F460393

General Info

Members Datasets Scaffolds Average Seq Length
533 168 1066 149

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11386495|Ga0105240_113864951
Length 177
Sequence VPLYSLNDLSPQLGSGAWAAPSADLIGDVRLGARASVWFGAVLRGDNTPLILGDETNFQDGSIGHSDADFPLTIGARVTVGHQAILHGCTVADDCLIGMGARILNGAAIEPELPDLGERLEEIIVARVAACDADPDSALEQEFAHVAADESGAAEDCHKLFRRLDHRARALATSFLH

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.63
Rhizosphere 97.19
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_11386495 3300009093 Bacteria 739
2 MRS1b_contig_2549187 2162886011 Bacteria 892
3 JGI24741J21665_1001454 3300001915 Bacteria 6779
4 JGI24740J21852_10001251 3300001979 Bacteria 11500
5 JGI24739J22299_10002074 3300001989 Bacteria 7673
6 JGI24737J22298_10008572 3300001990 Bacteria 3418
7 JGI24735J21928_10005139 3300002067 Bacteria 4354
8 JGI24735J21928_10025251 3300002067 Bacteria 1794
9 JGI24735J21928_10088965 3300002067 Bacteria 885
10 JGI24742J22300_10048406 3300002244 Bacteria 767
11 Ga0065712_10097799 3300005290 Bacteria 2139
12 Ga0065715_10017052 3300005293 Bacteria 3248
13 Ga0070658_10057910 3300005327 Bacteria 3152
14 Ga0070658_10087443 3300005327 Bacteria 2565
15 Ga0070658_10102785 3300005327 Bacteria 2363
16 Ga0070658_10138691 3300005327 Bacteria 2030
17 Ga0070658_10191584 3300005327 Bacteria 1723
18 Ga0070658_10275562 3300005327 Bacteria 1431
19 Ga0070658_10313598 3300005327 Bacteria 1338
20 Ga0070658_10427610 3300005327 Bacteria 1139
21 Ga0070676_10001015 3300005328 Bacteria 13927
22 Ga0070683_100067385 3300005329 Bacteria 3334
23 Ga0070683_100146285 3300005329 Bacteria 2239
24 Ga0070683_100527593 3300005329 Bacteria 1128
25 Ga0070690_100560721 3300005330 Bacteria 862
26 Ga0070670_100009958 3300005331 Bacteria 8113
27 Ga0070677_10029536 3300005333 Bacteria 2080
28 Ga0070666_10052568 3300005335 Bacteria 2745
29 Ga0070666_10190034 3300005335 Bacteria 1443
30 Ga0070680_100008726 3300005336 Bacteria 7771
31 Ga0070680_100030365 3300005336 Bacteria 4341
32 Ga0070680_100042796 3300005336 Bacteria 3676
33 Ga0070680_100107120 3300005336 Bacteria 2325
34 Ga0070680_100296900 3300005336 Bacteria 1370
35 Ga0070680_101052585 3300005336 Bacteria 703
36 Ga0070680_101138202 3300005336 Bacteria 675
37 Ga0070682_100002001 3300005337 Bacteria 11372
38 Ga0070682_100111384 3300005337 Bacteria 1825
39 Ga0070660_100016867 3300005339 Bacteria 5312
40 Ga0070660_100020181 3300005339 Bacteria 4893
41 Ga0070660_100032724 3300005339 Bacteria 3915
42 Ga0070660_100045756 3300005339 Bacteria 3352
43 Ga0070660_100066206 3300005339 Bacteria 2812
44 Ga0070660_100120250 3300005339 Bacteria 2096
45 Ga0070660_100232728 3300005339 Bacteria 1499
46 Ga0070660_100366887 3300005339 Bacteria 1187
47 Ga0070660_100555796 3300005339 Bacteria 958
48 Ga0070660_100824710 3300005339 Bacteria 781
49 Ga0070691_10029617 3300005341 Bacteria 2562
50 Ga0070661_100004849 3300005344 Bacteria 9261
51 Ga0070661_100024454 3300005344 Bacteria 4332
52 Ga0070661_100026968 3300005344 Bacteria 4136
53 Ga0070661_100028910 3300005344 Bacteria 4000
54 Ga0070661_100081975 3300005344 Bacteria 2382
55 Ga0070661_100189866 3300005344 Bacteria 1567
56 Ga0070661_100302602 3300005344 Bacteria 1245
57 Ga0070692_10116661 3300005345 Bacteria 1483
58 Ga0070668_100028004 3300005347 Bacteria 4277
59 Ga0070675_100071106 3300005354 Bacteria 2885
60 Ga0070671_100001670 3300005355 Bacteria 16795
61 Ga0070671_100041234 3300005355 Bacteria 3836
62 Ga0070671_100069747 3300005355 Bacteria 2932
63 Ga0070671_100156633 3300005355 Bacteria 1924
64 Ga0070671_100212563 3300005355 Bacteria 1640
65 Ga0070671_100408244 3300005355 Bacteria 1162
66 Ga0070674_100041808 3300005356 Bacteria 3110
67 Ga0070674_100547636 3300005356 Bacteria 970
68 Ga0070673_100004100 3300005364 Bacteria 9176
69 Ga0070673_100035335 3300005364 Bacteria 3789
70 Ga0070673_100168182 3300005364 Bacteria 1870
71 Ga0070673_100554303 3300005364 Bacteria 1044
72 Ga0070659_100004595 3300005366 Bacteria 9874
73 Ga0070659_100041240 3300005366 Bacteria 3607
74 Ga0070659_100169384 3300005366 Bacteria 1788
75 Ga0070659_100245549 3300005366 Bacteria 1483
76 Ga0070659_100372816 3300005366 Bacteria 1201
77 Ga0070659_100400887 3300005366 Bacteria 1158
78 Ga0070659_100501436 3300005366 Bacteria 1035
79 Ga0070667_100012450 3300005367 Bacteria 7037
80 Ga0070667_101496675 3300005367 Bacteria 634
81 Ga0070714_100136175 3300005435 Bacteria 2199
82 Ga0070714_100817424 3300005435 Bacteria 903
83 Ga0070701_10020489 3300005438 Bacteria 3141
84 Ga0070700_100026256 3300005441 Bacteria 3438
85 Ga0070663_100009529 3300005455 Bacteria 6016
86 Ga0070663_100035379 3300005455 Bacteria 3465
87 Ga0070663_100062182 3300005455 Bacteria 2691
88 Ga0070663_100091900 3300005455 Bacteria 2250
89 Ga0070663_100095948 3300005455 Bacteria 2205
90 Ga0070663_100313248 3300005455 Bacteria 1260
91 Ga0070663_100511688 3300005455 Bacteria 998
92 Ga0070663_100854156 3300005455 Bacteria 783
93 Ga0070678_100139205 3300005456 Bacteria 1939
94 Ga0070662_100000396 3300005457 Bacteria 26013
95 Ga0070662_100002657 3300005457 Bacteria 11026
96 Ga0070662_100004619 3300005457 Bacteria 8727
97 Ga0070662_100005822 3300005457 Bacteria 7907
98 Ga0070662_100236570 3300005457 Bacteria 1463
99 Ga0070662_100271389 3300005457 Bacteria 1370
100 Ga0070662_100381797 3300005457 Bacteria 1160
101 Ga0070681_10015100 3300005458 Bacteria 7681
102 Ga0070681_10685071 3300005458 Bacteria 940
103 Ga0070681_11424745 3300005458 Bacteria 617
104 Ga0068867_100110364 3300005459 Bacteria 2113
105 Ga0068867_100218446 3300005459 Bacteria 1535
106 Ga0070679_100022921 3300005530 Bacteria 6106
107 Ga0070679_100026181 3300005530 Bacteria 5726
108 Ga0070679_100120023 3300005530 Bacteria 2614
109 Ga0070679_100201045 3300005530 Bacteria 1959
110 Ga0070679_100286688 3300005530 Bacteria 1598
111 Ga0070679_100332271 3300005530 Bacteria 1468
112 Ga0070679_100386622 3300005530 Bacteria 1346
113 Ga0070679_101071351 3300005530 Bacteria 750
114 Ga0070684_100020494 3300005535 Bacteria 5485
115 Ga0070684_100118828 3300005535 Bacteria 2376
116 Ga0070684_100131113 3300005535 Bacteria 2261
117 Ga0068853_100013441 3300005539 Bacteria 6683
118 Ga0068853_100020701 3300005539 Bacteria 5471
119 Ga0068853_100026001 3300005539 Bacteria 4913
120 Ga0068853_100044596 3300005539 Bacteria 3796
121 Ga0068853_100045314 3300005539 Bacteria 3766
122 Ga0070672_100061072 3300005543 Bacteria 2970
123 Ga0070693_100099805 3300005547 Bacteria 1766
124 Ga0068855_100052677 3300005563 Bacteria 4790
125 Ga0068855_100064983 3300005563 Bacteria 4254
126 Ga0068855_100124380 3300005563 Bacteria 2950
127 Ga0068855_100160416 3300005563 Bacteria 2553
128 Ga0068855_100214492 3300005563 Bacteria 2161
129 Ga0068855_100382151 3300005563 Bacteria 1546
130 Ga0068855_100680448 3300005563 Bacteria 1102
131 Ga0070664_100015912 3300005564 Bacteria 6158
132 Ga0070664_100016226 3300005564 Bacteria 6106
133 Ga0070664_100048581 3300005564 Bacteria 3586
134 Ga0070664_100064902 3300005564 Bacteria 3114
135 Ga0070664_100163878 3300005564 Bacteria 1968
136 Ga0070664_100396415 3300005564 Bacteria 1262
137 Ga0070664_101381791 3300005564 Bacteria 665
138 Ga0068857_100019479 3300005577 Bacteria 5960
139 Ga0068857_100020085 3300005577 Bacteria 5872
140 Ga0068857_100025043 3300005577 Bacteria 5256
141 Ga0068854_100059774 3300005578 Bacteria 2755
142 Ga0068854_100120971 3300005578 Bacteria 1987
143 Ga0068854_100268810 3300005578 Bacteria 1368
144 Ga0068854_100954466 3300005578 Bacteria 756
145 Ga0068856_100158391 3300005614 Bacteria 2274
146 Ga0068856_100488881 3300005614 Bacteria 1252
147 Ga0068856_100692593 3300005614 Bacteria 1039
148 Ga0068852_100008231 3300005616 Bacteria 7665
149 Ga0068852_100027268 3300005616 Bacteria 4654
150 Ga0068852_100056106 3300005616 Bacteria 3402
151 Ga0068852_100124681 3300005616 Bacteria 2363
152 Ga0068852_100254372 3300005616 Unclassified 1684
153 Ga0068852_100470043 3300005616 Bacteria 1248
154 Ga0068852_100910695 3300005616 Bacteria 896
155 Ga0068852_101000144 3300005616 Bacteria 855
156 Ga0068852_101194924 3300005616 Bacteria 781
157 Ga0068852_102312513 3300005616 Bacteria 558
158 Ga0068859_101038127 3300005617 Bacteria 901
159 Ga0068864_100005796 3300005618 Bacteria 10135
160 Ga0068864_100095624 3300005618 Bacteria 2628
161 Ga0068864_100546546 3300005618 Bacteria 1119
162 Ga0068864_100640843 3300005618 Bacteria 1034
163 Ga0068861_100035949 3300005719 Bacteria 3672
164 Ga0068851_10004163 3300005834 Bacteria 6512
165 Ga0068851_10012109 3300005834 Bacteria 4061
166 Ga0068851_10015067 3300005834 Bacteria 3679
167 Ga0068863_100080750 3300005841 Bacteria 3080
168 Ga0068860_100470955 3300005843 Bacteria 1251
169 Ga0068860_100579521 3300005843 Bacteria 1126
170 Ga0068860_101017152 3300005843 Bacteria 847
171 Ga0068862_100013226 3300005844 Bacteria 6825
172 Ga0075429_101071324 3300006880 Bacteria 704
173 Ga0068865_100531836 3300006881 Bacteria 985
174 Ga0097620_101038073 3300006931 Bacteria 901
175 Ga0105240_10069742 3300009093 Bacteria 4350
176 Ga0105240_11806302 3300009093 Bacteria 637
177 Ga0105243_10174602 3300009148 Bacteria 1864
178 Ga0105241_10138353 3300009174 Bacteria 1980
179 Ga0105241_10358256 3300009174 Bacteria 1269
180 Ga0105248_10025398 3300009177 Bacteria 6586
181 Ga0105248_10043584 3300009177 Bacteria 5031
182 Ga0105248_10203118 3300009177 Bacteria 2233
183 Ga0105237_10013373 3300009545 Bacteria 8608
184 Ga0105237_10119913 3300009545 Bacteria 2624
185 Ga0105238_10478713 3300009551 Bacteria 1244
186 Ga0105249_10015106 3300009553 Bacteria 6831
187 Ga0105249_10388068 3300009553 Bacteria 1424
188 Ga0105239_10159702 3300010375 Bacteria 2518
189 Ga0105239_10652386 3300010375 Bacteria 1202
190 Ga0157373_10010324 3300013100 Bacteria 6878
191 Ga0157373_10064912 3300013100 Bacteria 2584
192 Ga0157373_10078555 3300013100 Bacteria 2327
193 Ga0157373_10144481 3300013100 Bacteria 1673
194 Ga0157373_10192782 3300013100 Bacteria 1436
195 Ga0157373_10292020 3300013100 Bacteria 1156
196 Ga0157371_10018199 3300013102 Bacteria 5199
197 Ga0157371_10032646 3300013102 Bacteria 3745
198 Ga0157371_10106275 3300013102 Bacteria 1992
199 Ga0157371_10123636 3300013102 Bacteria 1840
200 Ga0157371_10167551 3300013102 Bacteria 1569
201 Ga0157371_10270709 3300013102 Unclassified 1226
202 Ga0157371_10791341 3300013102 Bacteria 714
203 Ga0157371_10947526 3300013102 Bacteria 655
204 Ga0157370_10016460 3300013104 Bacteria 7485
205 Ga0157370_10097304 3300013104 Bacteria 2761
206 Ga0157370_10148058 3300013104 Bacteria 2186
207 Ga0157370_10178695 3300013104 Bacteria 1972
208 Ga0157369_10048561 3300013105 Bacteria 4605
209 Ga0157369_10096812 3300013105 Bacteria 3148
210 Ga0157369_10104866 3300013105 Bacteria 3010
211 Ga0157369_10407902 3300013105 Bacteria 1409
212 Ga0157369_10695601 3300013105 Bacteria 1047
213 Ga0157374_10069326 3300013296 Bacteria 3320
214 Ga0157372_10009904 3300013307 Bacteria 10136
215 Ga0157372_10039833 3300013307 Bacteria 5188
216 Ga0157372_10127285 3300013307 Bacteria 2929
217 Ga0157372_10568365 3300013307 Bacteria 1322
218 Ga0157372_10650525 3300013307 Bacteria 1227
219 Ga0157372_10821347 3300013307 Bacteria 1080
220 Ga0157372_11045000 3300013307 Bacteria 945
221 Ga0157380_10007408 3300014326 Bacteria 7791
222 Ga0163161_10043910 3300017792 Bacteria 3218
223 Ga0206354_11013178 3300020081 Bacteria 596
224 Ga0206353_11002623 3300020082 Bacteria 1239
225 Ga0206353_12024388 3300020082 Bacteria 979
226 Ga0207666_1024645 3300025271 Bacteria 899
227 Ga0207673_1004025 3300025290 Bacteria 1741
228 Ga0207697_10003320 3300025315 Bacteria 8009
229 Ga0207656_10015720 3300025321 Bacteria 2934
230 Ga0207656_10172487 3300025321 Bacteria 1035
231 Ga0207682_10002133 3300025893 Bacteria 8972
232 Ga0207680_10333792 3300025903 Bacteria 1062
233 Ga0207680_10455939 3300025903 Bacteria 908
234 Ga0207647_10098108 3300025904 Bacteria 1741
235 Ga0207647_10125571 3300025904 Bacteria 1510
236 Ga0207645_10002195 3300025907 Bacteria 15584
237 Ga0207645_10008148 3300025907 Bacteria 7339
238 Ga0207643_10630337 3300025908 Bacteria 691
239 Ga0207705_10006164 3300025909 Bacteria 8918
240 Ga0207705_10007414 3300025909 Bacteria 8069
241 Ga0207705_10010605 3300025909 Bacteria 6696
242 Ga0207705_10013910 3300025909 Bacteria 5803
243 Ga0207705_10016143 3300025909 Bacteria 5359
244 Ga0207705_10019648 3300025909 Bacteria 4830
245 Ga0207705_10083012 3300025909 Bacteria 2337
246 Ga0207705_10100570 3300025909 Bacteria 2126
247 Ga0207705_10126966 3300025909 Bacteria 1896
248 Ga0207705_10917255 3300025909 Bacteria 678
249 Ga0207707_10018268 3300025912 Bacteria 6113
250 Ga0207707_10079451 3300025912 Bacteria 2864
251 Ga0207707_10626623 3300025912 Bacteria 908
252 Ga0207707_10928197 3300025912 Bacteria 718
253 Ga0207707_11128807 3300025912 Bacteria 638
254 Ga0207695_10006228 3300025913 Bacteria 15537
255 Ga0207695_10016672 3300025913 Bacteria 8585
256 Ga0207695_10088765 3300025913 Bacteria 3111
257 Ga0207671_10010252 3300025914 Bacteria 7752
258 Ga0207660_10000864 3300025917 Bacteria 20005
259 Ga0207660_10002538 3300025917 Bacteria 11983
260 Ga0207660_10180602 3300025917 Bacteria 1639
261 Ga0207657_10001115 3300025919 Bacteria 28496
262 Ga0207657_10010311 3300025919 Bacteria 9330
263 Ga0207657_10016405 3300025919 Bacteria 7145
264 Ga0207657_10028965 3300025919 Bacteria 5045
265 Ga0207657_10035426 3300025919 Bacteria 4476
266 Ga0207657_10088353 3300025919 Bacteria 2591
267 Ga0207657_10117709 3300025919 Bacteria 2188
268 Ga0207657_10160173 3300025919 Bacteria 1828
269 Ga0207657_10379721 3300025919 Bacteria 1113
270 Ga0207649_10003421 3300025920 Bacteria 8680
271 Ga0207649_10043446 3300025920 Bacteria 2748
272 Ga0207649_10165051 3300025920 Bacteria 1538
273 Ga0207649_10272871 3300025920 Bacteria 1227
274 Ga0207652_10012378 3300025921 Bacteria 6893
275 Ga0207652_10017127 3300025921 Bacteria 5927
276 Ga0207652_10064045 3300025921 Bacteria 3181
277 Ga0207652_10145693 3300025921 Bacteria 2120
278 Ga0207652_10181346 3300025921 Bacteria 1892
279 Ga0207652_10350961 3300025921 Bacteria 1331
280 Ga0207652_10396347 3300025921 Bacteria 1246
281 Ga0207652_10566593 3300025921 Bacteria 1020
282 Ga0207652_10766044 3300025921 Bacteria 858
283 Ga0207681_10042898 3300025923 Bacteria 3024
284 Ga0207694_10001718 3300025924 Bacteria 18345
285 Ga0207650_10004942 3300025925 Bacteria 9108
286 Ga0207650_10013803 3300025925 Bacteria 5601
287 Ga0207659_10000660 3300025926 Bacteria 20395
288 Ga0207644_10005099 3300025931 Bacteria 8577
289 Ga0207644_10018932 3300025931 Bacteria 4668
290 Ga0207644_10047439 3300025931 Bacteria 3065
291 Ga0207644_10331035 3300025931 Bacteria 1233
292 Ga0207644_10441536 3300025931 Bacteria 1068
293 Ga0207690_10000709 3300025932 Bacteria 21444
294 Ga0207690_10002599 3300025932 Bacteria 10892
295 Ga0207690_10031558 3300025932 Bacteria 3392
296 Ga0207690_10067933 3300025932 Bacteria 2447
297 Ga0207690_10088240 3300025932 Bacteria 2184
298 Ga0207690_11047369 3300025932 Bacteria 679
299 Ga0207690_11154743 3300025932 Bacteria 646
300 Ga0207706_10000746 3300025933 Bacteria 33880
301 Ga0207706_10000914 3300025933 Bacteria 30342
302 Ga0207706_10006280 3300025933 Bacteria 11042
303 Ga0207706_10027342 3300025933 Bacteria 5102
304 Ga0207706_10096542 3300025933 Bacteria 2599
305 Ga0207706_10109665 3300025933 Bacteria 2429
306 Ga0207706_10375171 3300025933 Bacteria 1235
307 Ga0207706_10463316 3300025933 Bacteria 1096
308 Ga0207706_11025841 3300025933 Bacteria 692
309 Ga0207691_10001753 3300025940 Bacteria 21358
310 Ga0207691_10058669 3300025940 Bacteria 3500
311 Ga0207711_10004825 3300025941 Bacteria 11457
312 Ga0207711_10005374 3300025941 Bacteria 10843
313 Ga0207661_10008542 3300025944 Bacteria 7320
314 Ga0207661_10013895 3300025944 Bacteria 5885
315 Ga0207661_10026353 3300025944 Bacteria 4428
316 Ga0207679_10010212 3300025945 Bacteria 6039
317 Ga0207679_10099077 3300025945 Bacteria 2275
318 Ga0207679_10128115 3300025945 Bacteria 2032
319 Ga0207667_10014131 3300025949 Bacteria 9112
320 Ga0207667_10017621 3300025949 Bacteria 8034
321 Ga0207667_10049742 3300025949 Bacteria 4425
322 Ga0207667_10085815 3300025949 Bacteria 3258
323 Ga0207667_10230110 3300025949 Bacteria 1898
324 Ga0207667_10305222 3300025949 Bacteria 1626
325 Ga0207667_10354661 3300025949 Bacteria 1496
326 Ga0207667_10616476 3300025949 Bacteria 1093
327 Ga0207667_11451507 3300025949 Bacteria 658
328 Ga0207651_10681878 3300025960 Bacteria 904
329 Ga0207651_10849135 3300025960 Bacteria 811
330 Ga0207712_10045044 3300025961 Bacteria 3053
331 Ga0207712_10074360 3300025961 Bacteria 2453
332 Ga0207668_10064353 3300025972 Bacteria 2591
333 Ga0207640_10012192 3300025981 Bacteria 4890
334 Ga0207640_10114777 3300025981 Bacteria 1917
335 Ga0207640_10388105 3300025981 Bacteria 1133
336 Ga0207640_10438533 3300025981 Bacteria 1073
337 Ga0207640_10627412 3300025981 Bacteria 913
338 Ga0207658_10306834 3300025986 Bacteria 1369
339 Ga0207658_11289339 3300025986 Bacteria 668
340 Ga0207639_10001105 3300026041 Bacteria 18312
341 Ga0207639_10012560 3300026041 Bacteria 5901
342 Ga0207639_10019373 3300026041 Bacteria 4852
343 Ga0207639_10093937 3300026041 Bacteria 2406
344 Ga0207639_10153502 3300026041 Bacteria 1931
345 Ga0207639_10333723 3300026041 Bacteria 1350
346 Ga0207678_10001718 3300026067 Bacteria 20053
347 Ga0207678_10019915 3300026067 Bacteria 5896
348 Ga0207678_10031462 3300026067 Bacteria 4629
349 Ga0207678_10032282 3300026067 Bacteria 4563
350 Ga0207678_10079689 3300026067 Bacteria 2804
351 Ga0207678_10149761 3300026067 Bacteria 1992
352 Ga0207678_10497197 3300026067 Bacteria 1063
353 Ga0207678_10666398 3300026067 Bacteria 914
354 Ga0207708_10199033 3300026075 Bacteria 1598
355 Ga0207702_10157185 3300026078 Bacteria 2073
356 Ga0207702_10603333 3300026078 Bacteria 1077
357 Ga0207702_11194277 3300026078 Bacteria 755
358 Ga0207676_10057336 3300026095 Bacteria 3067
359 Ga0207676_10173147 3300026095 Bacteria 1882
360 Ga0207676_10406595 3300026095 Bacteria 1273
361 Ga0207676_10827526 3300026095 Bacteria 904
362 Ga0207674_10006239 3300026116 Bacteria 14052
363 Ga0207674_10015766 3300026116 Bacteria 8290
364 Ga0207674_10264311 3300026116 Bacteria 1668
365 Ga0207674_10344503 3300026116 Bacteria 1441
366 Ga0207674_11619248 3300026116 Bacteria 616
367 Ga0207675_100017757 3300026118 Bacteria 6636
368 Ga0207683_10229031 3300026121 Bacteria 1694
369 Ga0207698_10001191 3300026142 Bacteria 15162
370 Ga0207698_10002465 3300026142 Bacteria 10976
371 Ga0207698_10005372 3300026142 Bacteria 7909
372 Ga0207698_10026687 3300026142 Bacteria 4088
373 Ga0207698_10031443 3300026142 Bacteria 3831
374 Ga0207698_10240536 3300026142 Bacteria 1649
375 Ga0207698_11134226 3300026142 Bacteria 795
376 Ga0207698_11149659 3300026142 Bacteria 790
377 Ga0207698_11272186 3300026142 Bacteria 750
378 Ga0268265_10089402 3300028380 Bacteria 2456
379 Ga0268264_10261253 3300028381 Bacteria 1613
380 Ga0268264_10404827 3300028381 Bacteria 1312
381 Ga0307408_100308977 3300031548 Bacteria 1327
382 Ga0307405_10066463 3300031731 Bacteria 2299
383 Ga0307405_10503147 3300031731 Bacteria 971
384 Ga0307413_10000673 3300031824 Bacteria 11658
385 Ga0307413_10292852 3300031824 Bacteria 1230
386 Ga0307410_10000425 3300031852 Bacteria 16799
387 Ga0307410_10014284 3300031852 Bacteria 4667
388 Ga0307410_10125280 3300031852 Bacteria 1880
389 Ga0307406_10084853 3300031901 Bacteria 2116
390 Ga0307406_10359794 3300031901 Bacteria 1140
391 Ga0307407_10004841 3300031903 Bacteria 5774
392 Ga0307407_10034533 3300031903 Bacteria 2770
393 Ga0307412_10360155 3300031911 Bacteria 1171
394 Ga0307412_10720063 3300031911 Bacteria 858
395 Ga0307409_100021775 3300031995 Bacteria 4403
396 Ga0307409_100096653 3300031995 Bacteria 2437
397 Ga0307409_100105170 3300031995 Bacteria 2352
398 Ga0307409_100286532 3300031995 Bacteria 1525
399 Ga0307416_100091302 3300032002 Bacteria 2615
400 Ga0307416_100091432 3300032002 Bacteria 2614
401 Ga0307414_10006663 3300032004 Bacteria 6458
402 Ga0307414_10035744 3300032004 Bacteria 3309
403 Ga0307414_10239751 3300032004 Bacteria 1500
404 Ga0307414_10405975 3300032004 Bacteria 1184
405 Ga0307414_10907769 3300032004 Bacteria 808
406 Ga0307411_10014684 3300032005 Bacteria 4368
407 Ga0307411_10015911 3300032005 Bacteria 4241
408 Ga0307411_10103300 3300032005 Bacteria 2021
409 Ga0307411_10117087 3300032005 Bacteria 1919
410 Ga0307411_10172011 3300032005 Bacteria 1634
411 Ga0307411_10184338 3300032005 Bacteria 1587
412 Ga0307411_10231055 3300032005 Bacteria 1442
413 Ga0307411_10313709 3300032005 Bacteria 1263
414 Ga0307411_10769385 3300032005 Bacteria 845
415 Ga0307415_100001430 3300032126 Bacteria 11409
416 Ga0307415_100305105 3300032126 Bacteria 1320
417 Ga0307415_100320738 3300032126 Bacteria 1292
418 Ga0307415_100453670 3300032126 Bacteria 1109
419 Ga0307415_100560554 3300032126 Bacteria 1010
420 Ga0395899_0011333 3300037312 Bacteria 6829
421 Ga0395899_0011406 3300037312 Bacteria 6804
422 Ga0395899_0023219 3300037312 Bacteria 4701
423 Ga0395899_0060849 3300037312 Bacteria 2782
424 Ga0395899_0086067 3300037312 Bacteria 2283
425 Ga0395899_0097230 3300037312 Bacteria 2128
426 Ga0395899_0109844 3300037312 Bacteria 1983
427 Ga0395899_0207909 3300037312 Bacteria 1361
428 Ga0395900_0002464 3300037418 Bacteria 20376
429 Ga0395900_0003622 3300037418 Bacteria 16610
430 Ga0395900_0018873 3300037418 Bacteria 7034
431 Ga0395900_0027587 3300037418 Bacteria 5816
432 Ga0395900_0181067 3300037418 Bacteria 2141
433 Ga0395900_0318027 3300037418 Bacteria 1537
434 Ga0395900_0342337 3300037418 Bacteria 1470
435 Ga0395900_0406007 3300037418 Bacteria 1325
436 Ga0395900_0436886 3300037418 Bacteria 1267
437 Ga0395900_0744766 3300037418 Bacteria 910
438 Ga0395900_1329832 3300037418 Bacteria 632
439 Ga0395898_0006331 3300037466 Bacteria 12650
440 Ga0395898_0019094 3300037466 Bacteria 6978
441 Ga0395898_0024038 3300037466 Bacteria 6149
442 Ga0395898_0108209 3300037466 Bacteria 2665
443 Ga0395898_0168712 3300037466 Bacteria 2092
444 Ga0395898_0194809 3300037466 Bacteria 1936
445 Ga0395898_0214658 3300037466 Bacteria 1835
446 Ga0395898_0604613 3300037466 Bacteria 1039
447 Ga0395905_0014002 3300037471 Bacteria 7672
448 Ga0395905_0062359 3300037471 Bacteria 3487
449 Ga0395905_0069276 3300037471 Bacteria 3303
450 Ga0395905_0129160 3300037471 Bacteria 2377
451 Ga0395905_0132641 3300037471 Bacteria 2343
452 Ga0395905_0173248 3300037471 Bacteria 2026
453 Ga0395905_0288459 3300037471 Bacteria 1528
454 Ga0395905_0385440 3300037471 Bacteria 1296
455 Ga0395905_0474907 3300037471 Bacteria 1149
456 Ga0395905_0583416 3300037471 Bacteria 1019
457 Ga0395905_0786654 3300037471 Bacteria 854
458 Ga0395905_1333375 3300037471 Bacteria 621
459 Ga0395901_0000589 3300038443 Bacteria 42319
460 Ga0395901_0032051 3300038443 Bacteria 5422
461 Ga0395901_0062247 3300038443 Bacteria 3883
462 Ga0395901_0088323 3300038443 Bacteria 3242
463 Ga0395901_0121098 3300038443 Bacteria 2750
464 Ga0395901_0130732 3300038443 Bacteria 2638
465 Ga0395901_0196426 3300038443 Bacteria 2115
466 Ga0395901_0216853 3300038443 Bacteria 2001
467 Ga0395901_0423107 3300038443 Bacteria 1365
468 Ga0436365_0438315 3300039437 Bacteria 13498
469 Ga0450912_003820 3300042116 Bacteria 1093
470 Ga0450920_034776 3300042122 Bacteria 997
471 Ga0466966_0309693 3300044684 Bacteria 949
472 Ga0466961_0017090 3300044693 Bacteria 4659
473 Ga0466961_0115534 3300044693 Bacteria 1687
474 Ga0466963_0000058 3300044694 Bacteria 37428
475 Ga0466963_0004423 3300044694 Bacteria 8165
476 Ga0466963_0017068 3300044694 Bacteria 4522
477 Ga0466963_0034486 3300044694 Bacteria 3292
478 Ga0466963_0124191 3300044694 Bacteria 1778
479 Ga0466963_0128659 3300044694 Bacteria 1748
480 Ga0466963_0171979 3300044694 Bacteria 1510
481 Ga0466963_0183889 3300044694 Bacteria 1459
482 Ga0466964_0122035 3300044706 Bacteria 1176
483 Ga0453684_0562431 3300044712 Bacteria 1255
484 Ga0466971_0002898 3300044719 Bacteria 7274
485 Ga0466971_0089069 3300044719 Bacteria 1412
486 Ga0466971_0147945 3300044719 Bacteria 1096
487 Ga0466971_0154048 3300044719 Bacteria 1074
488 Ga0466957_0006412 3300044842 Bacteria 6645
489 Ga0466957_0014121 3300044842 Bacteria 4646
490 Ga0466957_0016636 3300044842 Bacteria 4302
491 Ga0466957_0338271 3300044842 Bacteria 1019
492 Ga0466959_0130495 3300045049 Bacteria 1781
493 Ga0466958_0003025 3300045836 Bacteria 8610
494 Ga0466958_0003341 3300045836 Bacteria 8311
495 Ga0466958_0158247 3300045836 Bacteria 1430
496 Ga0466967_0000120 3300045976 Bacteria 29412
497 Ga0466967_0008120 3300045976 Bacteria 7659
498 Ga0466967_0008863 3300045976 Bacteria 7417
499 Ga0466967_0018965 3300045976 Bacteria 5518
500 Ga0466967_0024155 3300045976 Bacteria 4993
501 Ga0466967_0074657 3300045976 Bacteria 3046
502 Ga0466967_0075514 3300045976 Bacteria 3029
503 Ga0466967_0096823 3300045976 Bacteria 2692
504 Ga0466967_0116772 3300045976 Bacteria 2459
505 Ga0466967_0525671 3300045976 Bacteria 1163
506 Ga0466967_0537995 3300045976 Bacteria 1149
507 Ga0466967_0591311 3300045976 Bacteria 1095
508 Ga0495663_0002958 3300046525 Bacteria 4997
509 Ga0495621_0124415 3300046539 Bacteria 999
510 Ga0495669_0000967 3300046684 Bacteria 11988
511 Ga0495669_0079520 3300046684 Bacteria 1503
512 Ga0495669_0087688 3300046684 Bacteria 1434
513 Ga0495670_0083188 3300046691 Bacteria 1632
514 Ga0495677_0011545 3300047445 Bacteria 3230
515 Ga0495677_0058023 3300047445 Bacteria 1431
516 Ga0495685_223583 3300047447 Bacteria 600
517 Ga0496100_0213184 3300048903 Bacteria 1413
518 Ga0496100_0240365 3300048903 Bacteria 1336
519 Ga0496100_0505058 3300048903 Bacteria 932
520 Ga0496101_0273337 3300048904 Bacteria 1319
521 Ga0496101_0309000 3300048904 Bacteria 1239
522 Ga0496109_0024200 3300048912 Bacteria 5396
523 Ga0496110_0024455 3300048913 Bacteria 5148
524 Ga0496110_0125563 3300048913 Bacteria 2315
525 Ga0496112_0003652 3300048915 Bacteria 12820
526 Ga0496113_0002901 3300048916 Bacteria 10103
527 Ga0496113_0015877 3300048916 Bacteria 5189
528 Ga0496114_0088971 3300048917 Bacteria 2620
529 Ga0496115_0000395 3300048918 Bacteria 35926
530 Ga0496115_0034171 3300048918 Bacteria 4018
531 Ga0501070_0105128 3300049586 Bacteria 2334
532 Ga0501074_0303774 3300049590 Bacteria 1133
533 Ga0466962_0000637 3300061719 Bacteria 15609
534 Ga0105240_11386495
535 MRS1b_contig_2549187
536 JGI24741J21665_1001454
537 JGI24740J21852_10001251
538 JGI24739J22299_10002074
539 JGI24737J22298_10008572
540 JGI24735J21928_10005139
541 JGI24735J21928_10025251
542 JGI24735J21928_10088965
543 JGI24742J22300_10048406
544 Ga0065712_10097799
545 Ga0065715_10017052
546 Ga0070658_10057910
547 Ga0070658_10087443
548 Ga0070658_10102785
549 Ga0070658_10138691
550 Ga0070658_10191584
551 Ga0070658_10275562
552 Ga0070658_10313598
553 Ga0070658_10427610
554 Ga0070676_10001015
555 Ga0070683_100067385
556 Ga0070683_100146285
557 Ga0070683_100527593
558 Ga0070690_100560721
559 Ga0070670_100009958
560 Ga0070677_10029536
561 Ga0070666_10052568
562 Ga0070666_10190034
563 Ga0070680_100008726
564 Ga0070680_100030365
565 Ga0070680_100042796
566 Ga0070680_100107120
567 Ga0070680_100296900
568 Ga0070680_101052585
569 Ga0070680_101138202
570 Ga0070682_100002001
571 Ga0070682_100111384
572 Ga0070660_100016867
573 Ga0070660_100020181
574 Ga0070660_100032724
575 Ga0070660_100045756
576 Ga0070660_100066206
577 Ga0070660_100120250
578 Ga0070660_100232728
579 Ga0070660_100366887
580 Ga0070660_100555796
581 Ga0070660_100824710
582 Ga0070691_10029617
583 Ga0070661_100004849
584 Ga0070661_100024454
585 Ga0070661_100026968
586 Ga0070661_100028910
587 Ga0070661_100081975
588 Ga0070661_100189866
589 Ga0070661_100302602
590 Ga0070692_10116661
591 Ga0070668_100028004
592 Ga0070675_100071106
593 Ga0070671_100001670
594 Ga0070671_100041234
595 Ga0070671_100069747
596 Ga0070671_100156633
597 Ga0070671_100212563
598 Ga0070671_100408244
599 Ga0070674_100041808
600 Ga0070674_100547636
601 Ga0070673_100004100
602 Ga0070673_100035335
603 Ga0070673_100168182
604 Ga0070673_100554303
605 Ga0070659_100004595
606 Ga0070659_100041240
607 Ga0070659_100169384
608 Ga0070659_100245549
609 Ga0070659_100372816
610 Ga0070659_100400887
611 Ga0070659_100501436
612 Ga0070667_100012450
613 Ga0070667_101496675
614 Ga0070714_100136175
615 Ga0070714_100817424
616 Ga0070701_10020489
617 Ga0070700_100026256
618 Ga0070663_100009529
619 Ga0070663_100035379
620 Ga0070663_100062182
621 Ga0070663_100091900
622 Ga0070663_100095948
623 Ga0070663_100313248
624 Ga0070663_100511688
625 Ga0070663_100854156
626 Ga0070678_100139205
627 Ga0070662_100000396
628 Ga0070662_100002657
629 Ga0070662_100004619
630 Ga0070662_100005822
631 Ga0070662_100236570
632 Ga0070662_100271389
633 Ga0070662_100381797
634 Ga0070681_10015100
635 Ga0070681_10685071
636 Ga0070681_11424745
637 Ga0068867_100110364
638 Ga0068867_100218446
639 Ga0070679_100022921
640 Ga0070679_100026181
641 Ga0070679_100120023
642 Ga0070679_100201045
643 Ga0070679_100286688
644 Ga0070679_100332271
645 Ga0070679_100386622
646 Ga0070679_101071351
647 Ga0070684_100020494
648 Ga0070684_100118828
649 Ga0070684_100131113
650 Ga0068853_100013441
651 Ga0068853_100020701
652 Ga0068853_100026001
653 Ga0068853_100044596
654 Ga0068853_100045314
655 Ga0070672_100061072
656 Ga0070693_100099805
657 Ga0068855_100052677
658 Ga0068855_100064983
659 Ga0068855_100124380
660 Ga0068855_100160416
661 Ga0068855_100214492
662 Ga0068855_100382151
663 Ga0068855_100680448
664 Ga0070664_100015912
665 Ga0070664_100016226
666 Ga0070664_100048581
667 Ga0070664_100064902
668 Ga0070664_100163878
669 Ga0070664_100396415
670 Ga0070664_101381791
671 Ga0068857_100019479
672 Ga0068857_100020085
673 Ga0068857_100025043
674 Ga0068854_100059774
675 Ga0068854_100120971
676 Ga0068854_100268810
677 Ga0068854_100954466
678 Ga0068856_100158391
679 Ga0068856_100488881
680 Ga0068856_100692593
681 Ga0068852_100008231
682 Ga0068852_100027268
683 Ga0068852_100056106
684 Ga0068852_100124681
685 Ga0068852_100254372
686 Ga0068852_100470043
687 Ga0068852_100910695
688 Ga0068852_101000144
689 Ga0068852_101194924
690 Ga0068852_102312513
691 Ga0068859_101038127
692 Ga0068864_100005796
693 Ga0068864_100095624
694 Ga0068864_100546546
695 Ga0068864_100640843
696 Ga0068861_100035949
697 Ga0068851_10004163
698 Ga0068851_10012109
699 Ga0068851_10015067
700 Ga0068863_100080750
701 Ga0068860_100470955
702 Ga0068860_100579521
703 Ga0068860_101017152
704 Ga0068862_100013226
705 Ga0075429_101071324
706 Ga0068865_100531836
707 Ga0097620_101038073
708 Ga0105240_10069742
709 Ga0105240_11806302
710 Ga0105243_10174602
711 Ga0105241_10138353
712 Ga0105241_10358256
713 Ga0105248_10025398
714 Ga0105248_10043584
715 Ga0105248_10203118
716 Ga0105237_10013373
717 Ga0105237_10119913
718 Ga0105238_10478713
719 Ga0105249_10015106
720 Ga0105249_10388068
721 Ga0105239_10159702
722 Ga0105239_10652386
723 Ga0157373_10010324
724 Ga0157373_10064912
725 Ga0157373_10078555
726 Ga0157373_10144481
727 Ga0157373_10192782
728 Ga0157373_10292020
729 Ga0157371_10018199
730 Ga0157371_10032646
731 Ga0157371_10106275
732 Ga0157371_10123636
733 Ga0157371_10167551
734 Ga0157371_10270709
735 Ga0157371_10791341
736 Ga0157371_10947526
737 Ga0157370_10016460
738 Ga0157370_10097304
739 Ga0157370_10148058
740 Ga0157370_10178695
741 Ga0157369_10048561
742 Ga0157369_10096812
743 Ga0157369_10104866
744 Ga0157369_10407902
745 Ga0157369_10695601
746 Ga0157374_10069326
747 Ga0157372_10009904
748 Ga0157372_10039833
749 Ga0157372_10127285
750 Ga0157372_10568365
751 Ga0157372_10650525
752 Ga0157372_10821347
753 Ga0157372_11045000
754 Ga0157380_10007408
755 Ga0163161_10043910
756 Ga0206354_11013178
757 Ga0206353_11002623
758 Ga0206353_12024388
759 Ga0207666_1024645
760 Ga0207673_1004025
761 Ga0207697_10003320
762 Ga0207656_10015720
763 Ga0207656_10172487
764 Ga0207682_10002133
765 Ga0207680_10333792
766 Ga0207680_10455939
767 Ga0207647_10098108
768 Ga0207647_10125571
769 Ga0207645_10002195
770 Ga0207645_10008148
771 Ga0207643_10630337
772 Ga0207705_10006164
773 Ga0207705_10007414
774 Ga0207705_10010605
775 Ga0207705_10013910
776 Ga0207705_10016143
777 Ga0207705_10019648
778 Ga0207705_10083012
779 Ga0207705_10100570
780 Ga0207705_10126966
781 Ga0207705_10917255
782 Ga0207707_10018268
783 Ga0207707_10079451
784 Ga0207707_10626623
785 Ga0207707_10928197
786 Ga0207707_11128807
787 Ga0207695_10006228
788 Ga0207695_10016672
789 Ga0207695_10088765
790 Ga0207671_10010252
791 Ga0207660_10000864
792 Ga0207660_10002538
793 Ga0207660_10180602
794 Ga0207657_10001115
795 Ga0207657_10010311
796 Ga0207657_10016405
797 Ga0207657_10028965
798 Ga0207657_10035426
799 Ga0207657_10088353
800 Ga0207657_10117709
801 Ga0207657_10160173
802 Ga0207657_10379721
803 Ga0207649_10003421
804 Ga0207649_10043446
805 Ga0207649_10165051
806 Ga0207649_10272871
807 Ga0207652_10012378
808 Ga0207652_10017127
809 Ga0207652_10064045
810 Ga0207652_10145693
811 Ga0207652_10181346
812 Ga0207652_10350961
813 Ga0207652_10396347
814 Ga0207652_10566593
815 Ga0207652_10766044
816 Ga0207681_10042898
817 Ga0207694_10001718
818 Ga0207650_10004942
819 Ga0207650_10013803
820 Ga0207659_10000660
821 Ga0207644_10005099
822 Ga0207644_10018932
823 Ga0207644_10047439
824 Ga0207644_10331035
825 Ga0207644_10441536
826 Ga0207690_10000709
827 Ga0207690_10002599
828 Ga0207690_10031558
829 Ga0207690_10067933
830 Ga0207690_10088240
831 Ga0207690_11047369
832 Ga0207690_11154743
833 Ga0207706_10000746
834 Ga0207706_10000914
835 Ga0207706_10006280
836 Ga0207706_10027342
837 Ga0207706_10096542
838 Ga0207706_10109665
839 Ga0207706_10375171
840 Ga0207706_10463316
841 Ga0207706_11025841
842 Ga0207691_10001753
843 Ga0207691_10058669
844 Ga0207711_10004825
845 Ga0207711_10005374
846 Ga0207661_10008542
847 Ga0207661_10013895
848 Ga0207661_10026353
849 Ga0207679_10010212
850 Ga0207679_10099077
851 Ga0207679_10128115
852 Ga0207667_10014131
853 Ga0207667_10017621
854 Ga0207667_10049742
855 Ga0207667_10085815
856 Ga0207667_10230110
857 Ga0207667_10305222
858 Ga0207667_10354661
859 Ga0207667_10616476
860 Ga0207667_11451507
861 Ga0207651_10681878
862 Ga0207651_10849135
863 Ga0207712_10045044
864 Ga0207712_10074360
865 Ga0207668_10064353
866 Ga0207640_10012192
867 Ga0207640_10114777
868 Ga0207640_10388105
869 Ga0207640_10438533
870 Ga0207640_10627412
871 Ga0207658_10306834
872 Ga0207658_11289339
873 Ga0207639_10001105
874 Ga0207639_10012560
875 Ga0207639_10019373
876 Ga0207639_10093937
877 Ga0207639_10153502
878 Ga0207639_10333723
879 Ga0207678_10001718
880 Ga0207678_10019915
881 Ga0207678_10031462
882 Ga0207678_10032282
883 Ga0207678_10079689
884 Ga0207678_10149761
885 Ga0207678_10497197
886 Ga0207678_10666398
887 Ga0207708_10199033
888 Ga0207702_10157185
889 Ga0207702_10603333
890 Ga0207702_11194277
891 Ga0207676_10057336
892 Ga0207676_10173147
893 Ga0207676_10406595
894 Ga0207676_10827526
895 Ga0207674_10006239
896 Ga0207674_10015766
897 Ga0207674_10264311
898 Ga0207674_10344503
899 Ga0207674_11619248
900 Ga0207675_100017757
901 Ga0207683_10229031
902 Ga0207698_10001191
903 Ga0207698_10002465
904 Ga0207698_10005372
905 Ga0207698_10026687
906 Ga0207698_10031443
907 Ga0207698_10240536
908 Ga0207698_11134226
909 Ga0207698_11149659
910 Ga0207698_11272186
911 Ga0268265_10089402
912 Ga0268264_10261253
913 Ga0268264_10404827
914 Ga0307408_100308977
915 Ga0307405_10066463
916 Ga0307405_10503147
917 Ga0307413_10000673
918 Ga0307413_10292852
919 Ga0307410_10000425
920 Ga0307410_10014284
921 Ga0307410_10125280
922 Ga0307406_10084853
923 Ga0307406_10359794
924 Ga0307407_10004841
925 Ga0307407_10034533
926 Ga0307412_10360155
927 Ga0307412_10720063
928 Ga0307409_100021775
929 Ga0307409_100096653
930 Ga0307409_100105170
931 Ga0307409_100286532
932 Ga0307416_100091302
933 Ga0307416_100091432
934 Ga0307414_10006663
935 Ga0307414_10035744
936 Ga0307414_10239751
937 Ga0307414_10405975
938 Ga0307414_10907769
939 Ga0307411_10014684
940 Ga0307411_10015911
941 Ga0307411_10103300
942 Ga0307411_10117087
943 Ga0307411_10172011
944 Ga0307411_10184338
945 Ga0307411_10231055
946 Ga0307411_10313709
947 Ga0307411_10769385
948 Ga0307415_100001430
949 Ga0307415_100305105
950 Ga0307415_100320738
951 Ga0307415_100453670
952 Ga0307415_100560554
953 Ga0395899_0011333
954 Ga0395899_0011406
955 Ga0395899_0023219
956 Ga0395899_0060849
957 Ga0395899_0086067
958 Ga0395899_0097230
959 Ga0395899_0109844
960 Ga0395899_0207909
961 Ga0395900_0002464
962 Ga0395900_0003622
963 Ga0395900_0018873
964 Ga0395900_0027587
965 Ga0395900_0181067
966 Ga0395900_0318027
967 Ga0395900_0342337
968 Ga0395900_0406007
969 Ga0395900_0436886
970 Ga0395900_0744766
971 Ga0395900_1329832
972 Ga0395898_0006331
973 Ga0395898_0019094
974 Ga0395898_0024038
975 Ga0395898_0108209
976 Ga0395898_0168712
977 Ga0395898_0194809
978 Ga0395898_0214658
979 Ga0395898_0604613
980 Ga0395905_0014002
981 Ga0395905_0062359
982 Ga0395905_0069276
983 Ga0395905_0129160
984 Ga0395905_0132641
985 Ga0395905_0173248
986 Ga0395905_0288459
987 Ga0395905_0385440
988 Ga0395905_0474907
989 Ga0395905_0583416
990 Ga0395905_0786654
991 Ga0395905_1333375
992 Ga0395901_0000589
993 Ga0395901_0032051
994 Ga0395901_0062247
995 Ga0395901_0088323
996 Ga0395901_0121098
997 Ga0395901_0130732
998 Ga0395901_0196426
999 Ga0395901_0216853
1000 Ga0395901_0423107
1001 Ga0436365_0438315
1002 Ga0450912_003820
1003 Ga0450920_034776
1004 Ga0466966_0309693
1005 Ga0466961_0017090
1006 Ga0466961_0115534
1007 Ga0466963_0000058
1008 Ga0466963_0004423
1009 Ga0466963_0017068
1010 Ga0466963_0034486
1011 Ga0466963_0124191
1012 Ga0466963_0128659
1013 Ga0466963_0171979
1014 Ga0466963_0183889
1015 Ga0466964_0122035
1016 Ga0453684_0562431
1017 Ga0466971_0002898
1018 Ga0466971_0089069
1019 Ga0466971_0147945
1020 Ga0466971_0154048
1021 Ga0466957_0006412
1022 Ga0466957_0014121
1023 Ga0466957_0016636
1024 Ga0466957_0338271
1025 Ga0466959_0130495
1026 Ga0466958_0003025
1027 Ga0466958_0003341
1028 Ga0466958_0158247
1029 Ga0466967_0000120
1030 Ga0466967_0008120
1031 Ga0466967_0008863
1032 Ga0466967_0018965
1033 Ga0466967_0024155
1034 Ga0466967_0074657
1035 Ga0466967_0075514
1036 Ga0466967_0096823
1037 Ga0466967_0116772
1038 Ga0466967_0525671
1039 Ga0466967_0537995
1040 Ga0466967_0591311
1041 Ga0495663_0002958
1042 Ga0495621_0124415
1043 Ga0495669_0000967
1044 Ga0495669_0079520
1045 Ga0495669_0087688
1046 Ga0495670_0083188
1047 Ga0495677_0011545
1048 Ga0495677_0058023
1049 Ga0495685_223583
1050 Ga0496100_0213184
1051 Ga0496100_0240365
1052 Ga0496100_0505058
1053 Ga0496101_0273337
1054 Ga0496101_0309000
1055 Ga0496109_0024200
1056 Ga0496110_0024455
1057 Ga0496110_0125563
1058 Ga0496112_0003652
1059 Ga0496113_0002901
1060 Ga0496113_0015877
1061 Ga0496114_0088971
1062 Ga0496115_0000395
1063 Ga0496115_0034171
1064 Ga0501070_0105128
1065 Ga0501074_0303774
1066 Ga0466962_0000637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ow5-assembly1.cif.gz_A crystal structure of the y200a mutant of gamma carbonic anhydrase from methanosarcina thermophila 0.9125 9 88
3kwc-assembly1.cif.gz_B oxidized, active structure of the beta-carboxysomal gamma-carbonic anhydrase, ccmm 0.8905 9 97
7o4z-assembly1.cif.gz_A crystal structure of the carbonic anhydrase-like domain of ccmm from synechococcus elongatus (strain pcc 7942) 0.8829 11 88
7d6c-assembly1.cif.gz_4 crystal structure of ccmm n-terminal domain in complex with ccmn 0.8578 11 97
6ive-assembly1.cif.gz_B molecular structure of a thermostable and a zinc ion binding gamma-class carbonic anhydrase 0.8393 3 118
ID Description Score Start End Superfamily
af_F1QSV4_111_509_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8879 11 65 3.90.550.10
af_P76100_221_315_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8461 8 92 2.160.10.10
6iveA00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8373 2 118 2.160.10.10
1qrfA00 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.7768 9 93 2.160.10.10
af_Q54JC2_42_221_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.7533 3 126 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A3D2DAC1-F1-model_v4 deleted 0.9898 3 79
AF-A0A6J6E949-F1-model_v4 Unannotated protein 0.9865 1 94
AF-A0A524MPY1-F1-model_v4 Gamma carbonic anhydrase family protein 0.9849 1 92
AF-A0A3T1DWU8-F1-model_v4 deleted 0.9842 1 98
AF-A0A1V6IGY1-F1-model_v4 Carnitine operon protein CaiE 0.9842 3 91

Map