057758 3300046665 Bacteria 2315
385 Ga0495661_0096556 3300046665 Bacteria 1671
386 Ga0495661_0118899 3300046665 Bacteria 1462
387 Ga0495661_0176705 3300046665 Bacteria 1134
388 Ga0495588_0000137 3300046674 Bacteria 114279
389 Ga0495588_0021620 3300046674 Bacteria 3172
390 Ga0495588_0028231 3300046674 Bacteria 2807
391 Ga0495588_0154525 3300046674 Bacteria 1213
392 Ga0495588_0213571 3300046674 Bacteria 1018
393 Ga0495588_0258593 3300046674 Bacteria 917
394 Ga0495657_0147283 3300046675 Bacteria 1464
395 Ga0495599_0032549 3300046678 Bacteria 3272
396 Ga0495623_0021633 3300046679 Bacteria 4153
397 Ga0495623_0086351 3300046679 Bacteria 1934
398 Ga0495623_0277407 3300046679 Bacteria 934
399 Ga0495646_0005852 3300046680 Bacteria 7797
400 Ga0495646_0062478 3300046680 Bacteria 2214
401 Ga0495669_0003209 3300046684 Bacteria 6733
402 Ga0495669_0013200 3300046684 Bacteria 3518
403 Ga0495669_0237578 3300046684 Bacteria 874
404 Ga0495624_0022391 3300046690 Bacteria 4177
405 Ga0495624_0023854 3300046690 Bacteria 4030
406 Ga0495670_0002149 3300046691 Bacteria 9744
407 Ga0495670_0007840 3300046691 Bacteria 5252
408 Ga0495670_0063955 3300046691 Bacteria 1853
409 Ga0495670_0460584 3300046691 Bacteria 689
410 Ga0495671_0000451 3300046692 Bacteria 32465
411 Ga0495671_0024969 3300046692 Bacteria 3109
412 Ga0495671_0027563 3300046692 Bacteria 2933
413 Ga0495671_0226274 3300046692 Bacteria 905
414 Ga0495649_0021472 3300046694 Bacteria 3616
415 Ga0495649_0165857 3300046694 Bacteria 1157
416 Ga0495589_0099366 3300046794 Bacteria 1409
417 Ga0495600_0008875 3300046809 Bacteria 6194
418 Ga0495600_0236273 3300046809 Bacteria 1165
419 Ga0495660_0000485 3300046810 Bacteria 33135
420 Ga0495581_0124878 3300047315 Bacteria 1498
421 Ga0495636_0001089 3300047318 Bacteria 10201
422 Ga0495636_0082712 3300047318 Bacteria 1384
423 Ga0495672_0000123 3300047320 Bacteria 120875
424 Ga0495672_0003754 3300047320 Bacteria 12791
425 Ga0495672_0009012 3300047320 Bacteria 7278
426 Ga0495676_0008573 3300047321 Bacteria 9366
427 Ga0495680_0521693 3300047322 Bacteria 804
428 Ga0495683_0000079 3300047323 Bacteria 96333
429 Ga0495683_0001601 3300047323 Bacteria 14569
430 Ga0495683_0002752 3300047323 Bacteria 10469
431 Ga0495683_0138101 3300047323 Bacteria 1144
432 Ga0495687_000263 3300047443 Bacteria 70773
433 Ga0495687_003066 3300047443 Bacteria 12529
434 Ga0495687_027659 3300047443 Bacteria 2650
435 Ga0495687_108411 3300047443 Bacteria 1026
436 Ga0495675_0036926 3300047444 Bacteria 3114
437 Ga0495677_0001202 3300047445 Bacteria 10368
438 Ga0495677_0002921 3300047445 Bacteria 6655
439 Ga0495677_0007082 3300047445 Bacteria 4197
440 Ga0495677_0022580 3300047445 Bacteria 2282
441 Ga0495677_0081450 3300047445 Bacteria 1213
442 Ga0495685_000015 3300047447 Bacteria 76348
443 Ga0495685_018708 3300047447 Bacteria 2378
444 Ga0495685_061792 3300047447 Bacteria 1261
445 Ga0495673_0008334 3300047469 Bacteria 5841
446 Ga0495681_0002629 3300047470 Bacteria 12765
447 Ga0495681_0008838 3300047470 Bacteria 6264
448 Ga0495681_0040730 3300047470 Bacteria 2260
449 Ga0495686_0001015 3300047472 Bacteria 33984
450 Ga0495602_0007374 3300048088 Bacteria 11514
451 Ga0495602_0083226 3300048088 Bacteria 2682
452 Ga0495602_0297775 3300048088 Bacteria 1181
453 Ga0495626_0000085 3300048091 Bacteria 125255
454 Ga0495626_0001715 3300048091 Bacteria 16788
455 Ga0495626_0006718 3300048091 Bacteria 6514
456 Ga0495626_0007503 3300048091 Bacteria 6064
457 Ga0495626_0017611 3300048091 Bacteria 3604
458 Ga0495626_0024687 3300048091 Bacteria 2945
459 Ga0495626_0058152 3300048091 Bacteria 1767
460 Ga0496100_0140225 3300048903 Bacteria 1713
461 Ga0496100_0191567 3300048903 Bacteria 1485
462 Ga0496101_0969346 3300048904 Bacteria 669
463 Ga0496104_0452013 3300048907 Bacteria 1196
464 Ga0496111_0005607 3300048914 Bacteria 8072
465 Ga0496111_0430744 3300048914 Bacteria 974
466 Ga0496113_0816559 3300048916 Bacteria 740
467 Ga0496114_0052667 3300048917 Bacteria 3391
468 Ga0496116_0010559 3300048919 Bacteria 7723
469 Ga0496116_0114651 3300048919 Bacteria 1574
470 Ga0496117_0000001 3300048920 Bacteria 2526244
471 Ga0496117_0038747 3300048920 Bacteria 3528
472 Ga0496117_0220538 3300048920 Bacteria 1056
473 Ga0496118_0000002 3300048921 Bacteria 1690764
474 Ga0496118_0159064 3300048921 Bacteria 1400
475 Ga0496121_0005713 3300048924 Bacteria 15799
476 Ga0496121_0009584 3300048924 Bacteria 11093
477 Ga0496121_0017840 3300048924 Bacteria 7208
478 Ga0496121_0023093 3300048924 Bacteria 6005
479 Ga0496122_0000457 3300048925 Bacteria 84895
480 Ga0496122_0002075 3300048925 Bacteria 29698
481 Ga0496122_0097403 3300048925 Bacteria 1980
482 Ga0496123_0000321 3300048926 Bacteria 91682
483 Ga0496123_0153355 3300048926 Bacteria 1239
484 Ga0496124_0101924 3300048927 Bacteria 2325
485 Ga0496125_0006830 3300048928 Bacteria 12243
486 Ga0496125_0012265 3300048928 Bacteria 8522
487 Ga0496125_0045347 3300048928 Bacteria 3701
488 Ga0496125_0084383 3300048928 Bacteria 2412
489 Ga0496125_0112950 3300048928 Bacteria 1961
490 Ga0496125_0382302 3300048928 Bacteria 829
491 Ga0495678_015340 3300049459 Bacteria 3529
492 Ga0495682_0000274 3300049460 Bacteria 40490
493 Ga0495682_0002560 3300049460 Bacteria 8545
494 Ga0495682_0035067 3300049460 Bacteria 1848
495 Ga0495682_0060901 3300049460 Bacteria 1363
496 Ga0501034_0278025 3300049571 Bacteria 1614
497 Ga0501238_002895 3300049671 Bacteria 2085
498 Ga0501282_021651 3300049778 Bacteria 708
499 Ga0501035_0651053 3300049822 Unclassified 854
500 Ga0501044_0216174 3300049823 Bacteria 1869
501 Ga0501226_014295 3300049853 Unclassified 876
502 Ga0501226_019563 3300049853 Bacteria 748
503 Ga0500651_0013323 3300053093 Bacteria 5009
504 Ga0500593_006078 3300053117 Bacteria 4809
505 Ga0500595_001521 3300053119 Bacteria 12313
506 Ga0500595_004649 3300053119 Bacteria 6111
507 Ga0500628_013864 3300053129 Bacteria 1512
508 Ga0500604_0059047 3300053151 Bacteria 1201
509 Ga0500645_097030 3300053730 Bacteria 833
510 2511251121 2511231003 Bacteria 5606035
511 2550696287 2548876994 Bacteria 4904866
512 2601667468 2600255292 Bacteria 6300551
513 2643787258 2643221554 Bacteria 6603920
514 2644215668 2643221638 Bacteria 6579467
515 2644252286 2643221645 Bacteria 7207331
516 2644360931 2643221664 Bacteria 7272945
517 2722885430 2721755523 Bacteria 6430384
518 2738715111 2738541276 Bacteria 4690596
519 2738742311 2738541280 Bacteria 6630198
520 2738843700 2738541300 Bacteria 6675882
521 2739275226 2738543018 Bacteria 6718814
522 2739344270 2738543030 Bacteria 6719714
523 2819542030 2818991436 Bacteria 5376622
524 2819591463 2818991445 Bacteria 4955017
525 2839140375 2839138175 Bacteria 6549354
526 2857551810 2857547612 Bacteria 6179999
527 2884813844 2884811622 Bacteria 5552861
528 2884837271 2884836552 Bacteria 5219991
529 2884853562 2884852848 Bacteria 5221161
530 2885084784 2885080285 Bacteria 6355622
531 2896155321 2896154374 Bacteria 5221518
532 2932411080 2932410948 Bacteria 6312192
533 2932419353 2932416698 Bacteria 6315112
534 Ga0182005_1000002
535 JGI25155J39150_1000257
536 JGI25155J39150_1000947
537 JGI25156J39149_1000426
538 JGI25156J39149_1003974
539 JGI25162J39368_1000271
540 JGI25154J39366_1000473
541 JGI25154J39366_1000493
542 JGI25158J39367_1000757
543 JGI25157J39369_1000450
544 JGI25152J39213_1000176
545 JGI25152J39213_1028305
546 JGI25150J39212_1000543
547 JGI25159J45721_1009223
548 JGI25165J46597_1000373
549 JGI25153J46596_10021834
550 JGI25161J50226_1001463
551 JGI25161J50226_1001792
552 Ga0055538_1000144
553 Ga0055539_1000195
554 Ga0055533_1000196
555 Ga0055532_1000101
556 Ga0055525_1000263
557 Ga0055535_1005964
558 Ga0055526_1000415
559 Ga0055526_1005360
560 Ga0055526_1032258
561 Ga0055537_1002229
562 Ga0055537_1003260
563 Ga0055524_1000021
564 Ga0055524_1000756
565 Ga0055524_1003341
566 Ga0055524_1009643
567 Ga0055534_1001919
568 Ga0055534_1010501
569 Ga0055528_1036685
570 Ga0055530_10000283
571 Ga0055531_10000410
572 Ga0055531_10058685
573 Ga0055531_10065416
574 Ga0055541_1000128
575 Ga0055543_1001424
576 Ga0065165_1000766
577 Ga0065165_1001842
578 Ga0065165_1083215
579 Ga0065165_1104501
580 Ga0065715_10124491
581 Ga0070658_10169938
582 Ga0070658_10516568
583 Ga0070658_10829446
584 Ga0070670_100000010
585 Ga0070666_10028071
586 Ga0070660_100224491
587 Ga0070660_100528014
588 Ga0070661_100209862
589 Ga0070669_100000387
590 Ga0070671_100000012
591 Ga0070659_100595715
592 Ga0070667_100000124
593 Ga0068855_100098317
594 Ga0068855_100160670
595 Ga0070664_100371693
596 Ga0070664_100577931
597 Ga0068856_100024067
598 Ga0068856_100678925
599 Ga0068852_100152309
600 Ga0068852_100764124
601 Ga0068864_100000018
602 Ga0068851_10421685
603 Ga0068863_100029645
604 Ga0068858_100406514
605 Ga0068860_100325067
606 Ga0075370_10221164
607 Ga0079104_1000072
608 Ga0079104_1005199
609 Ga0099826_10000041
610 Ga0105251_10064675
611 Ga0105244_10040121
612 Ga0105250_10000407
613 Ga0105240_10000569
614 Ga0105240_10432746
615 Ga0105240_10441930
616 Ga0105245_10149078
617 Ga0105247_10210092
618 Ga0105243_10905851
619 Ga0105243_11043305
620 Ga0105242_11013301
621 Ga0105237_10153552
622 Ga0105237_10611729
623 Ga0105238_10063491
624 Ga0105238_10203612
625 Ga0105249_10019065
626 Ga0105239_10154171
627 Ga0157326_1014352
628 Ga0157372_11371613
629 Ga0163163_10000069
630 Ga0182008_10000796
631 Ga0182008_10027858
632 Ga0182008_10058168
633 Ga0182006_1000002
634 Ga0182007_10000124
635 Ga0182007_10015023
636 Ga0163161_10101310
637 Ga0209435_100016
638 Ga0209435_100038
639 Ga0209435_100322
640 Ga0209436_100243
641 Ga0209436_106693
642 Ga0209436_108927
643 Ga0209784_100010
644 Ga0209566_100008
645 Ga0209674_100019
646 Ga0209672_104007
647 Ga0209147_100023
648 Ga0209563_100021
649 Ga0207427_102510
650 Ga0209437_100019
651 Ga0209437_100166
652 Ga0209258_100345
653 Ga0207425_1000001
654 Ga0207425_1000089
655 Ga0209646_1000033
656 Ga0209646_1000093
657 Ga0209026_1000031
658 Ga0209026_1002287
659 Ga0209677_100011
660 Ga0209148_1000575
661 Ga0209759_1000045
662 Ga0209759_1000565
663 Ga0209129_1000001
664 Ga0209129_1002496
665 Ga0209233_1000025
666 Ga0209565_1006140
667 Ga0209565_1008388
668 Ga0209565_1030762
669 Ga0209673_1027318
670 Ga0209130_1000407
671 Ga0209130_1006880
672 Ga0209675_1001579
673 Ga0209675_1012485
674 Ga0209675_1047260
675 Ga0209564_1000178
676 Ga0209564_1000443
677 Ga0209564_1004540
678 Ga0209564_1006177
679 Ga0209758_1000116
680 Ga0209050_1000271
681 Ga0209050_1000480
682 Ga0209050_1000844
683 Ga0209050_1004805
684 Ga0209050_1009486
685 Ga0209256_1000044
686 Ga0209256_1000297
687 Ga0209256_1000515
688 Ga0209256_1000635
689 Ga0207426_1001973
690 Ga0209051_1030807
691 Ga0209257_1000293
692 Ga0209257_1010322
693 Ga0207713_1071627
694 Ga0207680_10012563
695 Ga0207705_10001883
696 Ga0207705_10173529
697 Ga0207705_10484436
698 Ga0207654_10108150
699 Ga0207695_10002789
700 Ga0207657_10463832
701 Ga0207657_10502172
702 Ga0207649_10047166
703 Ga0207649_10589720
704 Ga0207681_10001220
705 Ga0207694_10083573
706 Ga0207650_10000003
707 Ga0207687_10082934
708 Ga0207644_10000036
709 Ga0207690_10413960
710 Ga0207706_10755758
711 Ga0207709_10000104
712 Ga0207679_10679309
713 Ga0207667_10010303
714 Ga0207667_10036930
715 Ga0207667_10690259
716 Ga0207712_10009809
717 Ga0207658_10000007
718 Ga0207703_10303114
719 Ga0207702_10027822
720 Ga0207641_10005798
721 Ga0207641_10714397
722 Ga0207676_10000003
723 Ga0207698_10563603
724 Ga0209281_1000002
725 Ga0209281_1029355
726 Ga0209282_1000001
727 Ga0265337_1110318
728 Ga0265332_10000015
729 Ga0265331_10014963
730 Ga0265327_10001967
731 Ga0307408_100000098
732 Ga0307408_100000526
733 Ga0307408_100000767
734 Ga0307408_100000792
735 Ga0307408_100000870
736 Ga0307408_100040915
737 Ga0307408_100573230
738 Ga0307406_10003341
739 Ga0395899_0000028
740 Ga0395899_0005629
741 Ga0395899_0009053
742 Ga0395900_0121094
743 Ga0395900_0139355
744 Ga0395900_0150603
745 Ga0395900_0321618
746 Ga0395900_0656114
747 Ga0395898_0062725
748 Ga0395898_0363701
749 Ga0395898_0458667
750 Ga0395898_1061194
751 Ga0395905_0774001
752 Ga0395901_0269699
753 Ga0395901_0316192
754 Ga0436361_1000267
755 Ga0451800_0905081
756 Ga0439448_0098524
757 Ga0439450_007782
758 Ga0439455_0005105
759 Ga0450891_000369
760 Ga0450893_0007413
761 Ga0451577_0162651
762 Ga0466972_0000088
763 Ga0453683_0004388
764 Ga0466965_0139818
765 Ga0466965_0285404
766 Ga0466964_0000385
767 Ga0453684_0288650
768 Ga0453684_0623094
769 Ga0453684_1674768
770 Ga0466970_0060096
771 Ga0466957_0347860
772 Ga0451576_0003846
773 Ga0466958_0014209
774 Ga0466958_0081857
775 Ga0466967_0043572
776 Ga0466967_0120667
777 Ga0466967_0530302
778 Ga0495617_000632
779 Ga0495617_008094
780 Ga0495617_008275
781 Ga0495617_015404
782 Ga0495617_103789
783 Ga0495617_120415
784 Ga0495592_0160716
785 Ga0495603_0004623
786 Ga0495603_0030825
787 Ga0495629_0010794
788 Ga0495638_0002326
789 Ga0495638_0052370
790 Ga0495651_0012702
791 Ga0495651_0082827
792 Ga0495653_0045323
793 Ga0495653_0172272
794 Ga0495650_0000048
795 Ga0495650_0003786
796 Ga0495650_0071794
797 Ga0495584_0000059
798 Ga0495584_0000082
799 Ga0495584_0000479
800 Ga0495584_0004260
801 Ga0495584_0008513
802 Ga0495584_0010316
803 Ga0495584_0044297
804 Ga0495584_0086890
805 Ga0495584_0153440
806 Ga0495584_0286058
807 Ga0495584_0307711
808 Ga0495585_0000084
809 Ga0495585_0000522
810 Ga0495585_0012225
811 Ga0495585_0018079
812 Ga0495585_0032311
813 Ga0495585_0033317
814 Ga0495585_0040681
815 Ga0495585_0089671
816 Ga0495585_0147645
817 Ga0495585_0157047
818 Ga0495585_0266041
819 Ga0495596_0000100
820 Ga0495596_0021053
821 Ga0495596_0129271
822 Ga0495596_0146084
823 Ga0495607_0004990
824 Ga0495607_0006726
825 Ga0495607_0007342
826 Ga0495607_0035365
827 Ga0495607_0054496
828 Ga0495583_0000295
829 Ga0495583_0000492
830 Ga0495583_0027011
831 Ga0495583_0032089
832 Ga0495583_0075667
833 Ga0495606_0004777
834 Ga0495606_0005115
835 Ga0495606_0014387
836 Ga0495606_0019794
837 Ga0495606_0046470
838 Ga0495608_0028589
839 Ga0495616_0001679
840 Ga0495616_0008907
841 Ga0495616_0029146
842 Ga0495616_0054308
843 Ga0495616_0108982
844 Ga0495628_0000580
845 Ga0495628_0151617
846 Ga0495631_0058374
847 Ga0495632_0042208
848 Ga0495643_0084635
849 Ga0495644_0000120
850 Ga0495644_0000716
851 Ga0495644_0017708
852 Ga0495648_0000118
853 Ga0495648_0000674
854 Ga0495663_0001754
855 Ga0495642_0005080
856 Ga0495642_0023047
857 Ga0495642_0035763
858 Ga0495642_0044221
859 Ga0495642_0078290
860 Ga0495642_0117596
861 Ga0495652_0006010
862 Ga0495652_0028657
863 Ga0495652_0126712
864 Ga0495652_0323350
865 Ga0495654_0013967
866 Ga0495654_0030214
867 Ga0495654_0098652
868 Ga0495609_0000140
869 Ga0495609_0002519
870 Ga0495609_0009035
871 Ga0495609_0016063
872 Ga0495609_0024706
873 Ga0495597_0005712
874 Ga0495597_0006221
875 Ga0495597_0009378
876 Ga0495597_0020246
877 Ga0495597_0047325
878 Ga0495597_0107428
879 Ga0495597_0123003
880 Ga0495645_0053834
881 Ga0495645_0490461
882 Ga0495633_0001076
883 Ga0495633_0001601
884 Ga0495633_0002254
885 Ga0495633_0002663
886 Ga0495633_0017259
887 Ga0495633_0030668
888 Ga0495656_0000887
889 Ga0495656_0066731
890 Ga0495656_0073663
891 Ga0495656_0086249
892 Ga0495656_0438399
893 Ga0495668_0002654
894 Ga0495668_0010062
895 Ga0495668_0131528
896 Ga0495668_0372850
897 Ga0495668_0377451
898 Ga0495634_0141238
899 Ga0495611_0000751
900 Ga0495611_0000954
901 Ga0495611_0006033
902 Ga0495611_0009763
903 Ga0495625_0001407
904 Ga0495625_0007167
905 Ga0495625_0011692
906 Ga0495625_0023982
907 Ga0495625_0044096
908 Ga0495625_0190604
909 Ga0495625_0415789
910 Ga0495659_0000014
911 Ga0495659_0000246
912 Ga0495659_0001927
913 Ga0495659_0005366
914 Ga0495661_0008728
915 Ga0495661_0039934
916 Ga0495661_0041631
917 Ga0495661_0057758
918 Ga0495661_0096556
919 Ga0495661_0118899
920 Ga0495661_0176705
921 Ga0495588_0000137
922 Ga0495588_0021620
923 Ga0495588_0028231
924 Ga0495588_0154525
925 Ga0495588_0213571
926 Ga0495588_0258593
927 Ga0495657_0147283
928 Ga0495599_0032549
929 Ga0495623_0021633
930 Ga0495623_0086351
931 Ga0495623_0277407
932 Ga0495646_0005852
933 Ga0495646_0062478
934 Ga0495669_0003209
935 Ga0495669_0013200
936 Ga0495669_0237578
937 Ga0495624_0022391
938 Ga0495624_0023854
939 Ga0495670_0002149
940 Ga0495670_0007840
941 Ga0495670_0063955
942 Ga0495670_0460584
943 Ga0495671_0000451
944 Ga0495671_0024969
945 Ga0495671_0027563
946 Ga0495671_0226274
947 Ga0495649_0021472
948 Ga0495649_0165857
949 Ga0495589_0099366
950 Ga0495600_0008875
951 Ga0495600_0236273
952 Ga0495660_0000485
953 Ga0495581_0124878
954 Ga0495636_0001089
955 Ga0495636_0082712
956 Ga0495672_0000123
957 Ga0495672_0003754
958 Ga0495672_0009012
959 Ga0495676_0008573
960 Ga0495680_0521693
961 Ga0495683_0000079
962 Ga0495683_0001601
963 Ga0495683_0002752
964 Ga0495683_0138101
965 Ga0495687_000263
966 Ga0495687_003066
967 Ga0495687_027659
968 Ga0495687_108411
969 Ga0495675_0036926
970 Ga0495677_0001202
971 Ga0495677_0002921
972 Ga0495677_0007082
973 Ga0495677_0022580
974 Ga0495677_0081450
975 Ga0495685_000015
976 Ga0495685_018708
977 Ga0495685_061792
978 Ga0495673_0008334
979 Ga0495681_0002629
980 Ga0495681_0008838
981 Ga0495681_0040730
982 Ga0495686_0001015
983 Ga0495602_0007374
984 Ga0495602_0083226
985 Ga0495602_0297775
986 Ga0495626_0000085
987 Ga0495626_0001715
988 Ga0495626_0006718
989 Ga0495626_0007503
990 Ga0495626_0017611
991 Ga0495626_0024687
992 Ga0495626_0058152
993 Ga0496100_0140225
994 Ga0496100_0191567
995 Ga0496101_0969346
996 Ga0496104_0452013
997 Ga0496111_0005607
998 Ga0496111_0430744
999 Ga0496113_0816559
1000 Ga0496114_0052667
1001 Ga0496116_0010559
1002 Ga0496116_0114651
1003 Ga0496117_0000001
1004 Ga0496117_0038747
1005 Ga0496117_0220538
1006 Ga0496118_0000002
1007 Ga0496118_0159064
1008 Ga0496121_0005713
1009 Ga0496121_0009584
1010 Ga0496121_0017840
1011 Ga0496121_0023093
1012 Ga0496122_0000457
1013 Ga0496122_0002075
1014 Ga0496122_0097403
1015 Ga0496123_0000321
1016 Ga0496123_0153355
1017 Ga0496124_0101924
1018 Ga0496125_0006830
1019 Ga0496125_0012265
1020 Ga0496125_0045347
1021 Ga0496125_0084383
1022 Ga0496125_0112950
1023 Ga0496125_0382302
1024 Ga0495678_015340
1025 Ga0495682_0000274
1026 Ga0495682_0002560
1027 Ga0495682_0035067
1028 Ga0495682_0060901
1029 Ga0501034_0278025
1030 Ga0501238_002895
1031 Ga0501282_021651
1032 Ga0501035_0651053
1033 Ga0501044_0216174
1034 Ga0501226_014295
1035 Ga0501226_019563
1036 Ga0500651_0013323
1037 Ga0500593_006078
1038 Ga0500595_001521
1039 Ga0500595_004649
1040 Ga0500628_013864
1041 Ga0500604_0059047
1042 Ga0500645_097030
1043 2511251121
1044 2550696287
1045 2601667468
1046 2643787258
1047 2644215668
1048 2644252286
1049 2644360931
1050 2722885430
1051 2738715111
1052 2738742311
1053 2738843700
1054 2739275226
1055 2739344270
1056 2819542030
1057 2819591463
1058 2839140375
1059 2857551810
1060 2884813844
1061 2884837271
1062 2884853562
1063 2885084784
1064 2896155321
1065 2932411080
1066 2932419353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03942

DTW

DTW domain

34

229

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6emv-assembly2.cif.gz_B crystal structure of dual specific trm10 construct from thermococcus kodakaraensis. 0.4594 35 141
6jfy-assembly1.cif.gz_B gluk3 receptor trapped in desensitized state 0.4585 35 140
5h5d-assembly1.cif.gz_A the crystal structure of the yeast arginine methyltransferase sfm1 complexed with mta 0.4567 37 147
6k4d-assembly1.cif.gz_A ancestral luciferase anclamp in complex with atp and d-luciferin 0.4532 27 89
4hh0-assembly1.cif.gz_A dark-state structure of appa c20s without the cys-rich region from rb. sphaeroides 0.4506 34 139
ID Description Score Start End Superfamily
af_Q9VI85_20_209_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8348 9 193 3.40.1280.10
af_Q9VI85_20_209_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8107 9 193 3.40.1280.10
af_A0A1D6KBM0_272_491_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.7975 85 193 3.40.1280.10
af_Q9D0U1_66_256_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.7937 9 193 3.40.1280.10
af_Q54Y04_84_367_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.7784 11 192 3.40.1280.10
ID Description Score Start End GO Terms
AF-W0V5C5-F1-model_v4 tRNA-uridine aminocarboxypropyltransferase (EC 2.5.1.25) 0.972 11 197 GO:0008033
GO:0016432
AF-A0A0S4K1M1-F1-model_v4 deleted 0.967 1 196
AF-A0A7S9UR09-F1-model_v4 deleted 0.9659 1 196
AF-A0A7X2LW41-F1-model_v4 tRNA-uridine aminocarboxypropyltransferase (EC 2.5.1.25) 0.9599 1 199 GO:0008033
GO:0016740
AF-A0A254TDS7-F1-model_v4 tRNA-uridine aminocarboxypropyltransferase (EC 2.5.1.25) 0.959 5 196 GO:0008033
GO:0016432

Map