F460387

General Info

Members Datasets Scaffolds Average Seq Length
533 234 1066 154

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100244821|Ga0070712_1002448212
Length 171
Sequence VSAAGSSEGPIAAGTPVPEFTLEREDGSKFTRADLEGQTTVLVFYPFAFSPVCTDQIGLYEDVLSDYLAKRGATMYGVSCDARWSQTAFREKLGVSIAQLSDFEPKGATCRAFGVYHPGGFPQRALVIVGPDGVVAWSYQAPAVTDLPGANLIFDGLDAVTAGSAATGSAA

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
178 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
181 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 9.38
Rhizosphere 80.86
Stem 0
Stem Tuber 0
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100244821 3300006175 Bacteria 1430
2 LJQas_1014381 3300000549 Bacteria 930
3 JGI24746J21847_1010194 3300001977 Bacteria 1393
4 JGI24745J21846_1004174 3300002073 Bacteria 1538
5 JGI24744J21845_10018620 3300002077 Bacteria 1376
6 JGI24033J26618_1027963 3300002155 Bacteria 748
7 JGI25406J46586_10014968 3300003203 Bacteria 3283
8 Ga0070658_10351594 3300005327 Bacteria 1261
9 Ga0070658_10580799 3300005327 Bacteria 971
10 Ga0070676_10205860 3300005328 Bacteria 1292
11 Ga0070683_100064098 3300005329 Bacteria 3420
12 Ga0070683_100421741 3300005329 Bacteria 1273
13 Ga0070683_100443599 3300005329 Bacteria 1238
14 Ga0070683_100606393 3300005329 Bacteria 1048
15 Ga0070683_100806274 3300005329 Bacteria 900
16 Ga0070690_100332822 3300005330 Bacteria 1098
17 Ga0070670_100511293 3300005331 Bacteria 1069
18 Ga0070670_100640597 3300005331 Bacteria 953
19 Ga0068869_100055918 3300005334 Bacteria 2877
20 Ga0068869_100658246 3300005334 Bacteria 890
21 Ga0070682_100030385 3300005337 Bacteria 3260
22 Ga0070682_100201279 3300005337 Bacteria 1405
23 Ga0070682_100387127 3300005337 Bacteria 1054
24 Ga0068868_100003558 3300005338 Bacteria 10851
25 Ga0068868_100075192 3300005338 Bacteria 2699
26 Ga0068868_100134995 3300005338 Bacteria 2022
27 Ga0068868_100194105 3300005338 Bacteria 1689
28 Ga0068868_100375720 3300005338 Bacteria 1222
29 Ga0070660_100078774 3300005339 Bacteria 2584
30 Ga0070660_100157930 3300005339 Bacteria 1826
31 Ga0070660_100267741 3300005339 Bacteria 1396
32 Ga0070689_100378819 3300005340 Bacteria 1192
33 Ga0070691_10191256 3300005341 Bacteria 1071
34 Ga0070692_10394959 3300005345 Bacteria 871
35 Ga0070668_100019464 3300005347 Bacteria 5109
36 Ga0070668_100136276 3300005347 Bacteria 1975
37 Ga0070668_100398296 3300005347 Bacteria 1175
38 Ga0070669_100833138 3300005353 Bacteria 785
39 Ga0070675_100023251 3300005354 Bacteria 4954
40 Ga0070674_100794691 3300005356 Bacteria 817
41 Ga0070673_100964198 3300005364 Bacteria 793
42 Ga0070673_101015731 3300005364 Bacteria 773
43 Ga0070673_101422699 3300005364 Bacteria 653
44 Ga0070688_100773960 3300005365 Bacteria 749
45 Ga0070659_100032885 3300005366 Bacteria 4026
46 Ga0070659_100662074 3300005366 Bacteria 901
47 Ga0070659_101307946 3300005366 Unclassified 643
48 Ga0070714_100082902 3300005435 Bacteria 2795
49 Ga0070713_100391599 3300005436 Bacteria 1296
50 Ga0070713_100784349 3300005436 Bacteria 913
51 Ga0070713_101353857 3300005436 Bacteria 690
52 Ga0070701_10022842 3300005438 Bacteria 3004
53 Ga0070701_10883812 3300005438 Bacteria 616
54 Ga0070711_100031264 3300005439 Bacteria 3533
55 Ga0070711_100069462 3300005439 Bacteria 2478
56 Ga0070711_100677480 3300005439 Bacteria 867
57 Ga0070705_100992652 3300005440 Bacteria 681
58 Ga0070700_100002452 3300005441 Bacteria 9431
59 Ga0070700_100399857 3300005441 Bacteria 1032
60 Ga0070700_100741983 3300005441 Bacteria 785
61 Ga0070663_100167131 3300005455 Bacteria 1698
62 Ga0070678_100035890 3300005456 Bacteria 3465
63 Ga0070678_100747119 3300005456 Bacteria 885
64 Ga0070662_100057076 3300005457 Bacteria 2836
65 Ga0070681_10320777 3300005458 Bacteria 1459
66 Ga0068867_100184518 3300005459 Bacteria 1661
67 Ga0070685_10018245 3300005466 Bacteria 3770
68 Ga0070685_10041645 3300005466 Bacteria 2618
69 Ga0070685_10229358 3300005466 Bacteria 1220
70 Ga0070684_100035034 3300005535 Bacteria 4294
71 Ga0070684_100038148 3300005535 Bacteria 4125
72 Ga0070684_100253775 3300005535 Bacteria 1608
73 Ga0070684_101423199 3300005535 Bacteria 653
74 Ga0068853_100510967 3300005539 Bacteria 1135
75 Ga0070693_100059942 3300005547 Bacteria 2208
76 Ga0070693_100297385 3300005547 Bacteria 1087
77 Ga0070693_100645552 3300005547 Bacteria 769
78 Ga0070693_100691348 3300005547 Bacteria 746
79 Ga0070693_101085435 3300005547 Bacteria 610
80 Ga0070665_100203919 3300005548 Bacteria 1978
81 Ga0070665_100421961 3300005548 Bacteria 1343
82 Ga0070704_100045680 3300005549 Bacteria 3049
83 Ga0068855_100592779 3300005563 Bacteria 1196
84 Ga0070664_100006882 3300005564 Bacteria 9167
85 Ga0070664_100033731 3300005564 Bacteria 4290
86 Ga0070664_100178251 3300005564 Bacteria 1888
87 Ga0070664_100181929 3300005564 Bacteria 1868
88 Ga0070664_100968711 3300005564 Unclassified 799
89 Ga0068857_100633149 3300005577 Bacteria 1013
90 Ga0068857_100644497 3300005577 Bacteria 1004
91 Ga0068854_100085144 3300005578 Bacteria 2341
92 Ga0068856_100013803 3300005614 Bacteria 7809
93 Ga0068856_100308254 3300005614 Bacteria 1601
94 Ga0068856_100337914 3300005614 Bacteria 1524
95 Ga0068856_100359706 3300005614 Bacteria 1474
96 Ga0068856_100629229 3300005614 Bacteria 1094
97 Ga0070702_100087350 3300005615 Bacteria 1883
98 Ga0070702_100453641 3300005615 Bacteria 931
99 Ga0068852_100036739 3300005616 Bacteria 4102
100 Ga0068852_100460137 3300005616 Bacteria 1261
101 Ga0068859_100640950 3300005617 Bacteria 1155
102 Ga0068864_100044364 3300005618 Bacteria 3810
103 Ga0068864_100113020 3300005618 Bacteria 2421
104 Ga0068864_100391153 3300005618 Bacteria 1320
105 Ga0068866_10336179 3300005718 Bacteria 955
106 Ga0068866_10594657 3300005718 Bacteria 746
107 Ga0068861_100020556 3300005719 Bacteria 4732
108 Ga0068851_10467662 3300005834 Bacteria 752
109 Ga0068870_10777905 3300005840 Bacteria 667
110 Ga0068863_100492100 3300005841 Bacteria 1207
111 Ga0068858_100063690 3300005842 Bacteria 3411
112 Ga0068858_100382278 3300005842 Bacteria 1351
113 Ga0068862_101053050 3300005844 Bacteria 807
114 Ga0068862_101375858 3300005844 Bacteria 709
115 Ga0081539_10001679 3300005985 Bacteria 35825
116 Ga0081539_10191578 3300005985 Bacteria 951
117 Ga0070717_10360652 3300006028 Bacteria 1301
118 Ga0075365_10565998 3300006038 Bacteria 804
119 Ga0075363_100471657 3300006048 Bacteria 743
120 Ga0075432_10177368 3300006058 Bacteria 832
121 Ga0070712_100010865 3300006175 Bacteria 5758
122 Ga0070712_100183886 3300006175 Bacteria 1631
123 Ga0070712_100658641 3300006175 Bacteria 890
124 Ga0075428_100111227 3300006844 Bacteria 2984
125 Ga0075428_100692700 3300006844 Bacteria 1086
126 Ga0075433_10395357 3300006852 Bacteria 1220
127 Ga0075433_10805524 3300006852 Bacteria 821
128 Ga0075433_11105396 3300006852 Bacteria 689
129 Ga0075434_100821888 3300006871 Bacteria 945
130 Ga0075429_100085003 3300006880 Bacteria 2758
131 Ga0068865_100125825 3300006881 Bacteria 1913
132 Ga0068865_100492454 3300006881 Bacteria 1021
133 Ga0075436_100028173 3300006914 Bacteria 3864
134 Ga0097620_100640977 3300006931 Bacteria 1155
135 Ga0075435_100103647 3300007076 Bacteria 2360
136 Ga0075435_100640167 3300007076 Bacteria 923
137 Ga0075435_101439621 3300007076 Bacteria 604
138 Ga0105250_10396124 3300009092 Bacteria 612
139 Ga0111539_10045073 3300009094 Bacteria 5280
140 Ga0111539_10268780 3300009094 Bacteria 1985
141 Ga0111539_10405194 3300009094 Bacteria 1588
142 Ga0111539_10695599 3300009094 Bacteria 1183
143 Ga0111539_10971478 3300009094 Bacteria 987
144 Ga0105245_10006719 3300009098 Bacteria 10090
145 Ga0105245_10085861 3300009098 Bacteria 2885
146 Ga0105245_10200762 3300009098 Bacteria 1915
147 Ga0105245_10295722 3300009098 Bacteria 1587
148 Ga0105245_10816358 3300009098 Bacteria 971
149 Ga0105245_11688884 3300009098 Bacteria 685
150 Ga0105243_10022176 3300009148 Bacteria 4825
151 Ga0105243_10171232 3300009148 Bacteria 1881
152 Ga0105243_10283316 3300009148 Bacteria 1494
153 Ga0105243_11822981 3300009148 Unclassified 640
154 Ga0105241_10690628 3300009174 Bacteria 931
155 Ga0105241_10978760 3300009174 Bacteria 790
156 Ga0105242_10239455 3300009176 Bacteria 1630
157 Ga0105242_10513830 3300009176 Bacteria 1141
158 Ga0105242_10791092 3300009176 Bacteria 938
159 Ga0105248_10190063 3300009177 Bacteria 2314
160 Ga0105248_10636297 3300009177 Bacteria 1203
161 Ga0105237_10173928 3300009545 Bacteria 2153
162 Ga0105237_11341185 3300009545 Bacteria 722
163 Ga0105249_10035662 3300009553 Bacteria 4510
164 Ga0105249_10240170 3300009553 Bacteria 1791
165 Ga0105239_10013492 3300010375 Bacteria 9072
166 Ga0105239_10093145 3300010375 Bacteria 3326
167 Ga0105239_10429424 3300010375 Bacteria 1497
168 Ga0105246_10056603 3300011119 Bacteria 2711
169 Ga0105246_10229542 3300011119 Bacteria 1461
170 Ga0105246_10595536 3300011119 Bacteria 954
171 Ga0157371_10159193 3300013102 Bacteria 1612
172 Ga0157371_10792201 3300013102 Bacteria 714
173 Ga0157369_10569314 3300013105 Bacteria 1170
174 Ga0157369_10651902 3300013105 Bacteria 1086
175 Ga0157374_10014828 3300013296 Bacteria 6828
176 Ga0157378_10026124 3300013297 Bacteria 5148
177 Ga0157378_10380479 3300013297 Bacteria 1386
178 Ga0157378_11050741 3300013297 Bacteria 850
179 Ga0163162_10144339 3300013306 Bacteria 2495
180 Ga0163162_10223759 3300013306 Bacteria 2011
181 Ga0163162_12792467 3300013306 Bacteria 562
182 Ga0157372_10044048 3300013307 Bacteria 4944
183 Ga0157372_11504322 3300013307 Bacteria 775
184 Ga0157375_10014942 3300013308 Bacteria 6941
185 Ga0163163_10280342 3300014325 Bacteria 1718
186 Ga0163163_10373189 3300014325 Bacteria 1484
187 Ga0157380_10191407 3300014326 Bacteria 1806
188 Ga0157380_10582552 3300014326 Bacteria 1104
189 Ga0157380_10786969 3300014326 Bacteria 967
190 Ga0157380_10982571 3300014326 Bacteria 876
191 Ga0157377_10003239 3300014745 Bacteria 7352
192 Ga0157377_10828658 3300014745 Bacteria 685
193 Ga0157379_10003495 3300014968 Bacteria 13314
194 Ga0157379_10766212 3300014968 Bacteria 909
195 Ga0157376_10146644 3300014969 Bacteria 2123
196 Ga0206354_11277094 3300020081 Bacteria 1152
197 Ga0213874_10004936 3300021377 Bacteria 3083
198 Ga0213874_10039915 3300021377 Bacteria 1400
199 Ga0213874_10062687 3300021377 Bacteria 1168
200 Ga0213874_10120138 3300021377 Bacteria 892
201 Ga0213876_10033431 3300021384 Bacteria 2712
202 Ga0213876_10077971 3300021384 Bacteria 1750
203 Ga0213876_10081823 3300021384 Bacteria 1708
204 Ga0213876_10098008 3300021384 Bacteria 1553
205 Ga0213876_10451156 3300021384 Bacteria 684
206 Ga0213875_10011653 3300021388 Bacteria 4368
207 Ga0213875_10012795 3300021388 Bacteria 4134
208 Ga0213875_10031677 3300021388 Bacteria 2500
209 Ga0213875_10131597 3300021388 Bacteria 1170
210 Ga0213875_10155187 3300021388 Bacteria 1073
211 Ga0207656_10214472 3300025321 Bacteria 934
212 Ga0207642_10235877 3300025899 Bacteria 1030
213 Ga0207642_10268251 3300025899 Bacteria 976
214 Ga0207642_10545506 3300025899 Bacteria 715
215 Ga0207710_10156513 3300025900 Bacteria 1108
216 Ga0207688_10001974 3300025901 Bacteria 10996
217 Ga0207688_10187021 3300025901 Bacteria 1237
218 Ga0207647_10371524 3300025904 Bacteria 808
219 Ga0207645_10297260 3300025907 Bacteria 1075
220 Ga0207643_10739547 3300025908 Bacteria 636
221 Ga0207643_10743166 3300025908 Bacteria 635
222 Ga0207705_10084173 3300025909 Bacteria 2322
223 Ga0207705_10556654 3300025909 Bacteria 891
224 Ga0207654_10295187 3300025911 Bacteria 1100
225 Ga0207671_10460623 3300025914 Bacteria 1013
226 Ga0207671_10685887 3300025914 Bacteria 815
227 Ga0207693_10154336 3300025915 Bacteria 1806
228 Ga0207693_10230867 3300025915 Bacteria 1453
229 Ga0207693_10289758 3300025915 Bacteria 1283
230 Ga0207693_10423326 3300025915 Bacteria 1041
231 Ga0207693_10481479 3300025915 Bacteria 969
232 Ga0207663_10000267 3300025916 Bacteria 22666
233 Ga0207663_10023132 3300025916 Bacteria 3562
234 Ga0207663_10215698 3300025916 Bacteria 1394
235 Ga0207663_10507244 3300025916 Bacteria 938
236 Ga0207662_10041131 3300025918 Bacteria 2720
237 Ga0207657_10009056 3300025919 Bacteria 10052
238 Ga0207657_10129066 3300025919 Bacteria 2074
239 Ga0207657_10196177 3300025919 Bacteria 1626
240 Ga0207657_10372222 3300025919 Bacteria 1125
241 Ga0207657_10544345 3300025919 Bacteria 908
242 Ga0207649_10101799 3300025920 Bacteria 1903
243 Ga0207649_11050776 3300025920 Unclassified 642
244 Ga0207649_11270679 3300025920 Bacteria 582
245 Ga0207652_10067744 3300025921 Bacteria 3096
246 Ga0207652_10693324 3300025921 Bacteria 909
247 Ga0207650_11362978 3300025925 Bacteria 604
248 Ga0207659_10016436 3300025926 Bacteria 4816
249 Ga0207659_10048536 3300025926 Bacteria 3008
250 Ga0207687_10152637 3300025927 Bacteria 1764
251 Ga0207687_10364531 3300025927 Bacteria 1180
252 Ga0207687_10839814 3300025927 Unclassified 784
253 Ga0207700_10587786 3300025928 Bacteria 990
254 Ga0207664_11290391 3300025929 Bacteria 649
255 Ga0207644_10063956 3300025931 Bacteria 2673
256 Ga0207690_10032864 3300025932 Bacteria 3332
257 Ga0207690_10866193 3300025932 Unclassified 748
258 Ga0207690_11154117 3300025932 Bacteria 646
259 Ga0207706_10021161 3300025933 Bacteria 5845
260 Ga0207686_10088870 3300025934 Bacteria 2035
261 Ga0207686_10265481 3300025934 Bacteria 1260
262 Ga0207686_10498076 3300025934 Bacteria 945
263 Ga0207709_10183056 3300025935 Bacteria 1481
264 Ga0207709_11135326 3300025935 Unclassified 642
265 Ga0207670_10142260 3300025936 Bacteria 1770
266 Ga0207670_10225349 3300025936 Bacteria 1437
267 Ga0207711_10581151 3300025941 Bacteria 1045
268 Ga0207689_10038186 3300025942 Bacteria 3979
269 Ga0207689_10877990 3300025942 Bacteria 757
270 Ga0207661_10006453 3300025944 Bacteria 8293
271 Ga0207661_10191990 3300025944 Bacteria 1791
272 Ga0207661_10324055 3300025944 Bacteria 1386
273 Ga0207661_10565452 3300025944 Bacteria 1042
274 Ga0207661_10580694 3300025944 Bacteria 1028
275 Ga0207661_11576980 3300025944 Bacteria 601
276 Ga0207679_10009192 3300025945 Bacteria 6318
277 Ga0207679_10450063 3300025945 Bacteria 1142
278 Ga0207679_11138379 3300025945 Bacteria 716
279 Ga0207667_10097738 3300025949 Bacteria 3030
280 Ga0207651_10163807 3300025960 Bacteria 1746
281 Ga0207651_11064178 3300025960 Bacteria 724
282 Ga0207651_11258638 3300025960 Bacteria 665
283 Ga0207668_10230101 3300025972 Bacteria 1494
284 Ga0207640_10125762 3300025981 Bacteria 1845
285 Ga0207640_11025340 3300025981 Bacteria 727
286 Ga0207677_10008111 3300026023 Bacteria 5847
287 Ga0207677_10051985 3300026023 Bacteria 2781
288 Ga0207677_10200914 3300026023 Bacteria 1584
289 Ga0207677_10976258 3300026023 Bacteria 767
290 Ga0207703_10408076 3300026035 Bacteria 1262
291 Ga0207703_10675467 3300026035 Bacteria 981
292 Ga0207639_10347513 3300026041 Bacteria 1324
293 Ga0207678_10097720 3300026067 Bacteria 2509
294 Ga0207678_10674391 3300026067 Bacteria 909
295 Ga0207708_10000450 3300026075 Bacteria 31989
296 Ga0207708_10384118 3300026075 Bacteria 1158
297 Ga0207702_10116909 3300026078 Bacteria 2381
298 Ga0207702_10309139 3300026078 Bacteria 1502
299 Ga0207702_10315446 3300026078 Bacteria 1487
300 Ga0207702_10820867 3300026078 Unclassified 920
301 Ga0207641_10131837 3300026088 Bacteria 2245
302 Ga0207648_10669698 3300026089 Bacteria 960
303 Ga0207676_10066318 3300026095 Bacteria 2878
304 Ga0207676_10216928 3300026095 Bacteria 1701
305 Ga0207676_10603220 3300026095 Bacteria 1055
306 Ga0207674_10152588 3300026116 Bacteria 2267
307 Ga0207674_10515481 3300026116 Bacteria 1155
308 Ga0207675_100057961 3300026118 Bacteria 3615
309 Ga0207675_100201659 3300026118 Bacteria 1911
310 Ga0207675_100984754 3300026118 Bacteria 861
311 Ga0207683_10108798 3300026121 Bacteria 2480
312 Ga0207683_10208783 3300026121 Bacteria 1777
313 Ga0207683_10427715 3300026121 Bacteria 1220
314 Ga0207698_10039075 3300026142 Bacteria 3513
315 Ga0207698_10062560 3300026142 Bacteria 2907
316 Ga0207698_10364902 3300026142 Bacteria 1369
317 Ga0207428_10075352 3300027907 Bacteria 2644
318 Ga0207428_10102750 3300027907 Bacteria 2207
319 Ga0207428_10272071 3300027907 Bacteria 1259
320 Ga0268266_10045365 3300028379 Bacteria 3761
321 Ga0268266_10429392 3300028379 Bacteria 1253
322 Ga0268265_10400974 3300028380 Bacteria 1268
323 Ga0268265_10681612 3300028380 Bacteria 991
324 Ga0268265_11727051 3300028380 Bacteria 632
325 Ga0265319_1003236 3300028563 Bacteria 8568
326 Ga0265318_10001862 3300028577 Bacteria 11881
327 Ga0265338_10062728 3300028800 Bacteria 3246
328 Ga0265320_10026940 3300031240 Bacteria 3003
329 Ga0265320_10255686 3300031240 Bacteria 776
330 Ga0265314_10033310 3300031711 Bacteria 3781
331 Ga0307405_10587664 3300031731 Bacteria 907
332 Ga0307405_11750269 3300031731 Bacteria 552
333 Ga0307413_10433382 3300031824 Bacteria 1039
334 Ga0307413_10594853 3300031824 Bacteria 904
335 Ga0307406_10710781 3300031901 Bacteria 840
336 Ga0307407_10111408 3300031903 Bacteria 1719
337 Ga0307407_10391633 3300031903 Bacteria 995
338 Ga0307407_10732016 3300031903 Bacteria 747
339 Ga0307409_100082529 3300031995 Bacteria 2602
340 Ga0307416_100192609 3300032002 Bacteria 1925
341 Ga0307416_100225475 3300032002 Bacteria 1802
342 Ga0307414_10191933 3300032004 Bacteria 1654
343 Ga0307411_10610755 3300032005 Bacteria 939
344 Ga0307415_100904351 3300032126 Bacteria 814
345 Ga0307415_101034050 3300032126 Bacteria 765
346 Ga0307415_101337770 3300032126 Bacteria 680
347 Ga0307415_102015781 3300032126 Bacteria 562
348 Ga0373949_0146711 3300035090 Bacteria 680
349 Ga0373952_0146489 3300035092 Bacteria 660
350 Ga0316574_0049742 3300035398 Bacteria 2607
351 Ga0395900_0015410 3300037418 Bacteria 7792
352 Ga0395898_0035474 3300037466 Bacteria 4958
353 Ga0395898_0495643 3300037466 Bacteria 1162
354 Ga0395898_0984883 3300037466 Bacteria 779
355 Ga0395905_1164024 3300037471 Bacteria 675
356 Ga0436364_0073806 3300037853 Bacteria 1759
357 Ga0436364_0437630 3300037853 Bacteria 2470
358 Ga0436364_0452123 3300037853 Bacteria 5679
359 Ga0436364_0816068 3300037853 Bacteria 21185
360 Ga0436364_1005459 3300037853 Bacteria 718
361 Ga0436364_1218417 3300037853 Unclassified 790
362 Ga0436364_1258262 3300037853 Bacteria 7848
363 Ga0436364_1336860 3300037853 Bacteria 8958
364 Ga0436364_1401499 3300037853 Bacteria 1586
365 Ga0395901_0186943 3300038443 Bacteria 2173
366 Ga0395901_0236119 3300038443 Bacteria 1908
367 Ga0436365_0111566 3300039437 Bacteria 7109
368 Ga0436365_0147149 3300039437 Bacteria 732
369 Ga0436365_0482503 3300039437 Bacteria 7795
370 Ga0436365_0809314 3300039437 Bacteria 597
371 Ga0436365_0903795 3300039437 Bacteria 1563
372 Ga0436365_1168763 3300039437 Bacteria 90017
373 Ga0436365_1380658 3300039437 Bacteria 17187
374 Ga0436365_1798385 3300039437 Bacteria 7935
375 Ga0436365_1863177 3300039437 Bacteria 2957
376 Ga0436360_0332197 3300039438 Bacteria 2676
377 Ga0436363_0076370 3300039450 Bacteria 5111
378 Ga0436363_0196710 3300039450 Bacteria 666
379 Ga0436363_0242605 3300039450 Unclassified 582
380 Ga0436363_0252313 3300039450 Bacteria 1718
381 Ga0436363_0423963 3300039450 Bacteria 1273
382 Ga0436363_0558206 3300039450 Bacteria 2665
383 Ga0436363_0710387 3300039450 Bacteria 3641
384 Ga0436363_0769720 3300039450 Bacteria 1712
385 Ga0436363_1143424 3300039450 Bacteria 1087
386 Ga0436363_1233558 3300039450 Bacteria 1155
387 Ga0436363_1607863 3300039450 Bacteria 5091
388 Ga0436362_0028405 3300039453 Bacteria 1552
389 Ga0436362_0123860 3300039453 Bacteria 2390
390 Ga0436362_0797217 3300039453 Bacteria 781
391 Ga0436362_0912320 3300039453 Bacteria 1011
392 Ga0451797_0564154 3300041453 Bacteria 906
393 Ga0451795_0340045 3300041456 Bacteria 544
394 Ga0451795_0643121 3300041456 Bacteria 1558
395 Ga0451807_2184212 3300041486 Bacteria 1205
396 Ga0451835_0197260 3300041492 Bacteria 752
397 Ga0451851_0045591 3300041507 Bacteria 738
398 Ga0451853_0078041 3300041512 Bacteria 879
399 Ga0451853_1839962 3300041512 Bacteria 1227
400 Ga0466969_0035083 3300044656 Bacteria 2539
401 Ga0466969_0074594 3300044656 Bacteria 1627
402 Ga0466972_0018136 3300044658 Bacteria 3521
403 Ga0466965_0325244 3300044683 Bacteria 838
404 Ga0466965_0550558 3300044683 Bacteria 651
405 Ga0466966_0250093 3300044684 Bacteria 1068
406 Ga0466961_0119919 3300044693 Bacteria 1652
407 Ga0466961_0127524 3300044693 Bacteria 1595
408 Ga0466961_0209288 3300044693 Bacteria 1204
409 Ga0466963_0008888 3300044694 Bacteria 6029
410 Ga0466963_0252668 3300044694 Bacteria 1237
411 Ga0466963_0295835 3300044694 Bacteria 1138
412 Ga0466964_0054674 3300044706 Bacteria 1646
413 Ga0466971_0003462 3300044719 Bacteria 6739
414 Ga0466971_0039073 3300044719 Bacteria 2130
415 Ga0466971_0054386 3300044719 Bacteria 1804
416 Ga0466971_0290012 3300044719 Bacteria 784
417 Ga0466971_0331499 3300044719 Bacteria 734
418 Ga0466968_0028546 3300044735 Bacteria 2301
419 Ga0466968_0060092 3300044735 Bacteria 1638
420 Ga0466968_0429310 3300044735 Bacteria 651
421 Ga0466968_0430429 3300044735 Bacteria 650
422 Ga0466970_0237129 3300044765 Bacteria 1020
423 Ga0466970_0249450 3300044765 Bacteria 994
424 Ga0466970_0358678 3300044765 Bacteria 828
425 Ga0466957_0066784 3300044842 Bacteria 2218
426 Ga0466957_0175343 3300044842 Bacteria 1398
427 Ga0466957_1302270 3300044842 Bacteria 527
428 Ga0466960_0046577 3300044901 Bacteria 2077
429 Ga0466960_0053769 3300044901 Bacteria 1952
430 Ga0466960_0446267 3300044901 Bacteria 751
431 Ga0466960_0470919 3300044901 Bacteria 733
432 Ga0466960_0659582 3300044901 Bacteria 625
433 Ga0466959_0001784 3300045049 Bacteria 13439
434 Ga0466959_0012489 3300045049 Bacteria 6139
435 Ga0466959_0059018 3300045049 Bacteria 2794
436 Ga0466959_0079780 3300045049 Bacteria 2360
437 Ga0466959_0079951 3300045049 Bacteria 2357
438 Ga0466959_0311387 3300045049 Bacteria 1077
439 Ga0466959_0610169 3300045049 Bacteria 734
440 Ga0466958_0003796 3300045836 Bacteria 7886
441 Ga0466958_0008366 3300045836 Bacteria 5734
442 Ga0466958_0016778 3300045836 Bacteria 4223
443 Ga0466958_0069000 3300045836 Bacteria 2162
444 Ga0466958_0140975 3300045836 Bacteria 1517
445 Ga0466958_0252155 3300045836 Bacteria 1129
446 Ga0466958_0451053 3300045836 Bacteria 833
447 Ga0466958_0484346 3300045836 Bacteria 802
448 Ga0466967_0011399 3300045976 Bacteria 6732
449 Ga0466967_0035350 3300045976 Bacteria 4252
450 Ga0466967_0076465 3300045976 Bacteria 3012
451 Ga0466967_0193146 3300045976 Bacteria 1925
452 Ga0466967_0309638 3300045976 Bacteria 1521
453 Ga0466967_0534199 3300045976 Bacteria 1153
454 Ga0466967_0769953 3300045976 Bacteria 955
455 Ga0466967_0902354 3300045976 Unclassified 879
456 Ga0466967_1070147 3300045976 Bacteria 803
457 Ga0466967_1682898 3300045976 Bacteria 632
458 Ga0466967_1846597 3300045976 Bacteria 601
459 Ga0495664_0000012 3300046477 Bacteria 226118
460 Ga0495584_0157078 3300046491 Bacteria 1156
461 Ga0495652_0115002 3300046529 Bacteria 2157
462 Ga0495634_0267978 3300046642 Bacteria 1040
463 Ga0495658_0890959 3300046683 Bacteria 569
464 Ga0495674_0753128 3300047319 Bacteria 761
465 Ga0496100_0011765 3300048903 Bacteria 4992
466 Ga0496100_0067704 3300048903 Bacteria 2372
467 Ga0496100_0074856 3300048903 Bacteria 2269
468 Ga0496100_0597341 3300048903 Bacteria 857
469 Ga0496100_0873231 3300048903 Bacteria 706
470 Ga0496101_0013960 3300048904 Bacteria 5394
471 Ga0496101_0028645 3300048904 Bacteria 3890
472 Ga0496101_1183404 3300048904 Unclassified 599
473 Ga0496102_0008403 3300048905 Bacteria 8845
474 Ga0496102_0090969 3300048905 Bacteria 2824
475 Ga0496102_0310745 3300048905 Bacteria 1485
476 Ga0496102_1276272 3300048905 Bacteria 654
477 Ga0496103_0037272 3300048906 Bacteria 2979
478 Ga0496104_0013246 3300048907 Bacteria 7432
479 Ga0496105_0139060 3300048908 Bacteria 1999
480 Ga0496105_0289414 3300048908 Bacteria 1319
481 Ga0496106_0009189 3300048909 Bacteria 7300
482 Ga0496106_0023901 3300048909 Bacteria 4541
483 Ga0496107_0006595 3300048910 Bacteria 7990
484 Ga0496107_0085103 3300048910 Bacteria 2307
485 Ga0496108_0005161 3300048911 Bacteria 10558
486 Ga0496108_0071290 3300048911 Bacteria 2931
487 Ga0496108_0137096 3300048911 Bacteria 2106
488 Ga0496108_0468938 3300048911 Bacteria 1100
489 Ga0496108_1767052 3300048911 Bacteria 507
490 Ga0496109_0004140 3300048912 Bacteria 12112
491 Ga0496109_0259355 3300048912 Bacteria 1637
492 Ga0496109_0267340 3300048912 Bacteria 1611
493 Ga0496109_0359654 3300048912 Bacteria 1375
494 Ga0496110_0016050 3300048913 Bacteria 6244
495 Ga0496110_0243272 3300048913 Bacteria 1637
496 Ga0496110_0850841 3300048913 Bacteria 817
497 Ga0496111_0070203 3300048914 Bacteria 2547
498 Ga0496111_0159502 3300048914 Bacteria 1674
499 Ga0496112_0000139 3300048915 Bacteria 45072
500 Ga0496112_0002780 3300048915 Bacteria 14199
501 Ga0496112_0381494 3300048915 Bacteria 1350
502 Ga0496113_0066165 3300048916 Bacteria 2736
503 Ga0496113_0131264 3300048916 Bacteria 1966
504 Ga0496113_0278825 3300048916 Bacteria 1336
505 Ga0496113_0371193 3300048916 Bacteria 1148
506 Ga0496114_0029473 3300048917 Bacteria 4512
507 Ga0496114_0153814 3300048917 Bacteria 1996
508 Ga0496114_0275816 3300048917 Bacteria 1482
509 Ga0496115_0000245 3300048918 Bacteria 49174
510 Ga0496115_0015070 3300048918 Bacteria 5859
511 Ga0496121_0541369 3300048924 Bacteria 730
512 Ga0501034_0621714 3300049571 Bacteria 984
513 Ga0501039_1417862 3300049575 Bacteria 535
514 Ga0501080_0500492 3300049742 Bacteria 1086
515 nmdc:mga0yw44_573454_c1 3300050492 Bacteria 766
516 nmdc:mga05p37_246535_c1 3300050507 Bacteria 2144
517 nmdc:mga09592_65123_c1 3300050508 Bacteria 3086
518 nmdc:mga06r32_19524_c1 3300050510 Bacteria 6224
519 nmdc:mga08y16_152981_c1 3300050511 Bacteria 2398
520 nmdc:mga08y16_180751_c1 3300050511 Bacteria 2190
521 nmdc:mga08y16_23806_c1 3300050511 Bacteria 6466
522 nmdc:mga08y16_353486_c1 3300050511 Bacteria 1509
523 nmdc:mga08y16_451807_c1 3300050511 Bacteria 1310
524 nmdc:mga0n895_923180_c1 3300050512 Bacteria 857
525 nmdc:mga0rr50_633860_c1 3300050513 Bacteria 912
526 nmdc:mga0rr50_70406_c1 3300050513 Bacteria 2665
527 nmdc:mga08x19_18436_c1 3300050514 Bacteria 4276
528 nmdc:mga0a205_1143798_c1 3300050515 Bacteria 626
529 nmdc:mga0a205_477784_c1 3300050515 Bacteria 1105
530 Ga0500616_0010852 3300053153 Bacteria 5430
531 Ga0466962_0011474 3300061719 Bacteria 4266
532 Ga0466962_0025663 3300061719 Bacteria 2829
533 Ga0466962_0348457 3300061719 Bacteria 737
534 Ga0070712_100244821
535 LJQas_1014381
536 JGI24746J21847_1010194
537 JGI24745J21846_1004174
538 JGI24744J21845_10018620
539 JGI24033J26618_1027963
540 JGI25406J46586_10014968
541 Ga0070658_10351594
542 Ga0070658_10580799
543 Ga0070676_10205860
544 Ga0070683_100064098
545 Ga0070683_100421741
546 Ga0070683_100443599
547 Ga0070683_100606393
548 Ga0070683_100806274
549 Ga0070690_100332822
550 Ga0070670_100511293
551 Ga0070670_100640597
552 Ga0068869_100055918
553 Ga0068869_100658246
554 Ga0070682_100030385
555 Ga0070682_100201279
556 Ga0070682_100387127
557 Ga0068868_100003558
558 Ga0068868_100075192
559 Ga0068868_100134995
560 Ga0068868_100194105
561 Ga0068868_100375720
562 Ga0070660_100078774
563 Ga0070660_100157930
564 Ga0070660_100267741
565 Ga0070689_100378819
566 Ga0070691_10191256
567 Ga0070692_10394959
568 Ga0070668_100019464
569 Ga0070668_100136276
570 Ga0070668_100398296
571 Ga0070669_100833138
572 Ga0070675_100023251
573 Ga0070674_100794691
574 Ga0070673_100964198
575 Ga0070673_101015731
576 Ga0070673_101422699
577 Ga0070688_100773960
578 Ga0070659_100032885
579 Ga0070659_100662074
580 Ga0070659_101307946
581 Ga0070714_100082902
582 Ga0070713_100391599
583 Ga0070713_100784349
584 Ga0070713_101353857
585 Ga0070701_10022842
586 Ga0070701_10883812
587 Ga0070711_100031264
588 Ga0070711_100069462
589 Ga0070711_100677480
590 Ga0070705_100992652
591 Ga0070700_100002452
592 Ga0070700_100399857
593 Ga0070700_100741983
594 Ga0070663_100167131
595 Ga0070678_100035890
596 Ga0070678_100747119
597 Ga0070662_100057076
598 Ga0070681_10320777
599 Ga0068867_100184518
600 Ga0070685_10018245
601 Ga0070685_10041645
602 Ga0070685_10229358
603 Ga0070684_100035034
604 Ga0070684_100038148
605 Ga0070684_100253775
606 Ga0070684_101423199
607 Ga0068853_100510967
608 Ga0070693_100059942
609 Ga0070693_100297385
610 Ga0070693_100645552
611 Ga0070693_100691348
612 Ga0070693_101085435
613 Ga0070665_100203919
614 Ga0070665_100421961
615 Ga0070704_100045680
616 Ga0068855_100592779
617 Ga0070664_100006882
618 Ga0070664_100033731
619 Ga0070664_100178251
620 Ga0070664_100181929
621 Ga0070664_100968711
622 Ga0068857_100633149
623 Ga0068857_100644497
624 Ga0068854_100085144
625 Ga0068856_100013803
626 Ga0068856_100308254
627 Ga0068856_100337914
628 Ga0068856_100359706
629 Ga0068856_100629229
630 Ga0070702_100087350
631 Ga0070702_100453641
632 Ga0068852_100036739
633 Ga0068852_100460137
634 Ga0068859_100640950
635 Ga0068864_100044364
636 Ga0068864_100113020
637 Ga0068864_100391153
638 Ga0068866_10336179
639 Ga0068866_10594657
640 Ga0068861_100020556
641 Ga0068851_10467662
642 Ga0068870_10777905
643 Ga0068863_100492100
644 Ga0068858_100063690
645 Ga0068858_100382278
646 Ga0068862_101053050
647 Ga0068862_101375858
648 Ga0081539_10001679
649 Ga0081539_10191578
650 Ga0070717_10360652
651 Ga0075365_10565998
652 Ga0075363_100471657
653 Ga0075432_10177368
654 Ga0070712_100010865
655 Ga0070712_100183886
656 Ga0070712_100658641
657 Ga0075428_100111227
658 Ga0075428_100692700
659 Ga0075433_10395357
660 Ga0075433_10805524
661 Ga0075433_11105396
662 Ga0075434_100821888
663 Ga0075429_100085003
664 Ga0068865_100125825
665 Ga0068865_100492454
666 Ga0075436_100028173
667 Ga0097620_100640977
668 Ga0075435_100103647
669 Ga0075435_100640167
670 Ga0075435_101439621
671 Ga0105250_10396124
672 Ga0111539_10045073
673 Ga0111539_10268780
674 Ga0111539_10405194
675 Ga0111539_10695599
676 Ga0111539_10971478
677 Ga0105245_10006719
678 Ga0105245_10085861
679 Ga0105245_10200762
680 Ga0105245_10295722
681 Ga0105245_10816358
682 Ga0105245_11688884
683 Ga0105243_10022176
684 Ga0105243_10171232
685 Ga0105243_10283316
686 Ga0105243_11822981
687 Ga0105241_10690628
688 Ga0105241_10978760
689 Ga0105242_10239455
690 Ga0105242_10513830
691 Ga0105242_10791092
692 Ga0105248_10190063
693 Ga0105248_10636297
694 Ga0105237_10173928
695 Ga0105237_11341185
696 Ga0105249_10035662
697 Ga0105249_10240170
698 Ga0105239_10013492
699 Ga0105239_10093145
700 Ga0105239_10429424
701 Ga0105246_10056603
702 Ga0105246_10229542
703 Ga0105246_10595536
704 Ga0157371_10159193
705 Ga0157371_10792201
706 Ga0157369_10569314
707 Ga0157369_10651902
708 Ga0157374_10014828
709 Ga0157378_10026124
710 Ga0157378_10380479
711 Ga0157378_11050741
712 Ga0163162_10144339
713 Ga0163162_10223759
714 Ga0163162_12792467
715 Ga0157372_10044048
716 Ga0157372_11504322
717 Ga0157375_10014942
718 Ga0163163_10280342
719 Ga0163163_10373189
720 Ga0157380_10191407
721 Ga0157380_10582552
722 Ga0157380_10786969
723 Ga0157380_10982571
724 Ga0157377_10003239
725 Ga0157377_10828658
726 Ga0157379_10003495
727 Ga0157379_10766212
728 Ga0157376_10146644
729 Ga0206354_11277094
730 Ga0213874_10004936
731 Ga0213874_10039915
732 Ga0213874_10062687
733 Ga0213874_10120138
734 Ga0213876_10033431
735 Ga0213876_10077971
736 Ga0213876_10081823
737 Ga0213876_10098008
738 Ga0213876_10451156
739 Ga0213875_10011653
740 Ga0213875_10012795
741 Ga0213875_10031677
742 Ga0213875_10131597
743 Ga0213875_10155187
744 Ga0207656_10214472
745 Ga0207642_10235877
746 Ga0207642_10268251
747 Ga0207642_10545506
748 Ga0207710_10156513
749 Ga0207688_10001974
750 Ga0207688_10187021
751 Ga0207647_10371524
752 Ga0207645_10297260
753 Ga0207643_10739547
754 Ga0207643_10743166
755 Ga0207705_10084173
756 Ga0207705_10556654
757 Ga0207654_10295187
758 Ga0207671_10460623
759 Ga0207671_10685887
760 Ga0207693_10154336
761 Ga0207693_10230867
762 Ga0207693_10289758
763 Ga0207693_10423326
764 Ga0207693_10481479
765 Ga0207663_10000267
766 Ga0207663_10023132
767 Ga0207663_10215698
768 Ga0207663_10507244
769 Ga0207662_10041131
770 Ga0207657_10009056
771 Ga0207657_10129066
772 Ga0207657_10196177
773 Ga0207657_10372222
774 Ga0207657_10544345
775 Ga0207649_10101799
776 Ga0207649_11050776
777 Ga0207649_11270679
778 Ga0207652_10067744
779 Ga0207652_10693324
780 Ga0207650_11362978
781 Ga0207659_10016436
782 Ga0207659_10048536
783 Ga0207687_10152637
784 Ga0207687_10364531
785 Ga0207687_10839814
786 Ga0207700_10587786
787 Ga0207664_11290391
788 Ga0207644_10063956
789 Ga0207690_10032864
790 Ga0207690_10866193
791 Ga0207690_11154117
792 Ga0207706_10021161
793 Ga0207686_10088870
794 Ga0207686_10265481
795 Ga0207686_10498076
796 Ga0207709_10183056
797 Ga0207709_11135326
798 Ga0207670_10142260
799 Ga0207670_10225349
800 Ga0207711_10581151
801 Ga0207689_10038186
802 Ga0207689_10877990
803 Ga0207661_10006453
804 Ga0207661_10191990
805 Ga0207661_10324055
806 Ga0207661_10565452
807 Ga0207661_10580694
808 Ga0207661_11576980
809 Ga0207679_10009192
810 Ga0207679_10450063
811 Ga0207679_11138379
812 Ga0207667_10097738
813 Ga0207651_10163807
814 Ga0207651_11064178
815 Ga0207651_11258638
816 Ga0207668_10230101
817 Ga0207640_10125762
818 Ga0207640_11025340
819 Ga0207677_10008111
820 Ga0207677_10051985
821 Ga0207677_10200914
822 Ga0207677_10976258
823 Ga0207703_10408076
824 Ga0207703_10675467
825 Ga0207639_10347513
826 Ga0207678_10097720
827 Ga0207678_10674391
828 Ga0207708_10000450
829 Ga0207708_10384118
830 Ga0207702_10116909
831 Ga0207702_10309139
832 Ga0207702_10315446
833 Ga0207702_10820867
834 Ga0207641_10131837
835 Ga0207648_10669698
836 Ga0207676_10066318
837 Ga0207676_10216928
838 Ga0207676_10603220
839 Ga0207674_10152588
840 Ga0207674_10515481
841 Ga0207675_100057961
842 Ga0207675_100201659
843 Ga0207675_100984754
844 Ga0207683_10108798
845 Ga0207683_10208783
846 Ga0207683_10427715
847 Ga0207698_10039075
848 Ga0207698_10062560
849 Ga0207698_10364902
850 Ga0207428_10075352
851 Ga0207428_10102750
852 Ga0207428_10272071
853 Ga0268266_10045365
854 Ga0268266_10429392
855 Ga0268265_10400974
856 Ga0268265_10681612
857 Ga0268265_11727051
858 Ga0265319_1003236
859 Ga0265318_10001862
860 Ga0265338_10062728
861 Ga0265320_10026940
862 Ga0265320_10255686
863 Ga0265314_10033310
864 Ga0307405_10587664
865 Ga0307405_11750269
866 Ga0307413_10433382
867 Ga0307413_10594853
868 Ga0307406_10710781
869 Ga0307407_10111408
870 Ga0307407_10391633
871 Ga0307407_10732016
872 Ga0307409_100082529
873 Ga0307416_100192609
874 Ga0307416_100225475
875 Ga0307414_10191933
876 Ga0307411_10610755
877 Ga0307415_100904351
878 Ga0307415_101034050
879 Ga0307415_101337770
880 Ga0307415_102015781
881 Ga0373949_0146711
882 Ga0373952_0146489
883 Ga0316574_0049742
884 Ga0395900_0015410
885 Ga0395898_0035474
886 Ga0395898_0495643
887 Ga0395898_0984883
888 Ga0395905_1164024
889 Ga0436364_0073806
890 Ga0436364_0437630
891 Ga0436364_0452123
892 Ga0436364_0816068
893 Ga0436364_1005459
894 Ga0436364_1218417
895 Ga0436364_1258262
896 Ga0436364_1336860
897 Ga0436364_1401499
898 Ga0395901_0186943
899 Ga0395901_0236119
900 Ga0436365_0111566
901 Ga0436365_0147149
902 Ga0436365_0482503
903 Ga0436365_0809314
904 Ga0436365_0903795
905 Ga0436365_1168763
906 Ga0436365_1380658
907 Ga0436365_1798385
908 Ga0436365_1863177
909 Ga0436360_0332197
910 Ga0436363_0076370
911 Ga0436363_0196710
912 Ga0436363_0242605
913 Ga0436363_0252313
914 Ga0436363_0423963
915 Ga0436363_0558206
916 Ga0436363_0710387
917 Ga0436363_0769720
918 Ga0436363_1143424
919 Ga0436363_1233558
920 Ga0436363_1607863
921 Ga0436362_0028405
922 Ga0436362_0123860
923 Ga0436362_0797217
924 Ga0436362_0912320
925 Ga0451797_0564154
926 Ga0451795_0340045
927 Ga0451795_0643121
928 Ga0451807_2184212
929 Ga0451835_0197260
930 Ga0451851_0045591
931 Ga0451853_0078041
932 Ga0451853_1839962
933 Ga0466969_0035083
934 Ga0466969_0074594
935 Ga0466972_0018136
936 Ga0466965_0325244
937 Ga0466965_0550558
938 Ga0466966_0250093
939 Ga0466961_0119919
940 Ga0466961_0127524
941 Ga0466961_0209288
942 Ga0466963_0008888
943 Ga0466963_0252668
944 Ga0466963_0295835
945 Ga0466964_0054674
946 Ga0466971_0003462
947 Ga0466971_0039073
948 Ga0466971_0054386
949 Ga0466971_0290012
950 Ga0466971_0331499
951 Ga0466968_0028546
952 Ga0466968_0060092
953 Ga0466968_0429310
954 Ga0466968_0430429
955 Ga0466970_0237129
956 Ga0466970_0249450
957 Ga0466970_0358678
958 Ga0466957_0066784
959 Ga0466957_0175343
960 Ga0466957_1302270
961 Ga0466960_0046577
962 Ga0466960_0053769
963 Ga0466960_0446267
964 Ga0466960_0470919
965 Ga0466960_0659582
966 Ga0466959_0001784
967 Ga0466959_0012489
968 Ga0466959_0059018
969 Ga0466959_0079780
970 Ga0466959_0079951
971 Ga0466959_0311387
972 Ga0466959_0610169
973 Ga0466958_0003796
974 Ga0466958_0008366
975 Ga0466958_0016778
976 Ga0466958_0069000
977 Ga0466958_0140975
978 Ga0466958_0252155
979 Ga0466958_0451053
980 Ga0466958_0484346
981 Ga0466967_0011399
982 Ga0466967_0035350
983 Ga0466967_0076465
984 Ga0466967_0193146
985 Ga0466967_0309638
986 Ga0466967_0534199
987 Ga0466967_0769953
988 Ga0466967_0902354
989 Ga0466967_1070147
990 Ga0466967_1682898
991 Ga0466967_1846597
992 Ga0495664_0000012
993 Ga0495584_0157078
994 Ga0495652_0115002
995 Ga0495634_0267978
996 Ga0495658_0890959
997 Ga0495674_0753128
998 Ga0496100_0011765
999 Ga0496100_0067704
1000 Ga0496100_0074856
1001 Ga0496100_0597341
1002 Ga0496100_0873231
1003 Ga0496101_0013960
1004 Ga0496101_0028645
1005 Ga0496101_1183404
1006 Ga0496102_0008403
1007 Ga0496102_0090969
1008 Ga0496102_0310745
1009 Ga0496102_1276272
1010 Ga0496103_0037272
1011 Ga0496104_0013246
1012 Ga0496105_0139060
1013 Ga0496105_0289414
1014 Ga0496106_0009189
1015 Ga0496106_0023901
1016 Ga0496107_0006595
1017 Ga0496107_0085103
1018 Ga0496108_0005161
1019 Ga0496108_0071290
1020 Ga0496108_0137096
1021 Ga0496108_0468938
1022 Ga0496108_1767052
1023 Ga0496109_0004140
1024 Ga0496109_0259355
1025 Ga0496109_0267340
1026 Ga0496109_0359654
1027 Ga0496110_0016050
1028 Ga0496110_0243272
1029 Ga0496110_0850841
1030 Ga0496111_0070203
1031 Ga0496111_0159502
1032 Ga0496112_0000139
1033 Ga0496112_0002780
1034 Ga0496112_0381494
1035 Ga0496113_0066165
1036 Ga0496113_0131264
1037 Ga0496113_0278825
1038 Ga0496113_0371193
1039 Ga0496114_0029473
1040 Ga0496114_0153814
1041 Ga0496114_0275816
1042 Ga0496115_0000245
1043 Ga0496115_0015070
1044 Ga0496121_0541369
1045 Ga0501034_0621714
1046 Ga0501039_1417862
1047 Ga0501080_0500492
1048 nmdc:mga0yw44_573454_c1
1049 nmdc:mga05p37_246535_c1
1050 nmdc:mga09592_65123_c1
1051 nmdc:mga06r32_19524_c1
1052 nmdc:mga08y16_152981_c1
1053 nmdc:mga08y16_180751_c1
1054 nmdc:mga08y16_23806_c1
1055 nmdc:mga08y16_353486_c1
1056 nmdc:mga08y16_451807_c1
1057 nmdc:mga0n895_923180_c1
1058 nmdc:mga0rr50_633860_c1
1059 nmdc:mga0rr50_70406_c1
1060 nmdc:mga08x19_18436_c1
1061 nmdc:mga0a205_1143798_c1
1062 nmdc:mga0a205_477784_c1
1063 Ga0500616_0010852
1064 Ga0466962_0011474
1065 Ga0466962_0025663
1066 Ga0466962_0348457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

13

138

0.96

PF08534

Redoxin

Redoxin

12

152

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9321 2 153
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9258 1 153
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9206 2 153
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9163 2 153
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.9117 3 154
ID Description Score Start End Superfamily
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9258 1 153 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9033 1 153 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8924 1 150 3.40.30.10
af_A0A0R4J5B9_27_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8906 2 149 3.40.30.10
af_A0A1D8PDN3_24_184_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8895 4 148 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A367YU65-F1-model_v4 Peroxiredoxin 0.9819 29 151 GO:0016209
GO:0016491
AF-A0A2W5YSI4-F1-model_v4 Alkyl hydroperoxide reductase 0.9806 1 151 GO:0016209
GO:0016491
AF-A0A538A886-F1-model_v4 Redoxin domain-containing protein 0.9791 4 152 GO:0016209
GO:0016491
AF-A0A7W0A7D4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9771 4 150 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A839QLP5-F1-model_v4 Peroxiredoxin 0.9731 31 156 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Map