metagRoot

F460351

General Info

Members	Datasets	Scaffolds	Average Seq Length
532	289	498	246

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|8056673599\|8056674329
Length	288
Sequence	VAKYLYLPPMWFLGDRIPATVSLYGLANLKLTTPAVALEMPKGRNVKKILLMTTGLIALGMAPAIAADLAARPYTKAPIAVAAYNWSGFYAGINGGWGSSRQSWYDAGFSLGSHDATGGTVGGQIGYRWQAGTWVFGVEAQGNWADFHGSNVIPLVVPSITNDTRVDAFGLFTGQVGYAANNVLFYVKGGAAVTSNRYRMLASATGAQIANGVDDTRWGGVVGVGLEYGFAPNWSAGIEYNHMFMQDKTYNFVTNGVVFPAGLLLANGRISQDVDIVTARINYKFGGY

Samples

	Sample ID	Description	Type	Environment
1	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
2	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
3	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
4	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
5	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
6	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
7	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
8	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
12	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
13	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
16	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
17	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
18	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
21	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
24	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
25	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
26	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
27	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
28	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
29	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
30	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
31	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
32	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
33	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
34	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
35	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
36	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
37	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
38	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
39	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
40	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
41	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
42	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
43	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
44	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
45	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
46	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
47	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
48	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
49	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
50	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
51	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
52	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
53	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
54	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
55	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
56	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
57	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
58	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
59	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
61	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
62	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
66	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
67	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
69	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
70	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
72	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
73	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
74	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
75	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
76	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
77	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
78	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
81	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
82	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
83	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
84	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
85	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
86	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
87	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
88	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
89	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
90	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
91	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
133	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
137	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
138	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
139	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
140	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
141	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
142	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
143	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
144	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
145	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
146	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
147	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
148	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
149	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
150	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
151	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
152	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
153	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
154	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
155	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
156	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
157	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
158	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
159	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
160	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
161	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
162	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
163	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
164	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
165	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
166	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
167	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
168	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
169	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
170	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
171	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
172	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
173	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
174	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
175	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
176	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
177	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
178	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
179	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
180	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
181	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
182	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
183	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
184	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
185	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
186	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
187	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
188	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
189	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
190	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
191	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
192	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
193	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
194	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
195	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
196	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
197	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
198	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
199	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
200	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
201	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
202	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
203	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
204	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
205	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
206	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
207	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
208	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
209	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
210	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
211	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
212	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
213	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
214	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
215	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
216	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
217	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
218	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
219	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
220	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
221	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
222	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
223	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
224	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
225	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
226	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
227	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
228	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
229	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
230	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
231	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
232	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
233	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
234	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
235	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
239	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
244	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
253	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
254	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
255	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
258	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
262	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
263	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
264	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
265	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
266	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
267	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
268	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
269	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
270	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
271	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
272	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
273	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
274	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
275	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
276	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
277	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
278	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
279	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
280	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
281	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
282	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
283	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
284	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
285	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
286	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
287	3300059642	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
288	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
289	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	98.5
Metatranscriptomes	0.56
Isolates	0.94

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.41
Nodule	0.94
Rhizoplane	9.02
Rhizosphere	69.74
Stem	0
Stem Tuber	0
Unclassified	7.89

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25153J46596_10004776	3300003215	Bacteria	7222
2	JGI25404J52841_10002719	3300003659	Bacteria	3391
3	Ga0058861_11443412	3300004800	Bacteria	800
4	Ga0058862_12448629	3300004803	Bacteria	802
5	Ga0070658_10070632	3300005327	Bacteria	2859
6	Ga0070683_100127147	3300005329	Bacteria	2410
7	Ga0068869_100008382	3300005334	Bacteria	6661
8	Ga0068869_100041926	3300005334	Bacteria	3279
9	Ga0070680_100138859	3300005336	Bacteria	2037
10	Ga0070682_100066797	3300005337	Bacteria	2289
11	Ga0068868_100043836	3300005338	Bacteria	3495
12	Ga0068868_100051211	3300005338	Bacteria	3246
13	Ga0068868_100096360	3300005338	Bacteria	2390
14	Ga0070660_100334906	3300005339	Bacteria	1245
15	Ga0070689_100262551	3300005340	Bacteria	1428
16	Ga0070668_100092933	3300005347	Bacteria	2380
17	Ga0070668_100157731	3300005347	Bacteria	1839
18	Ga0070669_100230528	3300005353	Bacteria	1468
19	Ga0070671_100250121	3300005355	Bacteria	1506
20	Ga0070688_100060808	3300005365	Bacteria	2386
21	Ga0070688_100132267	3300005365	Bacteria	1685
22	Ga0070688_100262462	3300005365	Bacteria	1234
23	Ga0070688_100342614	3300005365	Bacteria	1092
24	Ga0070659_100036450	3300005366	Bacteria	3835
25	Ga0070713_100049243	3300005436	Bacteria	3475
26	Ga0070710_10243133	3300005437	Bacteria	1154
27	Ga0070710_10435944	3300005437	Bacteria	885
28	Ga0070711_100074898	3300005439	Bacteria	2395
29	Ga0070694_100268008	3300005444	Bacteria	1298
30	Ga0070663_100022711	3300005455	Bacteria	4197
31	Ga0070663_100171273	3300005455	Bacteria	1678
32	Ga0070663_100406639	3300005455	Bacteria	1114
33	Ga0070678_100037525	3300005456	Bacteria	3404
34	Ga0070678_100061778	3300005456	Bacteria	2763
35	Ga0070678_100300980	3300005456	Bacteria	1363
36	Ga0070662_100224704	3300005457	Bacteria	1499
37	Ga0070662_100242626	3300005457	Bacteria	1446
38	Ga0070681_10015034	3300005458	Bacteria	7699
39	Ga0070681_10069727	3300005458	Bacteria	3482
40	Ga0070685_10231016	3300005466	Bacteria	1217
41	Ga0070679_100074282	3300005530	Bacteria	3390
42	Ga0068853_100157896	3300005539	Bacteria	2044
43	Ga0070693_100046911	3300005547	Bacteria	2455
44	Ga0070693_100084888	3300005547	Bacteria	1896
45	Ga0070665_100030300	3300005548	Bacteria	5445
46	Ga0070665_100031074	3300005548	Bacteria	5375
47	Ga0070665_100167091	3300005548	Bacteria	2202
48	Ga0068855_100039308	3300005563	Bacteria	5616
49	Ga0070664_100142603	3300005564	Bacteria	2110
50	Ga0070664_100240059	3300005564	Bacteria	1627
51	Ga0068854_100348126	3300005578	Bacteria	1212
52	Ga0068856_100238800	3300005614	Bacteria	1833
53	Ga0070702_100068510	3300005615	Bacteria	2088
54	Ga0068859_100092818	3300005617	Bacteria	3070
55	Ga0068859_100151769	3300005617	Bacteria	2392
56	Ga0068859_100163128	3300005617	Bacteria	2308
57	Ga0068864_100261950	3300005618	Bacteria	1609
58	Ga0068866_10143503	3300005718	Bacteria	1374
59	Ga0068861_100039161	3300005719	Bacteria	3536
60	Ga0068861_100119106	3300005719	Bacteria	2127
61	Ga0068861_100391303	3300005719	Bacteria	1231
62	Ga0068863_100299230	3300005841	Bacteria	1560
63	Ga0068858_100110123	3300005842	Bacteria	2571
64	Ga0068858_100361388	3300005842	Bacteria	1391
65	Ga0068858_100556335	3300005842	Bacteria	1111
66	Ga0068860_100065598	3300005843	Bacteria	3447
67	Ga0068860_100537708	3300005843	Bacteria	1170
68	Ga0068862_100032186	3300005844	Bacteria	4430
69	Ga0068862_100089496	3300005844	Bacteria	2679
70	Ga0068862_100105933	3300005844	Bacteria	2464
71	Ga0068862_100433024	3300005844	Bacteria	1236
72	Ga0081455_10003916	3300005937	Bacteria	16952
73	Ga0081455_10032741	3300005937	Bacteria	4681
74	Ga0081455_10286371	3300005937	Bacteria	1188
75	Ga0081540_1002364	3300005983	Bacteria	15402
76	Ga0081540_1010088	3300005983	Bacteria	6430
77	Ga0081540_1029837	3300005983	Bacteria	3031
78	Ga0081540_1065707	3300005983	Bacteria	1704
79	Ga0075365_10021759	3300006038	Bacteria	4006
80	Ga0075365_10033437	3300006038	Bacteria	3313
81	Ga0075368_10007885	3300006042	Bacteria	3776
82	Ga0075363_100010783	3300006048	Bacteria	4357
83	Ga0075363_100030478	3300006048	Bacteria	2793
84	Ga0075363_100085816	3300006048	Bacteria	1727
85	Ga0075363_100230634	3300006048	Bacteria	1063
86	Ga0075364_10029856	3300006051	Bacteria	3497
87	Ga0070715_10005242	3300006163	Bacteria	4308
88	Ga0070716_100031880	3300006173	Bacteria	2869
89	Ga0070712_100010605	3300006175	Bacteria	5819
90	Ga0075362_10050269	3300006177	Bacteria	1864
91	Ga0075362_10062572	3300006177	Bacteria	1686
92	Ga0075362_10113641	3300006177	Bacteria	1277
93	Ga0075367_10015687	3300006178	Bacteria	4123
94	Ga0075367_10234485	3300006178	Bacteria	1149
95	Ga0075367_10372434	3300006178	Unclassified	902
96	Ga0075369_10019473	3300006186	Bacteria	2771
97	Ga0075369_10024525	3300006186	Bacteria	2500
98	Ga0075366_10031132	3300006195	Bacteria	3139
99	Ga0075366_10166331	3300006195	Bacteria	1337
100	Ga0097621_100494965	3300006237	Bacteria	1107
101	Ga0075370_10013431	3300006353	Bacteria	4353
102	Ga0075370_10046411	3300006353	Bacteria	2458
103	Ga0075370_10128275	3300006353	Bacteria	1479
104	Ga0068871_100099088	3300006358	Bacteria	2439
105	Ga0075428_100060888	3300006844	Bacteria	4133
106	Ga0075434_100233583	3300006871	Bacteria	1859
107	Ga0097620_100092810	3300006931	Bacteria	3070
108	Ga0097620_100151766	3300006931	Bacteria	2392
109	Ga0097620_100163120	3300006931	Bacteria	2308
110	Ga0099795_10036681	3300007788	Bacteria	1721
111	Ga0105240_10119111	3300009093	Bacteria	3181
112	Ga0105240_10159151	3300009093	Bacteria	2684
113	Ga0111539_10009524	3300009094	Bacteria	12262
114	Ga0105245_10052962	3300009098	Bacteria	3642
115	Ga0105245_10199301	3300009098	Bacteria	1922
116	Ga0105245_10539791	3300009098	Bacteria	1187
117	Ga0105247_10013545	3300009101	Bacteria	4891
118	Ga0105247_10253327	3300009101	Bacteria	1204
119	Ga0114129_10338363	3300009147	Bacteria	1997
120	Ga0105243_10162160	3300009148	Bacteria	1929
121	Ga0105243_10508335	3300009148	Bacteria	1143
122	Ga0105243_10617793	3300009148	Bacteria	1046
123	Ga0105241_10022188	3300009174	Bacteria	4700
124	Ga0105242_10087066	3300009176	Bacteria	2622
125	Ga0105242_10191491	3300009176	Bacteria	1811
126	Ga0105242_10851868	3300009176	Bacteria	907
127	Ga0105237_10158435	3300009545	Bacteria	2261
128	Ga0105237_10232211	3300009545	Bacteria	1846
129	Ga0105237_10250633	3300009545	Bacteria	1773
130	Ga0105237_10691211	3300009545	Bacteria	1027
131	Ga0105238_10039979	3300009551	Bacteria	4754
132	Ga0105238_10154207	3300009551	Bacteria	2272
133	Ga0105249_10172465	3300009553	Bacteria	2099
134	Ga0105249_10410215	3300009553	Bacteria	1386
135	Ga0105249_10414271	3300009553	Bacteria	1380
136	Ga0105239_10043742	3300010375	Bacteria	4910
137	Ga0105239_10386339	3300010375	Bacteria	1583
138	Ga0105239_10495767	3300010375	Bacteria	1388
139	Ga0105239_10695548	3300010375	Bacteria	1162
140	Ga0105246_10054288	3300011119	Bacteria	2760
141	Ga0157370_10073536	3300013104	Bacteria	3225
142	Ga0157374_10048162	3300013296	Bacteria	3955
143	Ga0157374_10202520	3300013296	Bacteria	1944
144	Ga0157378_10028342	3300013297	Bacteria	4940
145	Ga0163162_10157862	3300013306	Bacteria	2389
146	Ga0163162_10182452	3300013306	Bacteria	2225
147	Ga0163162_10462341	3300013306	Bacteria	1400
148	Ga0163162_10682930	3300013306	Bacteria	1149
149	Ga0157375_10159696	3300013308	Bacteria	2395
150	Ga0157375_10382866	3300013308	Bacteria	1573
151	Ga0157375_10665246	3300013308	Bacteria	1197
152	Ga0163163_10024600	3300014325	Bacteria	5732
153	Ga0163163_10038391	3300014325	Bacteria	4668
154	Ga0163163_10076657	3300014325	Bacteria	3338
155	Ga0157380_10241850	3300014326	Bacteria	1628
156	Ga0157380_10529232	3300014326	Bacteria	1151
157	Ga0157377_10092234	3300014745	Bacteria	1791
158	Ga0157379_10053163	3300014968	Bacteria	3618
159	Ga0157376_10015165	3300014969	Bacteria	5812
160	Ga0157376_10137337	3300014969	Bacteria	2189
161	Ga0163161_10148926	3300017792	Bacteria	1777
162	Ga0209233_1006705	3300025261	Bacteria	3693
163	Ga0209758_1021144	3300025297	Bacteria	3046
164	Ga0207692_10367750	3300025898	Bacteria	890
165	Ga0207642_10084809	3300025899	Bacteria	1548
166	Ga0207688_10049588	3300025901	Bacteria	2347
167	Ga0207688_10091897	3300025901	Bacteria	1743
168	Ga0207647_10139276	3300025904	Bacteria	1422
169	Ga0207643_10058111	3300025908	Bacteria	2203
170	Ga0207705_10225415	3300025909	Bacteria	1424
171	Ga0207707_10002162	3300025912	Bacteria	17780
172	Ga0207707_10145052	3300025912	Bacteria	2075
173	Ga0207695_10085563	3300025913	Bacteria	3181
174	Ga0207695_10095631	3300025913	Bacteria	2974
175	Ga0207671_10191264	3300025914	Bacteria	1596
176	Ga0207693_10036440	3300025915	Bacteria	3878
177	Ga0207663_10138308	3300025916	Bacteria	1693
178	Ga0207660_10107392	3300025917	Bacteria	2094
179	Ga0207660_10123159	3300025917	Bacteria	1966
180	Ga0207657_10198570	3300025919	Bacteria	1615
181	Ga0207657_10305076	3300025919	Bacteria	1261
182	Ga0207687_10073435	3300025927	Bacteria	2449
183	Ga0207687_10359277	3300025927	Bacteria	1188
184	Ga0207700_10025832	3300025928	Bacteria	4086
185	Ga0207690_10045626	3300025932	Bacteria	2897
186	Ga0207706_10044973	3300025933	Bacteria	3912
187	Ga0207706_10114346	3300025933	Bacteria	2374
188	Ga0207686_10475486	3300025934	Bacteria	965
189	Ga0207709_10353963	3300025935	Bacteria	1109
190	Ga0207670_10138815	3300025936	Bacteria	1790
191	Ga0207670_10346972	3300025936	Bacteria	1174
192	Ga0207711_10120335	3300025941	Bacteria	2343
193	Ga0207711_10466237	3300025941	Bacteria	1176
194	Ga0207689_10041830	3300025942	Bacteria	3791
195	Ga0207689_10064363	3300025942	Bacteria	3017
196	Ga0207679_10034980	3300025945	Bacteria	3550
197	Ga0207679_10119152	3300025945	Bacteria	2098
198	Ga0207679_10245054	3300025945	Bacteria	1520
199	Ga0207667_10089757	3300025949	Bacteria	3176
200	Ga0207667_10379588	3300025949	Bacteria	1440
201	Ga0207712_10580103	3300025961	Bacteria	968
202	Ga0207668_10060733	3300025972	Bacteria	2654
203	Ga0207668_10246919	3300025972	Bacteria	1447
204	Ga0207668_10280264	3300025972	Bacteria	1367
205	Ga0207668_10285115	3300025972	Bacteria	1356
206	Ga0207658_10289007	3300025986	Bacteria	1408
207	Ga0207677_10038494	3300026023	Bacteria	3136
208	Ga0207677_10046794	3300026023	Bacteria	2899
209	Ga0207703_10039242	3300026035	Bacteria	3783
210	Ga0207703_10465163	3300026035	Bacteria	1183
211	Ga0207703_10529374	3300026035	Bacteria	1109
212	Ga0207703_10982340	3300026035	Bacteria	810
213	Ga0207639_10042671	3300026041	Bacteria	3400
214	Ga0207678_10037513	3300026067	Bacteria	4214
215	Ga0207678_10054230	3300026067	Bacteria	3452
216	Ga0207678_10062140	3300026067	Bacteria	3212
217	Ga0207678_10086132	3300026067	Bacteria	2685
218	Ga0207678_10136552	3300026067	Bacteria	2092
219	Ga0207708_10107124	3300026075	Bacteria	2167
220	Ga0207702_10396838	3300026078	Bacteria	1329
221	Ga0207641_10350765	3300026088	Bacteria	1406
222	Ga0207641_10626719	3300026088	Bacteria	1055
223	Ga0207648_10121738	3300026089	Bacteria	2294
224	Ga0207648_10507615	3300026089	Bacteria	1104
225	Ga0207676_10115462	3300026095	Bacteria	2254
226	Ga0207676_10115594	3300026095	Bacteria	2253
227	Ga0207674_10115942	3300026116	Bacteria	2650
228	Ga0207675_100042132	3300026118	Bacteria	4261
229	Ga0207675_100076023	3300026118	Bacteria	3144
230	Ga0207675_100536621	3300026118	Bacteria	1168
231	Ga0207683_10137547	3300026121	Bacteria	2199
232	Ga0207683_10249018	3300026121	Bacteria	1621
233	Ga0209813_10036740	3300027866	Bacteria	1473
234	Ga0209813_10143797	3300027866	Bacteria	849
235	Ga0207428_10026819	3300027907	Bacteria	4801
236	Ga0268266_10017468	3300028379	Bacteria	6118
237	Ga0268266_10099824	3300028379	Bacteria	2556
238	Ga0268266_10100198	3300028379	Bacteria	2551
239	Ga0268266_10137282	3300028379	Unclassified	2191
240	Ga0268265_10033256	3300028380	Bacteria	3747
241	Ga0268265_10105200	3300028380	Bacteria	2289
242	Ga0268265_10121690	3300028380	Bacteria	2151
243	Ga0268265_10126272	3300028380	Bacteria	2117
244	Ga0268264_10113072	3300028381	Bacteria	2381
245	Ga0268264_10159341	3300028381	Bacteria	2031
246	Ga0268264_10596313	3300028381	Bacteria	1088
247	Ga0307509_10100712	3300031507	Bacteria	2926
248	Ga0307509_10277303	3300031507	Bacteria	1440
249	Ga0307509_10389419	3300031507	Bacteria	1104
250	Ga0307516_10002141	3300031730	Bacteria	26772
251	Ga0307516_10025905	3300031730	Bacteria	5963
252	Ga0307516_10047713	3300031730	Bacteria	4217
253	Ga0307516_10113558	3300031730	Bacteria	2507
254	Ga0307415_100799307	3300032126	Bacteria	861
255	Ga0307510_10033831	3300033180	Bacteria	5734
256	Ga0307510_10114763	3300033180	Bacteria	2421
257	Ga0373944_0131055	3300035089	Bacteria	871
258	Ga0373923_0014069	3300035111	Bacteria	2998
259	Ga0373936_0010591	3300035113	Bacteria	3481
260	Ga0373945_0032367	3300035116	Bacteria	1852
261	Ga0373953_0152742	3300035117	Bacteria	990
262	Ga0373954_0121603	3300035118	Bacteria	1267
263	Ga0373956_0099223	3300035119	Bacteria	1349
264	Ga0373943_0028578	3300035170	Bacteria	2628
265	Ga0373946_0084996	3300035171	Bacteria	1392
266	Ga0373955_0091451	3300035172	Bacteria	1734
267	Ga0373924_0048121	3300035410	Bacteria	1760
268	Ga0373931_0108470	3300035691	Bacteria	1571
269	Ga0373935_0254571	3300035692	Bacteria	1229
270	Ga0373927_0045472	3300035695	Bacteria	2840
271	Ga0373933_0055355	3300035724	Bacteria	2379
272	Ga0373947_0001820	3300035725	Bacteria	13046
273	Ga0373925_0156601	3300037068	Bacteria	1792
274	Ga0451853_1884990	3300041512	Bacteria	968
275	Ga0495590_0023446	3300046457	Bacteria	2178
276	Ga0495629_0020241	3300046459	Bacteria	4751
277	Ga0495641_0109795	3300046461	Bacteria	1231
278	Ga0495651_0193094	3300046462	Bacteria	1431
279	Ga0495650_0151641	3300046471	Bacteria	832
280	Ga0495580_0000559	3300046472	Bacteria	31436
281	Ga0495582_0065929	3300046473	Bacteria	2000
282	Ga0495605_0043437	3300046474	Bacteria	2228
283	Ga0495662_0116613	3300046476	Bacteria	1309
284	Ga0495664_0116150	3300046477	Bacteria	1617
285	Ga0495584_0100633	3300046491	Bacteria	1461
286	Ga0495585_0091581	3300046492	Bacteria	1637
287	Ga0495585_0097218	3300046492	Bacteria	1579
288	Ga0495594_0255229	3300046499	Bacteria	999
289	Ga0495596_0030495	3300046500	Bacteria	2158
290	Ga0495606_0205206	3300046507	Bacteria	1120
291	Ga0495616_0089751	3300046513	Bacteria	1457
292	Ga0495618_0156283	3300046514	Bacteria	1455
293	Ga0495620_0163970	3300046515	Bacteria	863
294	Ga0495628_0151027	3300046516	Bacteria	1769
295	Ga0495632_0041132	3300046519	Bacteria	2323
296	Ga0495644_0026249	3300046523	Bacteria	2211
297	Ga0495648_0000704	3300046524	Bacteria	35656
298	Ga0495648_0130034	3300046524	Bacteria	1340
299	Ga0495666_0005819	3300046526	Bacteria	6218
300	Ga0495586_0045740	3300046535	Bacteria	2359
301	Ga0495587_0107352	3300046536	Bacteria	1605
302	Ga0495645_0202751	3300046543	Bacteria	1344
303	Ga0495622_0009300	3300046557	Bacteria	4547
304	Ga0495633_0102693	3300046558	Bacteria	1327
305	Ga0495667_0136632	3300046559	Bacteria	1580
306	Ga0495656_0009282	3300046615	Bacteria	3533
307	Ga0495656_0029754	3300046615	Bacteria	2201
308	Ga0495656_0116638	3300046615	Bacteria	1255
309	Ga0495668_0106258	3300046616	Bacteria	1535
310	Ga0495611_0138267	3300046648	Bacteria	1137
311	Ga0495625_0079649	3300046660	Bacteria	2283
312	Ga0495625_0346472	3300046660	Bacteria	940
313	Ga0495659_0030340	3300046664	Bacteria	1881
314	Ga0495661_0188177	3300046665	Bacteria	1089
315	Ga0495588_0014662	3300046674	Bacteria	3757
316	Ga0495588_0057732	3300046674	Bacteria	2005
317	Ga0495588_0326716	3300046674	Bacteria	807
318	Ga0495657_0225984	3300046675	Bacteria	1133
319	Ga0495623_0144740	3300046679	Bacteria	1410
320	Ga0495646_0025092	3300046680	Bacteria	3750
321	Ga0495658_0003445	3300046683	Bacteria	7826
322	Ga0495669_0069217	3300046684	Bacteria	1606
323	Ga0495613_0143252	3300046689	Bacteria	1706
324	Ga0495670_0071934	3300046691	Bacteria	1751
325	Ga0495670_0101648	3300046691	Bacteria	1481
326	Ga0495600_0353267	3300046809	Bacteria	920
327	Ga0495660_0177788	3300046810	Bacteria	1032
328	Ga0495604_0117669	3300047317	Bacteria	1927
329	Ga0495604_0386999	3300047317	Bacteria	923
330	Ga0495636_0029254	3300047318	Bacteria	2248
331	Ga0495674_0452263	3300047319	Bacteria	1032
332	Ga0495676_0017327	3300047321	Bacteria	6372
333	Ga0495680_0037702	3300047322	Bacteria	3871
334	Ga0495673_0068365	3300047469	Bacteria	1501
335	Ga0495684_0118752	3300047471	Bacteria	1992
336	Ga0495602_0315083	3300048088	Bacteria	1140
337	Ga0495615_0024510	3300048090	Bacteria	1393
338	Ga0496100_0062167	3300048903	Bacteria	2463
339	Ga0496101_0014070	3300048904	Bacteria	5375
340	Ga0496101_0250201	3300048904	Bacteria	1381
341	Ga0496101_0258979	3300048904	Bacteria	1356
342	Ga0496101_0261365	3300048904	Bacteria	1350
343	Ga0496102_0021974	3300048905	Bacteria	5650
344	Ga0496102_0071931	3300048905	Bacteria	3176
345	Ga0496102_0166005	3300048905	Bacteria	2077
346	Ga0496102_0199128	3300048905	Bacteria	1888
347	Ga0496102_0537052	3300048905	Bacteria	1092
348	Ga0496103_0106241	3300048906	Bacteria	1780
349	Ga0496103_0291199	3300048906	Bacteria	1050
350	Ga0496103_0435858	3300048906	Bacteria	841
351	Ga0496104_0016847	3300048907	Bacteria	6643
352	Ga0496104_0252304	3300048907	Bacteria	1677
353	Ga0496104_0333960	3300048907	Bacteria	1428
354	Ga0496104_1091115	3300048907	Unclassified	702
355	Ga0496105_0189631	3300048908	Bacteria	1681
356	Ga0496105_0209109	3300048908	Bacteria	1591
357	Ga0496105_0247350	3300048908	Bacteria	1445
358	Ga0496106_0045318	3300048909	Bacteria	3303
359	Ga0496106_0182150	3300048909	Bacteria	1668
360	Ga0496107_0002696	3300048910	Bacteria	11639
361	Ga0496107_0047648	3300048910	Bacteria	3086
362	Ga0496107_0279446	3300048910	Bacteria	1243
363	Ga0496108_0017733	3300048911	Bacteria	5822
364	Ga0496108_0056393	3300048911	Bacteria	3301
365	Ga0496108_0096053	3300048911	Bacteria	2524
366	Ga0496109_0032204	3300048912	Bacteria	4711
367	Ga0496109_0430526	3300048912	Bacteria	1246
368	Ga0496109_0555130	3300048912	Bacteria	1083
369	Ga0496109_0660420	3300048912	Bacteria	983
370	Ga0496110_0031099	3300048913	Bacteria	4604
371	Ga0496110_0117446	3300048913	Bacteria	2395
372	Ga0496110_0262854	3300048913	Bacteria	1571
373	Ga0496110_0507973	3300048913	Bacteria	1097
374	Ga0496111_0057087	3300048914	Bacteria	2826
375	Ga0496112_0048448	3300048915	Bacteria	4165
376	Ga0496112_0259769	3300048915	Bacteria	1686
377	Ga0496112_0273663	3300048915	Bacteria	1636
378	Ga0496113_0003559	3300048916	Bacteria	9347
379	Ga0496113_0078494	3300048916	Bacteria	2526
380	Ga0496113_0103034	3300048916	Bacteria	2213
381	Ga0496113_0454167	3300048916	Bacteria	1030
382	Ga0496114_0189385	3300048917	Bacteria	1799
383	Ga0496114_0691512	3300048917	Bacteria	895
384	Ga0496115_0000528	3300048918	Bacteria	29725
385	Ga0496115_0019092	3300048918	Bacteria	5271
386	Ga0496117_0283910	3300048920	Bacteria	885
387	Ga0496118_0120044	3300048921	Bacteria	1717
388	Ga0496119_0037072	3300048922	Bacteria	3173
389	Ga0496119_0090118	3300048922	Bacteria	1745
390	Ga0496119_0102855	3300048922	Bacteria	1601
391	Ga0496121_0018476	3300048924	Bacteria	7028
392	Ga0496121_0038503	3300048924	Bacteria	4232
393	Ga0496121_0099714	3300048924	Bacteria	2244
394	Ga0496121_0125779	3300048924	Bacteria	1927
395	Ga0496121_0129902	3300048924	Bacteria	1887
396	Ga0496121_0148278	3300048924	Bacteria	1730
397	Ga0496124_0030585	3300048927	Bacteria	4777
398	Ga0496124_0101395	3300048927	Bacteria	2332
399	Ga0496124_0299537	3300048927	Bacteria	1162
400	Ga0496125_0053488	3300048928	Bacteria	3309
401	Ga0496125_0177699	3300048928	Bacteria	1422
402	Ga0496126_0035303	3300048929	Bacteria	4687
403	Ga0496126_0047806	3300048929	Bacteria	3915
404	Ga0496126_0065917	3300048929	Bacteria	3239
405	Ga0496126_0098659	3300048929	Bacteria	2559
406	Ga0496126_0109502	3300048929	Bacteria	2407
407	Ga0496126_0209165	3300048929	Bacteria	1643
408	Ga0496126_0293386	3300048929	Bacteria	1344
409	Ga0496126_0302379	3300048929	Bacteria	1319
410	Ga0496126_0358454	3300048929	Bacteria	1191
411	Ga0496126_0388075	3300048929	Bacteria	1135
412	Ga0501031_0205344	3300049568	Bacteria	1285
413	Ga0501032_0135155	3300049569	Bacteria	1625
414	Ga0501034_0118893	3300049571	Bacteria	2629
415	Ga0501034_0157682	3300049571	Bacteria	2242
416	Ga0501036_0045531	3300049572	Bacteria	3716
417	Ga0501037_0108468	3300049573	Bacteria	2000
418	Ga0501037_0114793	3300049573	Bacteria	1938
419	Ga0501037_0391078	3300049573	Bacteria	954
420	Ga0501038_0001872	3300049574	Bacteria	19440
421	Ga0501040_0597019	3300049576	Bacteria	797
422	Ga0501042_0008574	3300049578	Bacteria	6762
423	Ga0501043_0034977	3300049579	Bacteria	3951
424	Ga0501043_0101725	3300049579	Bacteria	2258
425	Ga0501046_0312698	3300049580	Bacteria	1145
426	Ga0501046_0337037	3300049580	Bacteria	1096
427	Ga0501047_0061946	3300049581	Bacteria	3609
428	Ga0501047_0183671	3300049581	Bacteria	1957
429	Ga0501048_0083010	3300049582	Bacteria	2259
430	Ga0501067_0010315	3300049583	Bacteria	5170
431	Ga0501067_0327641	3300049583	Bacteria	853
432	Ga0501068_0153662	3300049584	Bacteria	1447
433	Ga0501068_0434091	3300049584	Bacteria	849
434	Ga0501069_0176841	3300049585	Bacteria	1233
435	Ga0501070_0024554	3300049586	Bacteria	5054
436	Ga0501071_0163023	3300049587	Bacteria	1667
437	Ga0501071_0260845	3300049587	Bacteria	1309
438	Ga0501072_0270410	3300049588	Bacteria	1352
439	Ga0501072_0312785	3300049588	Bacteria	1248
440	Ga0501073_0150474	3300049589	Bacteria	1613
441	Ga0501073_0343437	3300049589	Bacteria	1030
442	Ga0501074_0012924	3300049590	Bacteria	6069
443	Ga0501079_0104905	3300049741	Bacteria	2193
444	Ga0501080_0029306	3300049742	Bacteria	5123
445	Ga0501080_0765563	3300049742	Bacteria	848
446	Ga0501083_0099014	3300049744	Bacteria	1923
447	Ga0501035_0107348	3300049822	Bacteria	2447
448	Ga0501044_0009711	3300049823	Bacteria	10469
449	Ga0501044_0013605	3300049823	Bacteria	8794
450	Ga0501044_0462101	3300049823	Bacteria	1174
451	Ga0501044_0790052	3300049823	Bacteria	829
452	Ga0501045_0181410	3300049824	Bacteria	1568
453	Ga0501045_0226443	3300049824	Bacteria	1392
454	nmdc:mga03683_290649_c1	3300050489	Bacteria	765
455	nmdc:mga03683_305812_c1	3300050489	Unclassified	746
456	nmdc:mga03683_92023_c1	3300050489	Bacteria	1323
457	nmdc:mga03n38_23842_c1	3300050490	Bacteria	2495
458	nmdc:mga03n38_5300_c1	3300050490	Bacteria	4377
459	nmdc:mga03n38_7478_c1	3300050490	Bacteria	3869
460	nmdc:mga0yw44_105183_c1	3300050492	Bacteria	1803
461	nmdc:mga0yw44_17381_c1	3300050492	Bacteria	3912
462	nmdc:mga0yw44_47987_c1	3300050492	Bacteria	2573
463	nmdc:mga0k408_16415_c1	3300050493	Bacteria	4109
464	nmdc:mga0k408_31166_c1	3300050493	Bacteria	3043
465	nmdc:mga06z11_112422_c1	3300050494	Bacteria	1510
466	nmdc:mga06z11_160642_c1	3300050494	Unclassified	1284
467	nmdc:mga06z11_241086_c1	3300050494	Bacteria	1062
468	nmdc:mga04h51_137469_c1	3300050495	Bacteria	924
469	nmdc:mga04h51_34424_c1	3300050495	Bacteria	1618
470	nmdc:mga04h51_37374_c1	3300050495	Bacteria	1567
471	nmdc:mga04h51_63552_c1	3300050495	Bacteria	1271
472	nmdc:mga07m45_13925_c1	3300050496	Bacteria	4274
473	nmdc:mga07m45_156981_c1	3300050496	Bacteria	1320
474	nmdc:mga07m45_2979_c1	3300050496	Bacteria	7711
475	nmdc:mga05p37_277522_c1	3300050507	Bacteria	2000
476	nmdc:mga08y16_210117_c1	3300050511	Bacteria	2016
477	nmdc:mga0n895_115774_c1	3300050512	Bacteria	2699
478	nmdc:mga0sz30_14548_c1	3300050516	Bacteria	3099
479	nmdc:mga0sz30_19073_c1	3300050516	Bacteria	2751
480	Ga0495601_0099971	3300053077	Bacteria	1873
481	Ga0495612_0051110	3300053078	Bacteria	1698
482	Ga0495612_0108762	3300053078	Bacteria	1185
483	Ga0495619_0081385	3300053085	Bacteria	2180
484	Ga0495619_0302292	3300053085	Bacteria	1108
485	Ga0500643_016450	3300053087	Bacteria	2505
486	Ga0500583_0180878	3300053092	Bacteria	1050
487	Ga0500651_0137891	3300053093	Bacteria	1472
488	Ga0500566_0230529	3300053094	Bacteria	914
489	Ga0500650_0160173	3300053098	Bacteria	1038
490	Ga0500562_009908	3300053108	Bacteria	2410
491	Ga0500595_012482	3300053119	Bacteria	3284
492	Ga0500642_0137582	3300053130	Bacteria	1145
493	Ga0500561_0078724	3300053137	Bacteria	957
494	Ga0500638_112554	3300053162	Bacteria	1255
495	Ga0500636_0266062	3300053177	Bacteria	865
496	Ga0500645_058138	3300053730	Bacteria	1121
497	Ga0587069_037758	3300059642	Bacteria	811
498	Ga0501082_0062824	3300060353	Bacteria	3197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046472	Ga0495580_0000559	Ga0495580_0000559_30682_31335	194
2	3300046473	Ga0495582_0065929	Ga0495582_0065929_80_733	194
3	3300046477	Ga0495664_0116150	Ga0495664_0116150_945_1598	194
4	3300046526	Ga0495666_0005819	Ga0495666_0005819_20_673	194
5	3300048088	Ga0495602_0315083	Ga0495602_0315083_420_1073	194
6	3300053085	Ga0495619_0081385	Ga0495619_0081385_80_733	194
7	3300053177	Ga0500636_0266062	Ga0500636_0266062_137_790	194
8	3300026088	Ga0207641_10626719	Ga0207641_106267191	197
9	3300005436	Ga0070713_100049243	Ga0070713_1000492432	201
10	3300050489	nmdc:mga03683_290649_c1	nmdc:mga03683_290649_c1_25_708	206
11	3300005548	Ga0070665_100031074	Ga0070665_1000310745	208
12	3300006048	Ga0075363_100010783	Ga0075363_1000107834	208
13	3300006178	Ga0075367_10372434	Ga0075367_103724341	208
14	3300048907	Ga0496104_1091115	Ga0496104_1091115_42_686	208
15	3300050489	nmdc:mga03683_305812_c1	nmdc:mga03683_305812_c1_23_667	208
16	3300035113	Ga0373936_0010591	Ga0373936_0010591_1409_2164	209
17	3300035116	Ga0373945_0032367	Ga0373945_0032367_659_1414	209
18	3300035170	Ga0373943_0028578	Ga0373943_0028578_1416_2171	209
19	3300035724	Ga0373933_0055355	Ga0373933_0055355_62_817	209
20	3300046459	Ga0495629_0020241	Ga0495629_0020241_225_980	209
21	3300046516	Ga0495628_0151027	Ga0495628_0151027_542_1297	209
22	3300046559	Ga0495667_0136632	Ga0495667_0136632_51_806	209
23	3300046674	Ga0495588_0057732	Ga0495588_0057732_202_957	209
24	3300046679	Ga0495623_0144740	Ga0495623_0144740_146_901	209
25	3300046683	Ga0495658_0003445	Ga0495658_0003445_1610_2365	209
26	3300047317	Ga0495604_0117669	Ga0495604_0117669_529_1284	209
27	3300047322	Ga0495680_0037702	Ga0495680_0037702_2489_3244	209
28	3300053078	Ga0495612_0051110	Ga0495612_0051110_820_1575	209
29	3300048920	Ga0496117_0283910	Ga0496117_0283910_19_654	210
30	3300050494	nmdc:mga06z11_241086_c1	nmdc:mga06z11_241086_c1_51_695	210
31	3300049573	Ga0501037_0391078	Ga0501037_0391078_293_934	211
32	3300049576	Ga0501040_0597019	Ga0501040_0597019_120_761	211
33	3300049580	Ga0501046_0312698	Ga0501046_0312698_484_1125	211
34	3300049823	Ga0501044_0462101	Ga0501044_0462101_21_662	211
35	3300035691	Ga0373931_0108470	Ga0373931_0108470_874_1527	212
36	3300041512	Ga0451853_1884990	Ga0451853_1884990_293_931	212
37	3300048904	Ga0496101_0258979	Ga0496101_0258979_656_1309	212
38	3300048912	Ga0496109_0660420	Ga0496109_0660420_87_740	212
39	3300048915	Ga0496112_0273663	Ga0496112_0273663_944_1597	212
40	3300049580	Ga0501046_0337037	Ga0501046_0337037_21_674	213
41	3300046664	Ga0495659_0030340	Ga0495659_0030340_26_697	217
42	3300009176	Ga0105242_10851868	Ga0105242_108518681	218
43	3300046476	Ga0495662_0116613	Ga0495662_0116613_58_819	220
44	3300046543	Ga0495645_0202751	Ga0495645_0202751_177_938	220
45	3300046689	Ga0495613_0143252	Ga0495613_0143252_86_847	220
46	3300025898	Ga0207692_10367750	Ga0207692_103677501	223
47	3300048922	Ga0496119_0037072	Ga0496119_0037072_2336_3091	226
48	3300006177	Ga0075362_10113641	Ga0075362_101136412	227
49	3300009094	Ga0111539_10009524	Ga0111539_100095249	227
50	3300025261	Ga0209233_1006705	Ga0209233_10067051	227
51	3300027907	Ga0207428_10026819	Ga0207428_100268196	227
52	3300050489	nmdc:mga03683_92023_c1	nmdc:mga03683_92023_c1_327_1085	227
53	3300050511	nmdc:mga08y16_210117_c1	nmdc:mga08y16_210117_c1_795_1553	227
54	3300005437	Ga0070710_10435944	Ga0070710_104359441	228
55	3300006177	Ga0075362_10062572	Ga0075362_100625721	228
56	3300031507	Ga0307509_10389419	Ga0307509_103894191	228
57	3300035089	Ga0373944_0131055	Ga0373944_0131055_50_811	228
58	3300035111	Ga0373923_0014069	Ga0373923_0014069_1105_1866	228
59	3300035117	Ga0373953_0152742	Ga0373953_0152742_193_954	228
60	3300035118	Ga0373954_0121603	Ga0373954_0121603_314_1075	228
61	3300035119	Ga0373956_0099223	Ga0373956_0099223_198_959	228
62	3300035171	Ga0373946_0084996	Ga0373946_0084996_483_1244	228
63	3300035172	Ga0373955_0091451	Ga0373955_0091451_681_1442	228
64	3300035410	Ga0373924_0048121	Ga0373924_0048121_426_1187	228
65	3300035692	Ga0373935_0254571	Ga0373935_0254571_431_1192	228
66	3300035725	Ga0373947_0001820	Ga0373947_0001820_12063_12824	228
67	3300046462	Ga0495651_0193094	Ga0495651_0193094_198_959	228
68	3300046514	Ga0495618_0156283	Ga0495618_0156283_229_990	228
69	3300046535	Ga0495586_0045740	Ga0495586_0045740_500_1261	228
70	3300046536	Ga0495587_0107352	Ga0495587_0107352_544_1305	228
71	3300046557	Ga0495622_0009300	Ga0495622_0009300_1803_2564	228
72	3300046675	Ga0495657_0225984	Ga0495657_0225984_355_1116	228
73	3300046680	Ga0495646_0025092	Ga0495646_0025092_2261_3022	228
74	3300046809	Ga0495600_0353267	Ga0495600_0353267_80_841	228
75	3300047471	Ga0495684_0118752	Ga0495684_0118752_842_1603	228
76	3300048924	Ga0496121_0038503	Ga0496121_0038503_2774_3526	228
77	3300048929	Ga0496126_0109502	Ga0496126_0109502_1287_2039	228
78	3300053077	Ga0495601_0099971	Ga0495601_0099971_327_1088	228
79	3300053094	Ga0500566_0230529	Ga0500566_0230529_17_778	228
80	3300004800	Ga0058861_11443412	Ga0058861_114434121	229
81	3300004803	Ga0058862_12448629	Ga0058862_124486291	229
82	3300005336	Ga0070680_100138859	Ga0070680_1001388591	229
83	3300005337	Ga0070682_100066797	Ga0070682_1000667973	229
84	3300005455	Ga0070663_100406639	Ga0070663_1004066392	229
85	3300005457	Ga0070662_100242626	Ga0070662_1002426262	229
86	3300005458	Ga0070681_10015034	Ga0070681_100150344	229
87	3300005530	Ga0070679_100074282	Ga0070679_1000742824	229
88	3300005547	Ga0070693_100084888	Ga0070693_1000848882	229
89	3300005718	Ga0068866_10143503	Ga0068866_101435032	229
90	3300005719	Ga0068861_100119106	Ga0068861_1001191063	229
91	3300006358	Ga0068871_100099088	Ga0068871_1000990883	229
92	3300009093	Ga0105240_10119111	Ga0105240_101191112	229
93	3300009545	Ga0105237_10691211	Ga0105237_106912111	229
94	3300010375	Ga0105239_10695548	Ga0105239_106955481	229
95	3300014326	Ga0157380_10241850	Ga0157380_102418502	229
96	3300017792	Ga0163161_10148926	Ga0163161_101489262	229
97	3300025912	Ga0207707_10002162	Ga0207707_1000216216	229
98	3300025913	Ga0207695_10085563	Ga0207695_100855632	229
99	3300025917	Ga0207660_10123159	Ga0207660_101231591	229
100	3300026118	Ga0207675_100042132	Ga0207675_1000421322	229
101	3300047319	Ga0495674_0452263	Ga0495674_0452263_72_827	229
102	3300048905	Ga0496102_0537052	Ga0496102_0537052_326_1081	229
103	3300005842	Ga0068858_100361388	Ga0068858_1003613881	230
104	3300005937	Ga0081455_10286371	Ga0081455_102863712	230
105	3300006163	Ga0070715_10005242	Ga0070715_100052425	230
106	3300006175	Ga0070712_100010605	Ga0070712_1000106052	230
107	3300025915	Ga0207693_10036440	Ga0207693_100364405	230
108	3300025919	Ga0207657_10198570	Ga0207657_101985702	230
109	3300025928	Ga0207700_10025832	Ga0207700_100258321	230
110	3300048929	Ga0496126_0065917	Ga0496126_0065917_2003_2770	230
111	3300046691	Ga0495670_0101648	Ga0495670_0101648_379_1149	231
112	3300005983	Ga0081540_1065707	Ga0081540_10657072	232
113	3300006173	Ga0070716_100031880	Ga0070716_1000318803	234
114	3300049823	Ga0501044_0009711	Ga0501044_0009711_2873_3694	234
115	3300046524	Ga0495648_0000704	Ga0495648_0000704_19672_20421	236
116	3300053730	Ga0500645_058138	Ga0500645_058138_359_1108	236
117	iso_pu_bacteria	2879110137	2879118328	236
118	3300049568	Ga0501031_0205344	Ga0501031_0205344_452_1198	237
119	3300049569	Ga0501032_0135155	Ga0501032_0135155_418_1164	237
120	3300049571	Ga0501034_0118893	Ga0501034_0118893_872_1618	237
121	3300049572	Ga0501036_0045531	Ga0501036_0045531_2469_3215	237
122	3300049573	Ga0501037_0108468	Ga0501037_0108468_762_1508	237
123	3300049574	Ga0501038_0001872	Ga0501038_0001872_8223_9092	237
124	3300049579	Ga0501043_0034977	Ga0501043_0034977_606_1352	237
125	3300049581	Ga0501047_0183671	Ga0501047_0183671_361_1230	237
126	3300049583	Ga0501067_0327641	Ga0501067_0327641_31_777	237
127	3300049585	Ga0501069_0176841	Ga0501069_0176841_209_943	237
128	3300049587	Ga0501071_0163023	Ga0501071_0163023_99_845	237
129	3300049588	Ga0501072_0312785	Ga0501072_0312785_129_875	237
130	3300049589	Ga0501073_0150474	Ga0501073_0150474_56_802	237
131	3300049742	Ga0501080_0765563	Ga0501080_0765563_90_836	237
132	3300049823	Ga0501044_0013605	Ga0501044_0013605_6687_7433	237
133	3300049824	Ga0501045_0226443	Ga0501045_0226443_343_1089	237
134	iso_pu_bacteria	8056673599	8056674329	237
135	3300028380	Ga0268265_10121690	Ga0268265_101216902	238
136	3300031507	Ga0307509_10277303	Ga0307509_102773032	238
137	3300033180	Ga0307510_10033831	Ga0307510_100338312	238
138	3300048906	Ga0496103_0435858	Ga0496103_0435858_49_786	238
139	3300048917	Ga0496114_0691512	Ga0496114_0691512_128_871	238
140	3300048927	Ga0496124_0299537	Ga0496124_0299537_24_743	238
141	3300048929	Ga0496126_0209165	Ga0496126_0209165_258_995	238
142	3300005983	Ga0081540_1029837	Ga0081540_10298372	239
143	3300010375	Ga0105239_10386339	Ga0105239_103863391	239
144	3300025933	Ga0207706_10114346	Ga0207706_101143462	239
145	3300031507	Ga0307509_10100712	Ga0307509_101007121	239
146	3300033180	Ga0307510_10114763	Ga0307510_101147632	239
147	3300046457	Ga0495590_0023446	Ga0495590_0023446_924_1682	239
148	3300046471	Ga0495650_0151641	Ga0495650_0151641_46_786	239
149	3300046474	Ga0495605_0043437	Ga0495605_0043437_952_1710	239
150	3300046492	Ga0495585_0097218	Ga0495585_0097218_187_945	239
151	3300046499	Ga0495594_0255229	Ga0495594_0255229_20_841	239
152	3300046500	Ga0495596_0030495	Ga0495596_0030495_939_1697	239
153	3300046507	Ga0495606_0205206	Ga0495606_0205206_115_873	239
154	3300046515	Ga0495620_0163970	Ga0495620_0163970_86_844	239
155	3300046519	Ga0495632_0041132	Ga0495632_0041132_455_1213	239
156	3300046523	Ga0495644_0026249	Ga0495644_0026249_338_1096	239
157	3300046524	Ga0495648_0130034	Ga0495648_0130034_265_1023	239
158	3300046558	Ga0495633_0102693	Ga0495633_0102693_323_1081	239
159	3300046615	Ga0495656_0029754	Ga0495656_0029754_1398_2156	239
160	3300046615	Ga0495656_0116638	Ga0495656_0116638_49_807	239
161	3300046616	Ga0495668_0106258	Ga0495668_0106258_453_1211	239
162	3300046660	Ga0495625_0079649	Ga0495625_0079649_12_752	239
163	3300046674	Ga0495588_0014662	Ga0495588_0014662_910_1668	239
164	3300046684	Ga0495669_0069217	Ga0495669_0069217_53_811	239
165	3300046691	Ga0495670_0071934	Ga0495670_0071934_207_965	239
166	3300047321	Ga0495676_0017327	Ga0495676_0017327_2207_2965	239
167	3300047469	Ga0495673_0068365	Ga0495673_0068365_364_1122	239
168	3300048921	Ga0496118_0120044	Ga0496118_0120044_400_1248	239
169	3300048924	Ga0496121_0099714	Ga0496121_0099714_912_1670	239
170	3300048929	Ga0496126_0035303	Ga0496126_0035303_391_1137	239
171	3300053087	Ga0500643_016450	Ga0500643_016450_453_1211	239
172	3300053092	Ga0500583_0180878	Ga0500583_0180878_193_933	239
173	3300053093	Ga0500651_0137891	Ga0500651_0137891_97_855	239
174	3300053098	Ga0500650_0160173	Ga0500650_0160173_118_876	239
175	3300053108	Ga0500562_009908	Ga0500562_009908_839_1597	239
176	3300053119	Ga0500595_012482	Ga0500595_012482_1609_2415	239
177	3300005334	Ga0068869_100008382	Ga0068869_1000083823	240
178	3300005617	Ga0068859_100092818	Ga0068859_1000928183	240
179	3300006048	Ga0075363_100230634	Ga0075363_1002306341	240
180	3300006051	Ga0075364_10029856	Ga0075364_100298565	240
181	3300006186	Ga0075369_10024525	Ga0075369_100245253	240
182	3300006195	Ga0075366_10166331	Ga0075366_101663313	240
183	3300006844	Ga0075428_100060888	Ga0075428_1000608882	240
184	3300006931	Ga0097620_100092810	Ga0097620_1000928103	240
185	3300013308	Ga0157375_10665246	Ga0157375_106652461	240
186	3300025942	Ga0207689_10041830	Ga0207689_100418302	240
187	3300047317	Ga0495604_0386999	Ga0495604_0386999_56_823	240
188	3300048924	Ga0496121_0018476	Ga0496121_0018476_4859_5710	240
189	3300048927	Ga0496124_0101395	Ga0496124_0101395_1475_2218	240
190	3300048929	Ga0496126_0098659	Ga0496126_0098659_142_963	240
191	3300050492	nmdc:mga0yw44_105183_c1	nmdc:mga0yw44_105183_c1_794_1555	240
192	3300050493	nmdc:mga0k408_16415_c1	nmdc:mga0k408_16415_c1_1763_2524	240
193	3300050507	nmdc:mga05p37_277522_c1	nmdc:mga05p37_277522_c1_48_809	240
194	3300050516	nmdc:mga0sz30_14548_c1	nmdc:mga0sz30_14548_c1_321_1082	240
195	iso_pu_bacteria	2879110137	2879114995	240
196	3300005334	Ga0068869_100008382	Ga0068869_1000083825	241
197	3300005353	Ga0070669_100230528	Ga0070669_1002305281	241
198	3300005617	Ga0068859_100151769	Ga0068859_1001517693	241
199	3300005843	Ga0068860_100065598	Ga0068860_1000655983	241
200	3300005844	Ga0068862_100032186	Ga0068862_1000321862	241
201	3300006931	Ga0097620_100151766	Ga0097620_1001517661	241
202	3300009148	Ga0105243_10617793	Ga0105243_106177931	241
203	3300014326	Ga0157380_10529232	Ga0157380_105292321	241
204	3300025942	Ga0207689_10041830	Ga0207689_100418304	241
205	3300026023	Ga0207677_10046794	Ga0207677_100467943	241
206	3300026075	Ga0207708_10107124	Ga0207708_101071241	241
207	3300028381	Ga0268264_10159341	Ga0268264_101593411	241
208	3300048924	Ga0496121_0018476	Ga0496121_0018476_2997_3764	241
209	3300048927	Ga0496124_0030585	Ga0496124_0030585_2410_3177	241
210	3300048928	Ga0496125_0177699	Ga0496125_0177699_354_1121	241
211	3300048929	Ga0496126_0047806	Ga0496126_0047806_74_841	241
212	3300026089	Ga0207648_10121738	Ga0207648_101217383	242
213	3300005334	Ga0068869_100008382	Ga0068869_1000083824	243
214	3300005338	Ga0068868_100096360	Ga0068868_1000963603	243
215	3300005347	Ga0070668_100157731	Ga0070668_1001577312	243
216	3300005365	Ga0070688_100132267	Ga0070688_1001322672	243
217	3300005456	Ga0070678_100061778	Ga0070678_1000617782	243
218	3300005617	Ga0068859_100092818	Ga0068859_1000928184	243
219	3300005719	Ga0068861_100391303	Ga0068861_1003913032	243
220	3300005843	Ga0068860_100065598	Ga0068860_1000655982	243
221	3300005844	Ga0068862_100433024	Ga0068862_1004330242	243
222	3300006931	Ga0097620_100092810	Ga0097620_1000928104	243
223	3300009101	Ga0105247_10253327	Ga0105247_102533272	243
224	3300009553	Ga0105249_10414271	Ga0105249_104142711	243
225	3300025942	Ga0207689_10041830	Ga0207689_100418303	243
226	3300025972	Ga0207668_10246919	Ga0207668_102469192	243
227	3300026023	Ga0207677_10046794	Ga0207677_100467942	243
228	3300026118	Ga0207675_100536621	Ga0207675_1005366211	243
229	3300026121	Ga0207683_10137547	Ga0207683_101375472	243
230	3300028380	Ga0268265_10126272	Ga0268265_101262722	243
231	3300028381	Ga0268264_10596313	Ga0268264_105963131	243
232	3300048905	Ga0496102_0199128	Ga0496102_0199128_384_1136	243
233	3300048922	Ga0496119_0090118	Ga0496119_0090118_546_1319	243
234	3300048924	Ga0496121_0018476	Ga0496121_0018476_3968_4741	243
235	3300048927	Ga0496124_0101395	Ga0496124_0101395_475_1248	243
236	3300048929	Ga0496126_0302379	Ga0496126_0302379_251_1024	243
237	3300005437	Ga0070710_10243133	Ga0070710_102431331	244
238	3300005439	Ga0070711_100074898	Ga0070711_1000748982	244
239	3300009098	Ga0105245_10199301	Ga0105245_101993012	244
240	3300009545	Ga0105237_10158435	Ga0105237_101584353	244
241	3300013306	Ga0163162_10182452	Ga0163162_101824522	244
242	3300013306	Ga0163162_10682930	Ga0163162_106829301	244
243	3300025916	Ga0207663_10138308	Ga0207663_101383082	244
244	3300025934	Ga0207686_10475486	Ga0207686_104754861	244
245	3300026089	Ga0207648_10507615	Ga0207648_105076151	244
246	3300028379	Ga0268266_10137282	Ga0268266_101372823	244
247	3300048904	Ga0496101_0250201	Ga0496101_0250201_351_1088	244
248	3300048910	Ga0496107_0279446	Ga0496107_0279446_125_877	244
249	3300048913	Ga0496110_0507973	Ga0496110_0507973_19_813	244
250	3300049571	Ga0501034_0157682	Ga0501034_0157682_1201_1950	244
251	3300049578	Ga0501042_0008574	Ga0501042_0008574_1459_2208	244
252	3300049581	Ga0501047_0061946	Ga0501047_0061946_742_1491	244
253	3300049582	Ga0501048_0083010	Ga0501048_0083010_826_1575	244
254	3300049583	Ga0501067_0010315	Ga0501067_0010315_1025_1774	244
255	3300049584	Ga0501068_0153662	Ga0501068_0153662_110_859	244
256	3300049586	Ga0501070_0024554	Ga0501070_0024554_335_1084	244
257	3300049588	Ga0501072_0270410	Ga0501072_0270410_269_1018	244
258	3300049589	Ga0501073_0343437	Ga0501073_0343437_92_841	244
259	3300049590	Ga0501074_0012924	Ga0501074_0012924_567_1316	244
260	3300049741	Ga0501079_0104905	Ga0501079_0104905_445_1194	244
261	3300049742	Ga0501080_0029306	Ga0501080_0029306_1759_2508	244
262	3300049744	Ga0501083_0099014	Ga0501083_0099014_975_1724	244
263	3300049822	Ga0501035_0107348	Ga0501035_0107348_721_1470	244
264	3300049824	Ga0501045_0181410	Ga0501045_0181410_677_1426	244
265	3300050490	nmdc:mga03n38_7478_c1	nmdc:mga03n38_7478_c1_2224_3006	244
266	3300050494	nmdc:mga06z11_160642_c1	nmdc:mga06z11_160642_c1_343_1125	244
267	3300050496	nmdc:mga07m45_13925_c1	nmdc:mga07m45_13925_c1_2586_3368	244
268	3300053162	Ga0500638_112554	Ga0500638_112554_374_1123	244
269	3300060353	Ga0501082_0062824	Ga0501082_0062824_1561_2310	244
270	iso_pu_bacteria	8056673599	8056674328	244
271	3300005327	Ga0070658_10070632	Ga0070658_100706325	245
272	3300005329	Ga0070683_100127147	Ga0070683_1001271472	245
273	3300005338	Ga0068868_100043836	Ga0068868_1000438362	245
274	3300005339	Ga0070660_100334906	Ga0070660_1003349061	245
275	3300005365	Ga0070688_100262462	Ga0070688_1002624622	245
276	3300005455	Ga0070663_100022711	Ga0070663_1000227115	245
277	3300005455	Ga0070663_100171273	Ga0070663_1001712731	245
278	3300005456	Ga0070678_100037525	Ga0070678_1000375252	245
279	3300005456	Ga0070678_100300980	Ga0070678_1003009801	245
280	3300005458	Ga0070681_10069727	Ga0070681_100697271	245
281	3300005563	Ga0068855_100039308	Ga0068855_1000393087	245
282	3300005564	Ga0070664_100142603	Ga0070664_1001426033	245
283	3300005564	Ga0070664_100240059	Ga0070664_1002400593	245
284	3300005614	Ga0068856_100238800	Ga0068856_1002388003	245
285	3300005618	Ga0068864_100261950	Ga0068864_1002619502	245
286	3300006038	Ga0075365_10021759	Ga0075365_100217593	245
287	3300006048	Ga0075363_100085816	Ga0075363_1000858161	245
288	3300006237	Ga0097621_100494965	Ga0097621_1004949651	245
289	3300006353	Ga0075370_10046411	Ga0075370_100464111	245
290	3300009093	Ga0105240_10159151	Ga0105240_101591514	245
291	3300009098	Ga0105245_10539791	Ga0105245_105397912	245
292	3300009148	Ga0105243_10162160	Ga0105243_101621602	245
293	3300009148	Ga0105243_10508335	Ga0105243_105083352	245
294	3300009176	Ga0105242_10087066	Ga0105242_100870662	245
295	3300009176	Ga0105242_10191491	Ga0105242_101914912	245
296	3300009545	Ga0105237_10250633	Ga0105237_102506332	245
297	3300009551	Ga0105238_10154207	Ga0105238_101542073	245
298	3300010375	Ga0105239_10043742	Ga0105239_100437425	245
299	3300010375	Ga0105239_10495767	Ga0105239_104957671	245
300	3300011119	Ga0105246_10054288	Ga0105246_100542884	245
301	3300013104	Ga0157370_10073536	Ga0157370_100735363	245
302	3300013296	Ga0157374_10202520	Ga0157374_102025201	245
303	3300013306	Ga0163162_10157862	Ga0163162_101578623	245
304	3300013308	Ga0157375_10382866	Ga0157375_103828662	245
305	3300014325	Ga0163163_10024600	Ga0163163_100246002	245
306	3300014325	Ga0163163_10038391	Ga0163163_100383915	245
307	3300014969	Ga0157376_10015165	Ga0157376_100151653	245
308	3300025901	Ga0207688_10049588	Ga0207688_100495883	245
309	3300025904	Ga0207647_10139276	Ga0207647_101392762	245
310	3300025909	Ga0207705_10225415	Ga0207705_102254151	245
311	3300025912	Ga0207707_10145052	Ga0207707_101450524	245
312	3300025913	Ga0207695_10095631	Ga0207695_100956313	245
313	3300025914	Ga0207671_10191264	Ga0207671_101912642	245
314	3300025917	Ga0207660_10107392	Ga0207660_101073923	245
315	3300025919	Ga0207657_10305076	Ga0207657_103050762	245
316	3300025927	Ga0207687_10359277	Ga0207687_103592771	245
317	3300025935	Ga0207709_10353963	Ga0207709_103539631	245
318	3300025941	Ga0207711_10466237	Ga0207711_104662371	245
319	3300025945	Ga0207679_10119152	Ga0207679_101191522	245
320	3300025945	Ga0207679_10245054	Ga0207679_102450541	245
321	3300025949	Ga0207667_10379588	Ga0207667_103795882	245
322	3300025972	Ga0207668_10280264	Ga0207668_102802643	245
323	3300026067	Ga0207678_10037513	Ga0207678_100375134	245
324	3300026067	Ga0207678_10062140	Ga0207678_100621403	245
325	3300026067	Ga0207678_10086132	Ga0207678_100861323	245
326	3300026067	Ga0207678_10136552	Ga0207678_101365522	245
327	3300026078	Ga0207702_10396838	Ga0207702_103968382	245
328	3300026095	Ga0207676_10115594	Ga0207676_101155943	245
329	3300026121	Ga0207683_10249018	Ga0207683_102490182	245
330	3300028379	Ga0268266_10099824	Ga0268266_100998242	245
331	3300028379	Ga0268266_10100198	Ga0268266_101001983	245
332	3300031730	Ga0307516_10025905	Ga0307516_100259053	245
333	3300031730	Ga0307516_10113558	Ga0307516_101135583	245
334	3300035695	Ga0373927_0045472	Ga0373927_0045472_434_1186	245
335	3300037068	Ga0373925_0156601	Ga0373925_0156601_445_1197	245
336	3300046674	Ga0495588_0326716	Ga0495588_0326716_41_784	245
337	3300046810	Ga0495660_0177788	Ga0495660_0177788_44_787	245
338	3300048903	Ga0496100_0062167	Ga0496100_0062167_1544_2287	245
339	3300048904	Ga0496101_0014070	Ga0496101_0014070_753_1496	245
340	3300048905	Ga0496102_0021974	Ga0496102_0021974_874_1617	245
341	3300048905	Ga0496102_0071931	Ga0496102_0071931_1077_1829	245
342	3300048906	Ga0496103_0106241	Ga0496103_0106241_253_996	245
343	3300048906	Ga0496103_0291199	Ga0496103_0291199_61_813	245
344	3300048907	Ga0496104_0016847	Ga0496104_0016847_2423_3166	245
345	3300048907	Ga0496104_0333960	Ga0496104_0333960_499_1251	245
346	3300048908	Ga0496105_0189631	Ga0496105_0189631_403_1146	245
347	3300048908	Ga0496105_0209109	Ga0496105_0209109_137_1006	245
348	3300048908	Ga0496105_0247350	Ga0496105_0247350_401_1153	245
349	3300048909	Ga0496106_0045318	Ga0496106_0045318_1823_2692	245
350	3300048909	Ga0496106_0182150	Ga0496106_0182150_225_977	245
351	3300048910	Ga0496107_0002696	Ga0496107_0002696_10762_11505	245
352	3300048910	Ga0496107_0047648	Ga0496107_0047648_2104_2856	245
353	3300048911	Ga0496108_0017733	Ga0496108_0017733_4953_5696	245
354	3300048911	Ga0496108_0096053	Ga0496108_0096053_959_1711	245
355	3300048912	Ga0496109_0032204	Ga0496109_0032204_3498_4241	245
356	3300048912	Ga0496109_0430526	Ga0496109_0430526_383_1135	245
357	3300048913	Ga0496110_0031099	Ga0496110_0031099_3453_4205	245
358	3300048913	Ga0496110_0117446	Ga0496110_0117446_1330_2073	245
359	3300048914	Ga0496111_0057087	Ga0496111_0057087_1398_2141	245
360	3300048915	Ga0496112_0048448	Ga0496112_0048448_2882_3625	245
361	3300048916	Ga0496113_0003559	Ga0496113_0003559_2944_3687	245
362	3300048916	Ga0496113_0103034	Ga0496113_0103034_835_1587	245
363	3300048916	Ga0496113_0454167	Ga0496113_0454167_41_913	245
364	3300048917	Ga0496114_0189385	Ga0496114_0189385_718_1461	245
365	3300048918	Ga0496115_0000528	Ga0496115_0000528_22699_23442	245
366	3300048918	Ga0496115_0019092	Ga0496115_0019092_597_1349	245
367	3300049823	Ga0501044_0790052	Ga0501044_0790052_48_800	245
368	3300050490	nmdc:mga03n38_5300_c1	nmdc:mga03n38_5300_c1_1255_2124	245
369	3300050492	nmdc:mga0yw44_17381_c1	nmdc:mga0yw44_17381_c1_2361_3230	245
370	3300050495	nmdc:mga04h51_63552_c1	nmdc:mga04h51_63552_c1_261_1019	245
371	3300050496	nmdc:mga07m45_156981_c1	nmdc:mga07m45_156981_c1_389_1147	245
372	3300050496	nmdc:mga07m45_2979_c1	nmdc:mga07m45_2979_c1_4722_5591	245
373	3300053085	Ga0495619_0302292	Ga0495619_0302292_315_1067	245
374	iso_pu_bacteria	2922361189	2922368261	245
375	3300005466	Ga0070685_10231016	Ga0070685_102310161	246
376	3300007788	Ga0099795_10036681	Ga0099795_100366811	246
377	3300031730	Ga0307516_10002141	Ga0307516_1000214129	246
378	3300031730	Ga0307516_10047713	Ga0307516_100477134	246
379	3300046461	Ga0495641_0109795	Ga0495641_0109795_33_782	246
380	3300046660	Ga0495625_0346472	Ga0495625_0346472_90_842	246
381	3300048090	Ga0495615_0024510	Ga0495615_0024510_576_1328	246
382	3300049573	Ga0501037_0114793	Ga0501037_0114793_1088_1849	246
383	3300049579	Ga0501043_0101725	Ga0501043_0101725_461_1222	246
384	3300049587	Ga0501071_0260845	Ga0501071_0260845_47_808	246
385	3300053078	Ga0495612_0108762	Ga0495612_0108762_10_777	246
386	3300005937	Ga0081455_10003916	Ga0081455_100039165	247
387	3300013306	Ga0163162_10462341	Ga0163162_104623411	247
388	3300048924	Ga0496121_0148278	Ga0496121_0148278_522_1268	247
389	3300049584	Ga0501068_0434091	Ga0501068_0434091_81_827	247
390	3300059642	Ga0587069_037758	Ga0587069_037758_11_760	247
391	3300003659	JGI25404J52841_10002719	JGI25404J52841_100027192	248
392	3300005334	Ga0068869_100041926	Ga0068869_1000419262	248
393	3300005338	Ga0068868_100051211	Ga0068868_1000512112	248
394	3300005340	Ga0070689_100262551	Ga0070689_1002625511	248
395	3300005347	Ga0070668_100092933	Ga0070668_1000929332	248
396	3300005355	Ga0070671_100250121	Ga0070671_1002501212	248
397	3300005365	Ga0070688_100060808	Ga0070688_1000608082	248
398	3300005365	Ga0070688_100342614	Ga0070688_1003426141	248
399	3300005366	Ga0070659_100036450	Ga0070659_1000364502	248
400	3300005444	Ga0070694_100268008	Ga0070694_1002680081	248
401	3300005455	Ga0070663_100022711	Ga0070663_1000227114	248
402	3300005457	Ga0070662_100224704	Ga0070662_1002247041	248
403	3300005539	Ga0068853_100157896	Ga0068853_1001578962	248
404	3300005547	Ga0070693_100046911	Ga0070693_1000469111	248
405	3300005548	Ga0070665_100030300	Ga0070665_1000303004	248
406	3300005548	Ga0070665_100167091	Ga0070665_1001670911	248
407	3300005578	Ga0068854_100348126	Ga0068854_1003481261	248
408	3300005615	Ga0070702_100068510	Ga0070702_1000685101	248
409	3300005617	Ga0068859_100151769	Ga0068859_1001517692	248
410	3300005617	Ga0068859_100163128	Ga0068859_1001631282	248
411	3300005719	Ga0068861_100039161	Ga0068861_1000391612	248
412	3300005841	Ga0068863_100299230	Ga0068863_1002992302	248
413	3300005842	Ga0068858_100110123	Ga0068858_1001101232	248
414	3300005843	Ga0068860_100065598	Ga0068860_1000655984	248
415	3300005843	Ga0068860_100537708	Ga0068860_1005377081	248
416	3300005844	Ga0068862_100032186	Ga0068862_1000321863	248
417	3300005844	Ga0068862_100089496	Ga0068862_1000894962	248
418	3300005844	Ga0068862_100105933	Ga0068862_1001059333	248
419	3300005937	Ga0081455_10032741	Ga0081455_100327414	248
420	3300005983	Ga0081540_1002364	Ga0081540_100236417	248
421	3300005983	Ga0081540_1010088	Ga0081540_10100886	248
422	3300006038	Ga0075365_10021759	Ga0075365_100217592	248
423	3300006038	Ga0075365_10033437	Ga0075365_100334374	248
424	3300006042	Ga0075368_10007885	Ga0075368_100078854	248
425	3300006048	Ga0075363_100030478	Ga0075363_1000304782	248
426	3300006177	Ga0075362_10050269	Ga0075362_100502691	248
427	3300006178	Ga0075367_10015687	Ga0075367_100156875	248
428	3300006178	Ga0075367_10234485	Ga0075367_102344851	248
429	3300006186	Ga0075369_10019473	Ga0075369_100194732	248
430	3300006195	Ga0075366_10031132	Ga0075366_100311323	248
431	3300006353	Ga0075370_10013431	Ga0075370_100134313	248
432	3300006353	Ga0075370_10046411	Ga0075370_100464112	248
433	3300006353	Ga0075370_10128275	Ga0075370_101282752	248
434	3300006871	Ga0075434_100233583	Ga0075434_1002335832	248
435	3300006931	Ga0097620_100151766	Ga0097620_1001517662	248
436	3300006931	Ga0097620_100163120	Ga0097620_1001631202	248
437	3300009098	Ga0105245_10052962	Ga0105245_100529622	248
438	3300009101	Ga0105247_10013545	Ga0105247_100135454	248
439	3300009147	Ga0114129_10338363	Ga0114129_103383632	248
440	3300009174	Ga0105241_10022188	Ga0105241_100221883	248
441	3300009545	Ga0105237_10232211	Ga0105237_102322112	248
442	3300009551	Ga0105238_10039979	Ga0105238_100399794	248
443	3300009553	Ga0105249_10172465	Ga0105249_101724652	248
444	3300009553	Ga0105249_10410215	Ga0105249_104102151	248
445	3300013296	Ga0157374_10048162	Ga0157374_100481622	248
446	3300013297	Ga0157378_10028342	Ga0157378_100283424	248
447	3300013308	Ga0157375_10159696	Ga0157375_101596962	248
448	3300014325	Ga0163163_10038391	Ga0163163_100383914	248
449	3300014325	Ga0163163_10076657	Ga0163163_100766572	248
450	3300014745	Ga0157377_10092234	Ga0157377_100922342	248
451	3300014968	Ga0157379_10053163	Ga0157379_100531633	248
452	3300014969	Ga0157376_10137337	Ga0157376_101373371	248
453	3300025899	Ga0207642_10084809	Ga0207642_100848091	248
454	3300025901	Ga0207688_10091897	Ga0207688_100918972	248
455	3300025908	Ga0207643_10058111	Ga0207643_100581111	248
456	3300025927	Ga0207687_10073435	Ga0207687_100734352	248
457	3300025932	Ga0207690_10045626	Ga0207690_100456263	248
458	3300025933	Ga0207706_10044973	Ga0207706_100449732	248
459	3300025936	Ga0207670_10138815	Ga0207670_101388151	248
460	3300025936	Ga0207670_10346972	Ga0207670_103469721	248
461	3300025941	Ga0207711_10120335	Ga0207711_101203352	248
462	3300025942	Ga0207689_10064363	Ga0207689_100643633	248
463	3300025945	Ga0207679_10034980	Ga0207679_100349804	248
464	3300025949	Ga0207667_10089757	Ga0207667_100897574	248
465	3300025961	Ga0207712_10580103	Ga0207712_105801031	248
466	3300025972	Ga0207668_10060733	Ga0207668_100607332	248
467	3300025972	Ga0207668_10285115	Ga0207668_102851151	248
468	3300025986	Ga0207658_10289007	Ga0207658_102890072	248
469	3300026023	Ga0207677_10038494	Ga0207677_100384942	248
470	3300026035	Ga0207703_10039242	Ga0207703_100392424	248
471	3300026035	Ga0207703_10529374	Ga0207703_105293741	248
472	3300026035	Ga0207703_10982340	Ga0207703_109823401	248
473	3300026041	Ga0207639_10042671	Ga0207639_100426713	248
474	3300026067	Ga0207678_10037513	Ga0207678_100375133	248
475	3300026067	Ga0207678_10054230	Ga0207678_100542303	248
476	3300026095	Ga0207676_10115462	Ga0207676_101154621	248
477	3300026116	Ga0207674_10115942	Ga0207674_101159421	248
478	3300026118	Ga0207675_100076023	Ga0207675_1000760233	248
479	3300027866	Ga0209813_10036740	Ga0209813_100367401	248
480	3300027866	Ga0209813_10143797	Ga0209813_101437971	248
481	3300028379	Ga0268266_10017468	Ga0268266_100174684	248
482	3300028379	Ga0268266_10100198	Ga0268266_101001982	248
483	3300028380	Ga0268265_10033256	Ga0268265_100332562	248
484	3300028380	Ga0268265_10105200	Ga0268265_101052002	248
485	3300028380	Ga0268265_10121690	Ga0268265_101216903	248
486	3300028381	Ga0268264_10113072	Ga0268264_101130722	248
487	3300028381	Ga0268264_10159341	Ga0268264_101593412	248
488	3300046491	Ga0495584_0100633	Ga0495584_0100633_141_890	248
489	3300046492	Ga0495585_0091581	Ga0495585_0091581_873_1622	248
490	3300046513	Ga0495616_0089751	Ga0495616_0089751_142_891	248
491	3300046615	Ga0495656_0009282	Ga0495656_0009282_1796_2545	248
492	3300046648	Ga0495611_0138267	Ga0495611_0138267_54_803	248
493	3300046665	Ga0495661_0188177	Ga0495661_0188177_164_913	248
494	3300047318	Ga0495636_0029254	Ga0495636_0029254_480_1229	248
495	3300048904	Ga0496101_0261365	Ga0496101_0261365_371_1126	248
496	3300048905	Ga0496102_0166005	Ga0496102_0166005_301_1050	248
497	3300048907	Ga0496104_0252304	Ga0496104_0252304_903_1658	248
498	3300048911	Ga0496108_0056393	Ga0496108_0056393_1613_2362	248
499	3300048912	Ga0496109_0555130	Ga0496109_0555130_183_932	248
500	3300048913	Ga0496110_0262854	Ga0496110_0262854_632_1387	248
501	3300048915	Ga0496112_0259769	Ga0496112_0259769_144_893	248
502	3300048916	Ga0496113_0078494	Ga0496113_0078494_933_1682	248
503	3300048922	Ga0496119_0102855	Ga0496119_0102855_202_951	248
504	3300048924	Ga0496121_0018476	Ga0496121_0018476_2019_2768	248
505	3300048924	Ga0496121_0129902	Ga0496121_0129902_487_1236	248
506	3300048927	Ga0496124_0030585	Ga0496124_0030585_3406_4155	248
507	3300048928	Ga0496125_0053488	Ga0496125_0053488_444_1193	248
508	3300048929	Ga0496126_0047806	Ga0496126_0047806_1070_1819	248
509	3300048929	Ga0496126_0293386	Ga0496126_0293386_527_1282	248
510	3300048929	Ga0496126_0388075	Ga0496126_0388075_63_812	248
511	3300050490	nmdc:mga03n38_23842_c1	nmdc:mga03n38_23842_c1_807_1556	248
512	3300050490	nmdc:mga03n38_5300_c1	nmdc:mga03n38_5300_c1_2309_3064	248
513	3300050492	nmdc:mga0yw44_17381_c1	nmdc:mga0yw44_17381_c1_1421_2176	248
514	3300050492	nmdc:mga0yw44_47987_c1	nmdc:mga0yw44_47987_c1_368_1117	248
515	3300050493	nmdc:mga0k408_31166_c1	nmdc:mga0k408_31166_c1_1302_2060	248
516	3300050494	nmdc:mga06z11_112422_c1	nmdc:mga06z11_112422_c1_72_827	248
517	3300050495	nmdc:mga04h51_137469_c1	nmdc:mga04h51_137469_c1_18_773	248
518	3300050495	nmdc:mga04h51_34424_c1	nmdc:mga04h51_34424_c1_302_1051	248
519	3300050495	nmdc:mga04h51_37374_c1	nmdc:mga04h51_37374_c1_641_1399	248
520	3300050496	nmdc:mga07m45_2979_c1	nmdc:mga07m45_2979_c1_3782_4537	248
521	3300050512	nmdc:mga0n895_115774_c1	nmdc:mga0n895_115774_c1_982_1731	248
522	3300050516	nmdc:mga0sz30_19073_c1	nmdc:mga0sz30_19073_c1_1729_2478	248
523	3300053130	Ga0500642_0137582	Ga0500642_0137582_65_814	248
524	3300053137	Ga0500561_0078724	Ga0500561_0078724_197_946	248
525	3300003215	JGI25153J46596_10004776	JGI25153J46596_100047763	249
526	3300005842	Ga0068858_100556335	Ga0068858_1005563351	249
527	3300025297	Ga0209758_1021144	Ga0209758_10211442	249
528	3300026035	Ga0207703_10465163	Ga0207703_104651632	249
529	3300026088	Ga0207641_10350765	Ga0207641_103507652	249
530	3300032126	Ga0307415_100799307	Ga0307415_1007993071	249
531	3300048924	Ga0496121_0125779	Ga0496121_0125779_1087_1839	249
532	3300048929	Ga0496126_0358454	Ga0496126_0358454_390_1142	249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

54

263

0.76 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3nb3-assembly1.cif.gz_A	the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components	0.6752	40	241
3nb3-assembly1.cif.gz_A	the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components	0.6662	40	241
1bxw-assembly1.cif.gz_A	outer membrane protein a (ompa) transmembrane domain	0.627	38	241
1bxw-assembly1.cif.gz_A	outer membrane protein a (ompa) transmembrane domain	0.6203	38	241
1p4t-assembly1.cif.gz_A	crystal structure of neisserial surface protein a (nspa)	0.6045	43	240

ID	Description	Score	Start	End	Superfamily
1qjpA00	Mainly Beta;Beta Barrel;Porin;	0.6752	40	241	2.40.160.20
1qjpA00	Mainly Beta;Beta Barrel;Porin;	0.6662	40	241	2.40.160.20
1p4tA00	Mainly Beta;Beta Barrel;Porin;	0.6045	43	240	2.40.160.20
1p4tA00	Mainly Beta;Beta Barrel;Porin;	0.5906	43	240	2.40.160.20
2f1tA00	Mainly Beta;Beta Barrel;Porin;	0.5895	43	239	2.40.160.20

ID	Description	Score	Start	End	GO Terms
AF-A0A0T5PCW8-F1-model_v4	Outer membrane protein beta-barrel domain-containing protein	0.8832	38	242	GO:0016020
AF-A0A371B7L8-F1-model_v4	Porin family protein	0.8754	41	248	GO:0004190 GO:0009279
AF-A0A099RU32-F1-model_v4	deleted	0.8546	38	242
AF-A0A0W1AP65-F1-model_v4	Outer membrane protein beta-barrel domain-containing protein	0.842	42	241
AF-A0A1G3Z9Y5-F1-model_v4	Outer membrane protein beta-barrel domain-containing protein	0.8361	35	240

Feature Viewer

pLDDT	pTM	Quality
82.26	0.73	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460351

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

54

263

0.76

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map