F460342

General Info

Members Datasets Scaffolds Average Seq Length
532 218 1064 126

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_008219|Ga0590071_008219_165_548
Length 127
Sequence MKSIHTDNAPSPAGHYSQAIVHAGLVYVAGQLPIRPGASRGGEVGSIEEQTEQTLRNVAAILEAAGSGLDRVLQMTIYVSDMSLWSGVNAVYARVLGDHRPARAVVPVKDLHHGYQIEIQAIAALRD

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
203 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
204 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
205 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
206 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 1.32
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 12.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_008219 3300059421 Bacteria 2460
2 JGI24750J21931_1037299 3300002070 Bacteria 730
3 Ga0065704_10264601 3300005289 Bacteria 957
4 Ga0065715_10017075 3300005293 Bacteria 2230
5 Ga0065715_10164111 3300005293 Bacteria 1602
6 Ga0065715_10353347 3300005293 Bacteria 947
7 Ga0065715_10368537 3300005293 Unclassified 924
8 Ga0065707_10106511 3300005295 Bacteria 2593
9 Ga0065707_10107660 3300005295 Bacteria 2545
10 Ga0070658_10186520 3300005327 Bacteria 1747
11 Ga0070658_11941001 3300005327 Bacteria 508
12 Ga0070676_10018935 3300005328 Bacteria 3823
13 Ga0070676_10335976 3300005328 Bacteria 1035
14 Ga0070683_100055778 3300005329 Bacteria 3667
15 Ga0070683_100175486 3300005329 Bacteria 2034
16 Ga0070683_100463321 3300005329 Bacteria 1210
17 Ga0070683_100888390 3300005329 Bacteria 855
18 Ga0070683_100890299 3300005329 Bacteria 854
19 Ga0070690_100094637 3300005330 Bacteria 1972
20 Ga0070690_101164224 3300005330 Bacteria 614
21 Ga0070670_100017754 3300005331 Bacteria 6105
22 Ga0070670_100017835 3300005331 Bacteria 6092
23 Ga0070670_100032017 3300005331 Bacteria 4528
24 Ga0070670_100113292 3300005331 Bacteria 2338
25 Ga0070670_100134087 3300005331 Bacteria 2139
26 Ga0070670_100314084 3300005331 Bacteria 1372
27 Ga0070670_100478387 3300005331 Bacteria 1106
28 Ga0070677_10007735 3300005333 Bacteria 3599
29 Ga0068869_100011370 3300005334 Bacteria 5835
30 Ga0068869_100567273 3300005334 Bacteria 955
31 Ga0068869_101023236 3300005334 Bacteria 720
32 Ga0070666_10717550 3300005335 Bacteria 734
33 Ga0070680_100023485 3300005336 Bacteria 4918
34 Ga0070680_101024997 3300005336 Bacteria 713
35 Ga0070682_100288569 3300005337 Bacteria 1199
36 Ga0068868_100326567 3300005338 Bacteria 1308
37 Ga0070660_100029181 3300005339 Bacteria 4132
38 Ga0070660_100141441 3300005339 Bacteria 1931
39 Ga0070660_100206231 3300005339 Unclassified 1595
40 Ga0070689_100024552 3300005340 Bacteria 4522
41 Ga0070687_100158186 3300005343 Bacteria 1337
42 Ga0070661_100009795 3300005344 Bacteria 6644
43 Ga0070661_100077775 3300005344 Bacteria 2446
44 Ga0070661_100197573 3300005344 Bacteria 1536
45 Ga0070692_10150789 3300005345 Bacteria 1324
46 Ga0070692_10152132 3300005345 Bacteria 1319
47 Ga0070668_100142148 3300005347 Bacteria 1935
48 Ga0070668_101040941 3300005347 Bacteria 737
49 Ga0070669_100014747 3300005353 Bacteria 5564
50 Ga0070669_100017559 3300005353 Bacteria 5104
51 Ga0070669_100047085 3300005353 Bacteria 3145
52 Ga0070669_101848046 3300005353 Bacteria 527
53 Ga0070675_100096930 3300005354 Bacteria 2478
54 Ga0070675_100098008 3300005354 Bacteria 2465
55 Ga0070675_100099909 3300005354 Bacteria 2443
56 Ga0070671_100116817 3300005355 Bacteria 2243
57 Ga0070671_100642209 3300005355 Archaea 919
58 Ga0070671_101373415 3300005355 Bacteria 624
59 Ga0070671_101560568 3300005355 Bacteria 585
60 Ga0070674_100045188 3300005356 Bacteria 3009
61 Ga0070674_100066272 3300005356 Bacteria 2537
62 Ga0070674_100220143 3300005356 Bacteria 1476
63 Ga0070674_101347818 3300005356 Bacteria 637
64 Ga0070673_100059967 3300005364 Bacteria 3014
65 Ga0070673_100209739 3300005364 Bacteria 1682
66 Ga0070673_100323006 3300005364 Bacteria 1364
67 Ga0070673_101185350 3300005364 Bacteria 715
68 Ga0070688_100147947 3300005365 Bacteria 1603
69 Ga0070688_100276948 3300005365 Bacteria 1204
70 Ga0070688_100767672 3300005365 Bacteria 752
71 Ga0070659_100014190 3300005366 Bacteria 5949
72 Ga0070659_100115701 3300005366 Bacteria 2167
73 Ga0070667_100085803 3300005367 Bacteria 2700
74 Ga0070667_100692001 3300005367 Unclassified 943
75 Ga0070701_10014961 3300005438 Bacteria 3570
76 Ga0070701_10205688 3300005438 Bacteria 1166
77 Ga0070700_100185770 3300005441 Bacteria 1450
78 Ga0070700_100879654 3300005441 Bacteria 728
79 Ga0070694_100142447 3300005444 Bacteria 1743
80 Ga0070694_100924379 3300005444 Unclassified 721
81 Ga0070663_100011388 3300005455 Bacteria 5582
82 Ga0070678_100197237 3300005456 Unclassified 1659
83 Ga0070678_100441010 3300005456 Bacteria 1139
84 Ga0070678_101730297 3300005456 Bacteria 589
85 Ga0070678_101906605 3300005456 Unclassified 561
86 Ga0070662_100023249 3300005457 Bacteria 4256
87 Ga0070662_100057776 3300005457 Bacteria 2820
88 Ga0070662_100825063 3300005457 Bacteria 789
89 Ga0070681_10041136 3300005458 Bacteria 4631
90 Ga0070681_10153596 3300005458 Bacteria 2227
91 Ga0070681_10390296 3300005458 Bacteria 1303
92 Ga0068867_100115505 3300005459 Unclassified 2067
93 Ga0068867_100150900 3300005459 Bacteria 1825
94 Ga0068867_100182901 3300005459 Bacteria 1667
95 Ga0068867_100367514 3300005459 Bacteria 1205
96 Ga0068867_100370937 3300005459 Bacteria 1200
97 Ga0068867_101205212 3300005459 Unclassified 695
98 Ga0068867_102249042 3300005459 Unclassified 518
99 Ga0068867_102388051 3300005459 Unclassified 503
100 Ga0070698_100127154 3300005471 Bacteria 2506
101 Ga0070679_100222394 3300005530 Bacteria 1849
102 Ga0070684_100008077 3300005535 Bacteria 8216
103 Ga0070684_100347140 3300005535 Bacteria 1365
104 Ga0070697_101213675 3300005536 Unclassified 672
105 Ga0068853_100067676 3300005539 Bacteria 3103
106 Ga0068853_100100449 3300005539 Bacteria 2557
107 Ga0068853_100108321 3300005539 Bacteria 2465
108 Ga0068853_100124128 3300005539 Bacteria 2305
109 Ga0068853_100143179 3300005539 Bacteria 2147
110 Ga0070672_100008106 3300005543 Bacteria 7178
111 Ga0070672_100016160 3300005543 Bacteria 5338
112 Ga0070672_100206106 3300005543 Bacteria 1646
113 Ga0070672_100578755 3300005543 Unclassified 977
114 Ga0070686_100315650 3300005544 Bacteria 1164
115 Ga0070686_101599927 3300005544 Bacteria 551
116 Ga0070695_101015948 3300005545 Unclassified 675
117 Ga0070693_100505420 3300005547 Bacteria 858
118 Ga0070665_100187632 3300005548 Bacteria 2068
119 Ga0070665_100252879 3300005548 Bacteria 1763
120 Ga0070665_100857933 3300005548 Unclassified 921
121 Ga0070704_100096660 3300005549 Unclassified 2215
122 Ga0070704_100629915 3300005549 Bacteria 945
123 Ga0068855_100197591 3300005563 Bacteria 2265
124 Ga0068855_100414221 3300005563 Bacteria 1475
125 Ga0068855_102430562 3300005563 Bacteria 522
126 Ga0070664_100028651 3300005564 Bacteria 4635
127 Ga0070664_100029071 3300005564 Bacteria 4606
128 Ga0070664_100039268 3300005564 Bacteria 3988
129 Ga0070664_100173006 3300005564 Bacteria 1916
130 Ga0068857_100014149 3300005577 Bacteria 6949
131 Ga0068857_100015878 3300005577 Bacteria 6590
132 Ga0068857_100020469 3300005577 Bacteria 5819
133 Ga0068857_100109334 3300005577 Bacteria 2484
134 Ga0068857_101683447 3300005577 Bacteria 620
135 Ga0068854_100172535 3300005578 Bacteria 1684
136 Ga0068854_101354364 3300005578 Unclassified 642
137 Ga0070702_100073046 3300005615 Bacteria 2031
138 Ga0068852_100082346 3300005616 Bacteria 2859
139 Ga0068852_100403256 3300005616 Bacteria 1345
140 Ga0068852_100478023 3300005616 Bacteria 1238
141 Ga0068852_102059653 3300005616 Unclassified 593
142 Ga0068859_100248930 3300005617 Bacteria 1867
143 Ga0068859_100320115 3300005617 Bacteria 1645
144 Ga0068859_100613275 3300005617 Bacteria 1181
145 Ga0068859_100661864 3300005617 Bacteria 1136
146 Ga0068859_101666335 3300005617 Unclassified 704
147 Ga0068864_100058122 3300005618 Bacteria 3341
148 Ga0068864_100146162 3300005618 Bacteria 2137
149 Ga0068864_100150278 3300005618 Bacteria 2109
150 Ga0068864_100393230 3300005618 Bacteria 1316
151 Ga0068864_101654503 3300005618 Bacteria 644
152 Ga0068866_10050373 3300005718 Unclassified 2115
153 Ga0068866_10450983 3300005718 Archaea 841
154 Ga0068861_100004593 3300005719 Bacteria 9265
155 Ga0068861_100549506 3300005719 Unclassified 1052
156 Ga0068851_10025160 3300005834 Bacteria 2919
157 Ga0068851_10056001 3300005834 Bacteria 2010
158 Ga0068870_10010610 3300005840 Bacteria 4239
159 Ga0068870_10109729 3300005840 Unclassified 1573
160 Ga0068863_100107293 3300005841 Bacteria 2657
161 Ga0068858_100048574 3300005842 Bacteria 3930
162 Ga0068858_100224035 3300005842 Unclassified 1782
163 Ga0068858_101949827 3300005842 Unclassified 580
164 Ga0068860_100057709 3300005843 Bacteria 3690
165 Ga0068862_100002276 3300005844 Bacteria 17181
166 Ga0068862_100095829 3300005844 Bacteria 2589
167 Ga0068862_100206879 3300005844 Unclassified 1772
168 Ga0068862_100323223 3300005844 Bacteria 1425
169 Ga0068862_100439274 3300005844 Bacteria 1228
170 Ga0070712_100418412 3300006175 Bacteria 1110
171 Ga0097621_100369287 3300006237 Bacteria 1280
172 Ga0097621_100616708 3300006237 Bacteria 993
173 Ga0097621_100824285 3300006237 Bacteria 861
174 Ga0097621_101556100 3300006237 Bacteria 628
175 Ga0068871_101111691 3300006358 Archaea 739
176 Ga0075428_100273714 3300006844 Bacteria 1817
177 Ga0075430_100021929 3300006846 Bacteria 5427
178 Ga0075430_100055981 3300006846 Bacteria 3316
179 Ga0075430_100105229 3300006846 Bacteria 2355
180 Ga0075431_100248099 3300006847 Bacteria 1809
181 Ga0075431_100644914 3300006847 Bacteria 1040
182 Ga0075431_101794105 3300006847 Bacteria 570
183 Ga0075433_10128962 3300006852 Bacteria 2247
184 Ga0075433_10265400 3300006852 Bacteria 1522
185 Ga0075434_100114646 3300006871 Bacteria 2708
186 Ga0075429_100025799 3300006880 Bacteria 5102
187 Ga0075429_100515628 3300006880 Bacteria 1048
188 Ga0075429_101212947 3300006880 Bacteria 658
189 Ga0068865_100025230 3300006881 Bacteria 3907
190 Ga0068865_100247661 3300006881 Bacteria 1405
191 Ga0068865_100351585 3300006881 Bacteria 1194
192 Ga0097620_100248932 3300006931 Bacteria 1867
193 Ga0097620_100320124 3300006931 Bacteria 1645
194 Ga0097620_100613223 3300006931 Bacteria 1181
195 Ga0097620_100661966 3300006931 Bacteria 1136
196 Ga0097620_101665987 3300006931 Unclassified 704
197 Ga0105240_10129284 3300009093 Bacteria 3031
198 Ga0111539_10022595 3300009094 Bacteria 7727
199 Ga0111539_10272289 3300009094 Bacteria 1971
200 Ga0111539_11468122 3300009094 Bacteria 791
201 Ga0111539_11524114 3300009094 Unclassified 775
202 Ga0111539_11593952 3300009094 Bacteria 757
203 Ga0105245_10209901 3300009098 Bacteria 1874
204 Ga0105247_10321987 3300009101 Bacteria 1079
205 Ga0105247_10462535 3300009101 Bacteria 917
206 Ga0114129_10130380 3300009147 Bacteria 3453
207 Ga0114129_10530767 3300009147 Bacteria 1533
208 Ga0105243_10112877 3300009148 Bacteria 2278
209 Ga0105243_10237636 3300009148 Bacteria 1620
210 Ga0105242_10135999 3300009176 Bacteria 2127
211 Ga0105248_10094604 3300009177 Bacteria 3364
212 Ga0105248_10303478 3300009177 Bacteria 1798
213 Ga0105248_10597313 3300009177 Bacteria 1245
214 Ga0105248_10866708 3300009177 Unclassified 1019
215 Ga0105237_10126687 3300009545 Bacteria 2548
216 Ga0105237_10339008 3300009545 Bacteria 1508
217 Ga0105237_12215947 3300009545 Bacteria 559
218 Ga0105238_10899034 3300009551 Bacteria 904
219 Ga0105249_10000733 3300009553 Bacteria 29716
220 Ga0105249_10020388 3300009553 Bacteria 5927
221 Ga0105249_10084079 3300009553 Bacteria 2963
222 Ga0105249_10087506 3300009553 Bacteria 2907
223 Ga0105249_10173352 3300009553 Unclassified 2093
224 Ga0105249_12734036 3300009553 Unclassified 565
225 Ga0105239_10169232 3300010375 Bacteria 2443
226 Ga0105239_11179332 3300010375 Bacteria 882
227 Ga0105246_10080374 3300011119 Bacteria 2321
228 Ga0105246_12521647 3300011119 Bacteria 506
229 Ga0157339_1043752 3300012505 Bacteria 571
230 Ga0157371_10050525 3300013102 Bacteria 2955
231 Ga0157371_10558759 3300013102 Bacteria 849
232 Ga0157369_10515068 3300013105 Bacteria 1237
233 Ga0157369_10533764 3300013105 Bacteria 1213
234 Ga0157369_10557514 3300013105 Bacteria 1184
235 Ga0157374_10630728 3300013296 Bacteria 1083
236 Ga0157374_10780611 3300013296 Bacteria 971
237 Ga0157374_11275396 3300013296 Unclassified 756
238 Ga0157378_10276383 3300013297 Bacteria 1617
239 Ga0157378_10315275 3300013297 Bacteria 1518
240 Ga0157378_11417130 3300013297 Bacteria 738
241 Ga0157378_12233280 3300013297 Bacteria 598
242 Ga0163162_10045749 3300013306 Bacteria 4385
243 Ga0163162_10160713 3300013306 Bacteria 2368
244 Ga0163162_10332783 3300013306 Bacteria 1651
245 Ga0157372_10053314 3300013307 Bacteria 4508
246 Ga0157372_10116554 3300013307 Bacteria 3063
247 Ga0157372_10256637 3300013307 Bacteria 2029
248 Ga0157372_10270072 3300013307 Bacteria 1976
249 Ga0157372_11238517 3300013307 Bacteria 862
250 Ga0157372_11691967 3300013307 Bacteria 728
251 Ga0157375_10059281 3300013308 Bacteria 3792
252 Ga0157375_10087690 3300013308 Bacteria 3165
253 Ga0157375_10113726 3300013308 Bacteria 2808
254 Ga0157375_10217708 3300013308 Unclassified 2067
255 Ga0157375_10481691 3300013308 Unclassified 1406
256 Ga0157375_10589477 3300013308 Unclassified 1271
257 Ga0163163_10014694 3300014325 Bacteria 7200
258 Ga0163163_10837121 3300014325 Unclassified 983
259 Ga0163163_11062063 3300014325 Unclassified 873
260 Ga0163163_11747434 3300014325 Bacteria 682
261 Ga0157380_10029974 3300014326 Bacteria 4163
262 Ga0157380_10070935 3300014326 Bacteria 2817
263 Ga0157380_10084903 3300014326 Bacteria 2597
264 Ga0157380_10907784 3300014326 Bacteria 907
265 Ga0157380_12217339 3300014326 Bacteria 613
266 Ga0157380_13160915 3300014326 Unclassified 526
267 Ga0157377_10786161 3300014745 Archaea 700
268 Ga0157377_11516942 3300014745 Bacteria 533
269 Ga0157379_10043859 3300014968 Bacteria 3993
270 Ga0157376_10789592 3300014969 Archaea 961
271 Ga0157376_11223385 3300014969 Bacteria 780
272 Ga0163161_10015981 3300017792 Bacteria 5237
273 Ga0163161_10061122 3300017792 Bacteria 2742
274 Ga0163161_11161459 3300017792 Bacteria 666
275 Ga0206356_11577379 3300020070 Bacteria 659
276 Ga0213876_10477600 3300021384 Bacteria 663
277 Ga0207697_10021900 3300025315 Bacteria 2619
278 Ga0207656_10032237 3300025321 Bacteria 2176
279 Ga0207682_10111433 3300025893 Bacteria 1205
280 Ga0207682_10319453 3300025893 Bacteria 729
281 Ga0207647_10058402 3300025904 Bacteria 2363
282 Ga0207645_10008255 3300025907 Bacteria 7280
283 Ga0207645_10128487 3300025907 Bacteria 1648
284 Ga0207645_10156945 3300025907 Bacteria 1487
285 Ga0207643_10022129 3300025908 Bacteria 3498
286 Ga0207643_10094896 3300025908 Unclassified 1743
287 Ga0207707_10008793 3300025912 Bacteria 8764
288 Ga0207707_10349449 3300025912 Bacteria 1274
289 Ga0207707_10861065 3300025912 Bacteria 751
290 Ga0207695_10442869 3300025913 Bacteria 1182
291 Ga0207695_10543850 3300025913 Bacteria 1043
292 Ga0207671_10165447 3300025914 Bacteria 1715
293 Ga0207693_10105493 3300025915 Bacteria 2210
294 Ga0207660_10242221 3300025917 Bacteria 1421
295 Ga0207660_10458491 3300025917 Bacteria 1031
296 Ga0207662_10007039 3300025918 Bacteria 6108
297 Ga0207657_10157250 3300025919 Bacteria 1848
298 Ga0207657_10169261 3300025919 Bacteria 1771
299 Ga0207657_10795253 3300025919 Archaea 731
300 Ga0207649_10016919 3300025920 Bacteria 4124
301 Ga0207649_10020856 3300025920 Bacteria 3763
302 Ga0207649_10186180 3300025920 Bacteria 1457
303 Ga0207652_10023898 3300025921 Bacteria 5068
304 Ga0207681_10009169 3300025923 Bacteria 6044
305 Ga0207681_10016104 3300025923 Bacteria 4671
306 Ga0207681_10067471 3300025923 Bacteria 2480
307 Ga0207681_10380128 3300025923 Bacteria 1137
308 Ga0207694_10638564 3300025924 Bacteria 897
309 Ga0207650_10012247 3300025925 Bacteria 5919
310 Ga0207650_10034789 3300025925 Bacteria 3655
311 Ga0207650_10108198 3300025925 Bacteria 2148
312 Ga0207650_10143954 3300025925 Unclassified 1876
313 Ga0207650_10148411 3300025925 Bacteria 1849
314 Ga0207650_10511288 3300025925 Bacteria 1004
315 Ga0207650_11303762 3300025925 Unclassified 618
316 Ga0207659_10024392 3300025926 Bacteria 4051
317 Ga0207659_10066686 3300025926 Bacteria 2613
318 Ga0207659_10079048 3300025926 Bacteria 2425
319 Ga0207659_10481817 3300025926 Bacteria 1048
320 Ga0207687_10198851 3300025927 Bacteria 1565
321 Ga0207644_10153617 3300025931 Bacteria 1783
322 Ga0207644_10304100 3300025931 Bacteria 1286
323 Ga0207644_10733568 3300025931 Unclassified 825
324 Ga0207690_10059303 3300025932 Bacteria 2593
325 Ga0207690_10423463 3300025932 Bacteria 1065
326 Ga0207690_10465679 3300025932 Bacteria 1018
327 Ga0207706_10002610 3300025933 Bacteria 17550
328 Ga0207706_10078315 3300025933 Bacteria 2907
329 Ga0207706_10579870 3300025933 Bacteria 964
330 Ga0207686_10365936 3300025934 Bacteria 1090
331 Ga0207670_10310729 3300025936 Bacteria 1237
332 Ga0207670_10796215 3300025936 Bacteria 787
333 Ga0207669_10182388 3300025937 Bacteria 1506
334 Ga0207669_10463801 3300025937 Bacteria 1006
335 Ga0207704_10046790 3300025938 Bacteria 2581
336 Ga0207704_10163423 3300025938 Bacteria 1587
337 Ga0207704_10653330 3300025938 Bacteria 866
338 Ga0207691_10009023 3300025940 Bacteria 9562
339 Ga0207691_10033207 3300025940 Bacteria 4804
340 Ga0207691_10083724 3300025940 Bacteria 2864
341 Ga0207691_10238718 3300025940 Bacteria 1572
342 Ga0207711_10132110 3300025941 Bacteria 2239
343 Ga0207711_10145247 3300025941 Bacteria 2137
344 Ga0207711_10343719 3300025941 Bacteria 1381
345 Ga0207689_10020792 3300025942 Bacteria 5520
346 Ga0207661_10030606 3300025944 Bacteria 4148
347 Ga0207661_10078335 3300025944 Bacteria 2720
348 Ga0207661_10772977 3300025944 Bacteria 884
349 Ga0207661_10940839 3300025944 Bacteria 796
350 Ga0207661_11703998 3300025944 Bacteria 576
351 Ga0207679_10013591 3300025945 Bacteria 5337
352 Ga0207679_10030295 3300025945 Bacteria 3776
353 Ga0207679_10034420 3300025945 Bacteria 3574
354 Ga0207679_10170281 3300025945 Bacteria 1792
355 Ga0207679_10335022 3300025945 Bacteria 1314
356 Ga0207679_11159978 3300025945 Bacteria 709
357 Ga0207679_11415984 3300025945 Unclassified 638
358 Ga0207667_10146611 3300025949 Bacteria 2430
359 Ga0207651_10129205 3300025960 Bacteria 1931
360 Ga0207651_10279270 3300025960 Bacteria 1379
361 Ga0207712_10014066 3300025961 Bacteria 5137
362 Ga0207712_10061343 3300025961 Bacteria 2669
363 Ga0207668_10070182 3300025972 Bacteria 2497
364 Ga0207640_10214423 3300025981 Bacteria 1469
365 Ga0207658_10316056 3300025986 Bacteria 1350
366 Ga0207658_10341928 3300025986 Unclassified 1301
367 Ga0207658_10792959 3300025986 Unclassified 860
368 Ga0207703_10060468 3300026035 Bacteria 3098
369 Ga0207703_10085182 3300026035 Bacteria 2644
370 Ga0207703_12280001 3300026035 Bacteria 517
371 Ga0207639_10001576 3300026041 Bacteria 15295
372 Ga0207639_10053035 3300026041 Bacteria 3092
373 Ga0207639_10121437 3300026041 Bacteria 2147
374 Ga0207639_10394112 3300026041 Bacteria 1246
375 Ga0207678_10008895 3300026067 Bacteria 8841
376 Ga0207708_10173021 3300026075 Bacteria 1711
377 Ga0207708_10657596 3300026075 Bacteria 893
378 Ga0207702_11690275 3300026078 Bacteria 626
379 Ga0207641_10069354 3300026088 Bacteria 3026
380 Ga0207641_10087531 3300026088 Unclassified 2718
381 Ga0207641_10384251 3300026088 Bacteria 1345
382 Ga0207648_10023576 3300026089 Bacteria 5511
383 Ga0207648_10037030 3300026089 Bacteria 4297
384 Ga0207648_10200179 3300026089 Bacteria 1771
385 Ga0207648_10280590 3300026089 Bacteria 1490
386 Ga0207648_10403710 3300026089 Bacteria 1239
387 Ga0207648_10534696 3300026089 Bacteria 1075
388 Ga0207676_10061503 3300026095 Bacteria 2974
389 Ga0207676_10114464 3300026095 Bacteria 2263
390 Ga0207676_10237009 3300026095 Bacteria 1634
391 Ga0207676_10267575 3300026095 Bacteria 1546
392 Ga0207674_10001029 3300026116 Bacteria 36400
393 Ga0207674_10009866 3300026116 Bacteria 10867
394 Ga0207674_10012601 3300026116 Bacteria 9450
395 Ga0207674_10025524 3300026116 Bacteria 6300
396 Ga0207674_10786262 3300026116 Bacteria 918
397 Ga0207675_100009300 3300026118 Bacteria 9216
398 Ga0207675_100551079 3300026118 Unclassified 1152
399 Ga0207675_100594194 3300026118 Bacteria 1109
400 Ga0207683_10058503 3300026121 Bacteria 3384
401 Ga0207683_10312032 3300026121 Unclassified 1440
402 Ga0207683_11417529 3300026121 Unclassified 642
403 Ga0207683_11558518 3300026121 Bacteria 610
404 Ga0207683_11649944 3300026121 Bacteria 590
405 Ga0207698_10081666 3300026142 Bacteria 2610
406 Ga0207698_10170875 3300026142 Bacteria 1914
407 Ga0207698_10360379 3300026142 Bacteria 1377
408 Ga0207698_11325203 3300026142 Bacteria 735
409 Ga0209974_10380301 3300027876 Bacteria 551
410 Ga0268265_10009803 3300028380 Bacteria 6466
411 Ga0268265_10020612 3300028380 Bacteria 4603
412 Ga0268265_10302758 3300028380 Unclassified 1440
413 Ga0268265_10779897 3300028380 Bacteria 930
414 Ga0268264_10092896 3300028381 Bacteria 2605
415 Ga0268264_10212355 3300028381 Bacteria 1777
416 Ga0265331_10105180 3300031250 Bacteria 1297
417 Ga0265327_10027270 3300031251 Bacteria 3291
418 Ga0307408_100003070 3300031548 Bacteria 11521
419 Ga0307408_100016786 3300031548 Bacteria 4894
420 Ga0307408_101181730 3300031548 Bacteria 713
421 Ga0265314_10002966 3300031711 Bacteria 16817
422 Ga0307405_10000529 3300031731 Bacteria 14453
423 Ga0307405_10057979 3300031731 Bacteria 2435
424 Ga0307405_11043388 3300031731 Unclassified 700
425 Ga0307405_11484737 3300031731 Bacteria 595
426 Ga0307413_10004105 3300031824 Bacteria 6272
427 Ga0307413_10045353 3300031824 Bacteria 2605
428 Ga0307413_10060285 3300031824 Bacteria 2335
429 Ga0307413_10329569 3300031824 Bacteria 1170
430 Ga0307413_10333116 3300031824 Bacteria 1164
431 Ga0307410_10002656 3300031852 Bacteria 8720
432 Ga0307410_10024065 3300031852 Bacteria 3799
433 Ga0307410_10034976 3300031852 Bacteria 3259
434 Ga0307410_10224259 3300031852 Unclassified 1447
435 Ga0307410_10472504 3300031852 Bacteria 1027
436 Ga0307406_10001540 3300031901 Bacteria 12722
437 Ga0307406_10014971 3300031901 Bacteria 4477
438 Ga0307406_10024589 3300031901 Bacteria 3600
439 Ga0307406_10333074 3300031901 Bacteria 1179
440 Ga0307406_10635906 3300031901 Bacteria 884
441 Ga0307406_10827118 3300031901 Bacteria 783
442 Ga0307406_11237117 3300031901 Bacteria 649
443 Ga0307406_11409395 3300031901 Bacteria 611
444 Ga0307407_10000765 3300031903 Bacteria 10571
445 Ga0307407_10001112 3300031903 Bacteria 9393
446 Ga0307407_10109307 3300031903 Unclassified 1733
447 Ga0307407_10229414 3300031903 Bacteria 1260
448 Ga0307407_10244522 3300031903 Bacteria 1226
449 Ga0307407_10410342 3300031903 Bacteria 974
450 Ga0307412_10000820 3300031911 Bacteria 17912
451 Ga0307412_10084477 3300031911 Unclassified 2204
452 Ga0307409_100001085 3300031995 Bacteria 12843
453 Ga0307409_100133159 3300031995 Bacteria 2128
454 Ga0307409_100458061 3300031995 Bacteria 1232
455 Ga0307409_100458917 3300031995 Unclassified 1231
456 Ga0307416_100002894 3300032002 Bacteria 9998
457 Ga0307416_100094770 3300032002 Unclassified 2575
458 Ga0307416_100154980 3300032002 Bacteria 2108
459 Ga0307416_100228662 3300032002 Bacteria 1791
460 Ga0307416_100403775 3300032002 Bacteria 1405
461 Ga0307416_100483295 3300032002 Bacteria 1299
462 Ga0307416_100697430 3300032002 Bacteria 1104
463 Ga0307414_10126151 3300032004 Bacteria 1978
464 Ga0307414_10127774 3300032004 Bacteria 1967
465 Ga0307414_10780848 3300032004 Bacteria 870
466 Ga0307414_11021872 3300032004 Bacteria 761
467 Ga0307411_10003308 3300032005 Bacteria 7453
468 Ga0307411_10083443 3300032005 Unclassified 2207
469 Ga0307411_10179099 3300032005 Bacteria 1607
470 Ga0307415_100007070 3300032126 Bacteria 6109
471 Ga0307415_100030625 3300032126 Bacteria 3457
472 Ga0307415_100176631 3300032126 Unclassified 1671
473 Ga0307415_100267155 3300032126 Bacteria 1399
474 Ga0307415_100597386 3300032126 Unclassified 982
475 Ga0373943_0409329 3300035170 Bacteria 784
476 Ga0373927_0916352 3300035695 Bacteria 578
477 Ga0373947_0675817 3300035725 Bacteria 704
478 Ga0395905_1727798 3300037471 Unclassified 531
479 Ga0400489_89059 3300039093 Bacteria 1571
480 Ga0436365_0752795 3300039437 Bacteria 2097
481 Ga0439438_101355 3300041405 Bacteria 698
482 Ga0439439_0092737 3300041406 Bacteria 826
483 Ga0439466_0063414 3300041411 Bacteria 1186
484 Ga0451804_0128962 3300041463 Bacteria 574
485 Ga0451807_2482904 3300041486 Bacteria 934
486 Ga0451843_0292727 3300041509 Bacteria 976
487 Ga0451853_0793158 3300041512 Bacteria 2527
488 Ga0439448_0202458 3300042005 Bacteria 696
489 Ga0439432_083880 3300042006 Bacteria 963
490 Ga0439449_0352649 3300042007 Bacteria 557
491 Ga0450889_014830 3300042144 Bacteria 833
492 Ga0439464_0057063 3300042439 Bacteria 1138
493 Ga0451576_0109529 3300045051 Bacteria 2874
494 Ga0451576_0533392 3300045051 Bacteria 1233
495 Ga0495629_0194965 3300046459 Bacteria 1401
496 Ga0495582_0044249 3300046473 Bacteria 2453
497 Ga0495598_0003096 3300046537 Bacteria 3500
498 Ga0495613_0425426 3300046689 Bacteria 903
499 Ga0496108_1075014 3300048911 Archaea 685
500 Ga0496108_1345264 3300048911 Bacteria 599
501 Ga0496109_0442049 3300048912 Bacteria 1228
502 Ga0496109_0514919 3300048912 Bacteria 1129
503 Ga0496113_0994762 3300048916 Bacteria 661
504 Ga0501298_148288 3300049521 Unclassified 572
505 Ga0501235_219396 3300049669 Unclassified 521
506 Ga0501249_156130 3300049679 Unclassified 577
507 Ga0501250_006663 3300049680 Bacteria 1228
508 Ga0501225_0041941 3300049705 Bacteria 1263
509 Ga0501245_046290 3300049708 Unclassified 760
510 Ga0501263_030351 3300049760 Unclassified 761
511 nmdc:mga05p37_41501_c1 3300050507 Bacteria 5649
512 nmdc:mga09592_42520_c1 3300050508 Bacteria 3822
513 nmdc:mga09592_546942_c1 3300050508 Bacteria 994
514 nmdc:mga0qj67_39891_c1 3300050509 Bacteria 3689
515 nmdc:mga0qj67_575149_c1 3300050509 Unclassified 902
516 nmdc:mga0qj67_632607_c1 3300050509 Bacteria 854
517 nmdc:mga0qj67_8075_c1 3300050509 Bacteria 7791
518 nmdc:mga0qj67_87182_c1 3300050509 Bacteria 2505
519 nmdc:mga06r32_590778_c1 3300050510 Bacteria 1082
520 nmdc:mga06r32_643969_c1 3300050510 Bacteria 1028
521 nmdc:mga08y16_119861_c1 3300050511 Bacteria 2738
522 nmdc:mga08y16_352738_c1 3300050511 Bacteria 1511
523 nmdc:mga0n895_299592_c1 3300050512 Bacteria 1630
524 nmdc:mga0n895_80275_c1 3300050512 Bacteria 3250
525 nmdc:mga0a205_17208_c2 3300050515 Bacteria 4696
526 nmdc:mga0a205_337590_c1 3300050515 Bacteria 1376
527 nmdc:mga0a205_50212_c1 3300050515 Bacteria 4027
528 Ga0495601_0081119 3300053077 Bacteria 2082
529 Ga0495619_1209976 3300053085 Unclassified 500
530 Ga0500577_0002458 3300053142 Bacteria 4739
531 Ga0501084_0485412 3300054114 Bacteria 1044
532 Ga0501082_0368668 3300060353 Bacteria 1253
533 Ga0590071_008219
534 JGI24750J21931_1037299
535 Ga0065704_10264601
536 Ga0065715_10017075
537 Ga0065715_10164111
538 Ga0065715_10353347
539 Ga0065715_10368537
540 Ga0065707_10106511
541 Ga0065707_10107660
542 Ga0070658_10186520
543 Ga0070658_11941001
544 Ga0070676_10018935
545 Ga0070676_10335976
546 Ga0070683_100055778
547 Ga0070683_100175486
548 Ga0070683_100463321
549 Ga0070683_100888390
550 Ga0070683_100890299
551 Ga0070690_100094637
552 Ga0070690_101164224
553 Ga0070670_100017754
554 Ga0070670_100017835
555 Ga0070670_100032017
556 Ga0070670_100113292
557 Ga0070670_100134087
558 Ga0070670_100314084
559 Ga0070670_100478387
560 Ga0070677_10007735
561 Ga0068869_100011370
562 Ga0068869_100567273
563 Ga0068869_101023236
564 Ga0070666_10717550
565 Ga0070680_100023485
566 Ga0070680_101024997
567 Ga0070682_100288569
568 Ga0068868_100326567
569 Ga0070660_100029181
570 Ga0070660_100141441
571 Ga0070660_100206231
572 Ga0070689_100024552
573 Ga0070687_100158186
574 Ga0070661_100009795
575 Ga0070661_100077775
576 Ga0070661_100197573
577 Ga0070692_10150789
578 Ga0070692_10152132
579 Ga0070668_100142148
580 Ga0070668_101040941
581 Ga0070669_100014747
582 Ga0070669_100017559
583 Ga0070669_100047085
584 Ga0070669_101848046
585 Ga0070675_100096930
586 Ga0070675_100098008
587 Ga0070675_100099909
588 Ga0070671_100116817
589 Ga0070671_100642209
590 Ga0070671_101373415
591 Ga0070671_101560568
592 Ga0070674_100045188
593 Ga0070674_100066272
594 Ga0070674_100220143
595 Ga0070674_101347818
596 Ga0070673_100059967
597 Ga0070673_100209739
598 Ga0070673_100323006
599 Ga0070673_101185350
600 Ga0070688_100147947
601 Ga0070688_100276948
602 Ga0070688_100767672
603 Ga0070659_100014190
604 Ga0070659_100115701
605 Ga0070667_100085803
606 Ga0070667_100692001
607 Ga0070701_10014961
608 Ga0070701_10205688
609 Ga0070700_100185770
610 Ga0070700_100879654
611 Ga0070694_100142447
612 Ga0070694_100924379
613 Ga0070663_100011388
614 Ga0070678_100197237
615 Ga0070678_100441010
616 Ga0070678_101730297
617 Ga0070678_101906605
618 Ga0070662_100023249
619 Ga0070662_100057776
620 Ga0070662_100825063
621 Ga0070681_10041136
622 Ga0070681_10153596
623 Ga0070681_10390296
624 Ga0068867_100115505
625 Ga0068867_100150900
626 Ga0068867_100182901
627 Ga0068867_100367514
628 Ga0068867_100370937
629 Ga0068867_101205212
630 Ga0068867_102249042
631 Ga0068867_102388051
632 Ga0070698_100127154
633 Ga0070679_100222394
634 Ga0070684_100008077
635 Ga0070684_100347140
636 Ga0070697_101213675
637 Ga0068853_100067676
638 Ga0068853_100100449
639 Ga0068853_100108321
640 Ga0068853_100124128
641 Ga0068853_100143179
642 Ga0070672_100008106
643 Ga0070672_100016160
644 Ga0070672_100206106
645 Ga0070672_100578755
646 Ga0070686_100315650
647 Ga0070686_101599927
648 Ga0070695_101015948
649 Ga0070693_100505420
650 Ga0070665_100187632
651 Ga0070665_100252879
652 Ga0070665_100857933
653 Ga0070704_100096660
654 Ga0070704_100629915
655 Ga0068855_100197591
656 Ga0068855_100414221
657 Ga0068855_102430562
658 Ga0070664_100028651
659 Ga0070664_100029071
660 Ga0070664_100039268
661 Ga0070664_100173006
662 Ga0068857_100014149
663 Ga0068857_100015878
664 Ga0068857_100020469
665 Ga0068857_100109334
666 Ga0068857_101683447
667 Ga0068854_100172535
668 Ga0068854_101354364
669 Ga0070702_100073046
670 Ga0068852_100082346
671 Ga0068852_100403256
672 Ga0068852_100478023
673 Ga0068852_102059653
674 Ga0068859_100248930
675 Ga0068859_100320115
676 Ga0068859_100613275
677 Ga0068859_100661864
678 Ga0068859_101666335
679 Ga0068864_100058122
680 Ga0068864_100146162
681 Ga0068864_100150278
682 Ga0068864_100393230
683 Ga0068864_101654503
684 Ga0068866_10050373
685 Ga0068866_10450983
686 Ga0068861_100004593
687 Ga0068861_100549506
688 Ga0068851_10025160
689 Ga0068851_10056001
690 Ga0068870_10010610
691 Ga0068870_10109729
692 Ga0068863_100107293
693 Ga0068858_100048574
694 Ga0068858_100224035
695 Ga0068858_101949827
696 Ga0068860_100057709
697 Ga0068862_100002276
698 Ga0068862_100095829
699 Ga0068862_100206879
700 Ga0068862_100323223
701 Ga0068862_100439274
702 Ga0070712_100418412
703 Ga0097621_100369287
704 Ga0097621_100616708
705 Ga0097621_100824285
706 Ga0097621_101556100
707 Ga0068871_101111691
708 Ga0075428_100273714
709 Ga0075430_100021929
710 Ga0075430_100055981
711 Ga0075430_100105229
712 Ga0075431_100248099
713 Ga0075431_100644914
714 Ga0075431_101794105
715 Ga0075433_10128962
716 Ga0075433_10265400
717 Ga0075434_100114646
718 Ga0075429_100025799
719 Ga0075429_100515628
720 Ga0075429_101212947
721 Ga0068865_100025230
722 Ga0068865_100247661
723 Ga0068865_100351585
724 Ga0097620_100248932
725 Ga0097620_100320124
726 Ga0097620_100613223
727 Ga0097620_100661966
728 Ga0097620_101665987
729 Ga0105240_10129284
730 Ga0111539_10022595
731 Ga0111539_10272289
732 Ga0111539_11468122
733 Ga0111539_11524114
734 Ga0111539_11593952
735 Ga0105245_10209901
736 Ga0105247_10321987
737 Ga0105247_10462535
738 Ga0114129_10130380
739 Ga0114129_10530767
740 Ga0105243_10112877
741 Ga0105243_10237636
742 Ga0105242_10135999
743 Ga0105248_10094604
744 Ga0105248_10303478
745 Ga0105248_10597313
746 Ga0105248_10866708
747 Ga0105237_10126687
748 Ga0105237_10339008
749 Ga0105237_12215947
750 Ga0105238_10899034
751 Ga0105249_10000733
752 Ga0105249_10020388
753 Ga0105249_10084079
754 Ga0105249_10087506
755 Ga0105249_10173352
756 Ga0105249_12734036
757 Ga0105239_10169232
758 Ga0105239_11179332
759 Ga0105246_10080374
760 Ga0105246_12521647
761 Ga0157339_1043752
762 Ga0157371_10050525
763 Ga0157371_10558759
764 Ga0157369_10515068
765 Ga0157369_10533764
766 Ga0157369_10557514
767 Ga0157374_10630728
768 Ga0157374_10780611
769 Ga0157374_11275396
770 Ga0157378_10276383
771 Ga0157378_10315275
772 Ga0157378_11417130
773 Ga0157378_12233280
774 Ga0163162_10045749
775 Ga0163162_10160713
776 Ga0163162_10332783
777 Ga0157372_10053314
778 Ga0157372_10116554
779 Ga0157372_10256637
780 Ga0157372_10270072
781 Ga0157372_11238517
782 Ga0157372_11691967
783 Ga0157375_10059281
784 Ga0157375_10087690
785 Ga0157375_10113726
786 Ga0157375_10217708
787 Ga0157375_10481691
788 Ga0157375_10589477
789 Ga0163163_10014694
790 Ga0163163_10837121
791 Ga0163163_11062063
792 Ga0163163_11747434
793 Ga0157380_10029974
794 Ga0157380_10070935
795 Ga0157380_10084903
796 Ga0157380_10907784
797 Ga0157380_12217339
798 Ga0157380_13160915
799 Ga0157377_10786161
800 Ga0157377_11516942
801 Ga0157379_10043859
802 Ga0157376_10789592
803 Ga0157376_11223385
804 Ga0163161_10015981
805 Ga0163161_10061122
806 Ga0163161_11161459
807 Ga0206356_11577379
808 Ga0213876_10477600
809 Ga0207697_10021900
810 Ga0207656_10032237
811 Ga0207682_10111433
812 Ga0207682_10319453
813 Ga0207647_10058402
814 Ga0207645_10008255
815 Ga0207645_10128487
816 Ga0207645_10156945
817 Ga0207643_10022129
818 Ga0207643_10094896
819 Ga0207707_10008793
820 Ga0207707_10349449
821 Ga0207707_10861065
822 Ga0207695_10442869
823 Ga0207695_10543850
824 Ga0207671_10165447
825 Ga0207693_10105493
826 Ga0207660_10242221
827 Ga0207660_10458491
828 Ga0207662_10007039
829 Ga0207657_10157250
830 Ga0207657_10169261
831 Ga0207657_10795253
832 Ga0207649_10016919
833 Ga0207649_10020856
834 Ga0207649_10186180
835 Ga0207652_10023898
836 Ga0207681_10009169
837 Ga0207681_10016104
838 Ga0207681_10067471
839 Ga0207681_10380128
840 Ga0207694_10638564
841 Ga0207650_10012247
842 Ga0207650_10034789
843 Ga0207650_10108198
844 Ga0207650_10143954
845 Ga0207650_10148411
846 Ga0207650_10511288
847 Ga0207650_11303762
848 Ga0207659_10024392
849 Ga0207659_10066686
850 Ga0207659_10079048
851 Ga0207659_10481817
852 Ga0207687_10198851
853 Ga0207644_10153617
854 Ga0207644_10304100
855 Ga0207644_10733568
856 Ga0207690_10059303
857 Ga0207690_10423463
858 Ga0207690_10465679
859 Ga0207706_10002610
860 Ga0207706_10078315
861 Ga0207706_10579870
862 Ga0207686_10365936
863 Ga0207670_10310729
864 Ga0207670_10796215
865 Ga0207669_10182388
866 Ga0207669_10463801
867 Ga0207704_10046790
868 Ga0207704_10163423
869 Ga0207704_10653330
870 Ga0207691_10009023
871 Ga0207691_10033207
872 Ga0207691_10083724
873 Ga0207691_10238718
874 Ga0207711_10132110
875 Ga0207711_10145247
876 Ga0207711_10343719
877 Ga0207689_10020792
878 Ga0207661_10030606
879 Ga0207661_10078335
880 Ga0207661_10772977
881 Ga0207661_10940839
882 Ga0207661_11703998
883 Ga0207679_10013591
884 Ga0207679_10030295
885 Ga0207679_10034420
886 Ga0207679_10170281
887 Ga0207679_10335022
888 Ga0207679_11159978
889 Ga0207679_11415984
890 Ga0207667_10146611
891 Ga0207651_10129205
892 Ga0207651_10279270
893 Ga0207712_10014066
894 Ga0207712_10061343
895 Ga0207668_10070182
896 Ga0207640_10214423
897 Ga0207658_10316056
898 Ga0207658_10341928
899 Ga0207658_10792959
900 Ga0207703_10060468
901 Ga0207703_10085182
902 Ga0207703_12280001
903 Ga0207639_10001576
904 Ga0207639_10053035
905 Ga0207639_10121437
906 Ga0207639_10394112
907 Ga0207678_10008895
908 Ga0207708_10173021
909 Ga0207708_10657596
910 Ga0207702_11690275
911 Ga0207641_10069354
912 Ga0207641_10087531
913 Ga0207641_10384251
914 Ga0207648_10023576
915 Ga0207648_10037030
916 Ga0207648_10200179
917 Ga0207648_10280590
918 Ga0207648_10403710
919 Ga0207648_10534696
920 Ga0207676_10061503
921 Ga0207676_10114464
922 Ga0207676_10237009
923 Ga0207676_10267575
924 Ga0207674_10001029
925 Ga0207674_10009866
926 Ga0207674_10012601
927 Ga0207674_10025524
928 Ga0207674_10786262
929 Ga0207675_100009300
930 Ga0207675_100551079
931 Ga0207675_100594194
932 Ga0207683_10058503
933 Ga0207683_10312032
934 Ga0207683_11417529
935 Ga0207683_11558518
936 Ga0207683_11649944
937 Ga0207698_10081666
938 Ga0207698_10170875
939 Ga0207698_10360379
940 Ga0207698_11325203
941 Ga0209974_10380301
942 Ga0268265_10009803
943 Ga0268265_10020612
944 Ga0268265_10302758
945 Ga0268265_10779897
946 Ga0268264_10092896
947 Ga0268264_10212355
948 Ga0265331_10105180
949 Ga0265327_10027270
950 Ga0307408_100003070
951 Ga0307408_100016786
952 Ga0307408_101181730
953 Ga0265314_10002966
954 Ga0307405_10000529
955 Ga0307405_10057979
956 Ga0307405_11043388
957 Ga0307405_11484737
958 Ga0307413_10004105
959 Ga0307413_10045353
960 Ga0307413_10060285
961 Ga0307413_10329569
962 Ga0307413_10333116
963 Ga0307410_10002656
964 Ga0307410_10024065
965 Ga0307410_10034976
966 Ga0307410_10224259
967 Ga0307410_10472504
968 Ga0307406_10001540
969 Ga0307406_10014971
970 Ga0307406_10024589
971 Ga0307406_10333074
972 Ga0307406_10635906
973 Ga0307406_10827118
974 Ga0307406_11237117
975 Ga0307406_11409395
976 Ga0307407_10000765
977 Ga0307407_10001112
978 Ga0307407_10109307
979 Ga0307407_10229414
980 Ga0307407_10244522
981 Ga0307407_10410342
982 Ga0307412_10000820
983 Ga0307412_10084477
984 Ga0307409_100001085
985 Ga0307409_100133159
986 Ga0307409_100458061
987 Ga0307409_100458917
988 Ga0307416_100002894
989 Ga0307416_100094770
990 Ga0307416_100154980
991 Ga0307416_100228662
992 Ga0307416_100403775
993 Ga0307416_100483295
994 Ga0307416_100697430
995 Ga0307414_10126151
996 Ga0307414_10127774
997 Ga0307414_10780848
998 Ga0307414_11021872
999 Ga0307411_10003308
1000 Ga0307411_10083443
1001 Ga0307411_10179099
1002 Ga0307415_100007070
1003 Ga0307415_100030625
1004 Ga0307415_100176631
1005 Ga0307415_100267155
1006 Ga0307415_100597386
1007 Ga0373943_0409329
1008 Ga0373927_0916352
1009 Ga0373947_0675817
1010 Ga0395905_1727798
1011 Ga0400489_89059
1012 Ga0436365_0752795
1013 Ga0439438_101355
1014 Ga0439439_0092737
1015 Ga0439466_0063414
1016 Ga0451804_0128962
1017 Ga0451807_2482904
1018 Ga0451843_0292727
1019 Ga0451853_0793158
1020 Ga0439448_0202458
1021 Ga0439432_083880
1022 Ga0439449_0352649
1023 Ga0450889_014830
1024 Ga0439464_0057063
1025 Ga0451576_0109529
1026 Ga0451576_0533392
1027 Ga0495629_0194965
1028 Ga0495582_0044249
1029 Ga0495598_0003096
1030 Ga0495613_0425426
1031 Ga0496108_1075014
1032 Ga0496108_1345264
1033 Ga0496109_0442049
1034 Ga0496109_0514919
1035 Ga0496113_0994762
1036 Ga0501298_148288
1037 Ga0501235_219396
1038 Ga0501249_156130
1039 Ga0501250_006663
1040 Ga0501225_0041941
1041 Ga0501245_046290
1042 Ga0501263_030351
1043 nmdc:mga05p37_41501_c1
1044 nmdc:mga09592_42520_c1
1045 nmdc:mga09592_546942_c1
1046 nmdc:mga0qj67_39891_c1
1047 nmdc:mga0qj67_575149_c1
1048 nmdc:mga0qj67_632607_c1
1049 nmdc:mga0qj67_8075_c1
1050 nmdc:mga0qj67_87182_c1
1051 nmdc:mga06r32_590778_c1
1052 nmdc:mga06r32_643969_c1
1053 nmdc:mga08y16_119861_c1
1054 nmdc:mga08y16_352738_c1
1055 nmdc:mga0n895_299592_c1
1056 nmdc:mga0n895_80275_c1
1057 nmdc:mga0a205_17208_c2
1058 nmdc:mga0a205_337590_c1
1059 nmdc:mga0a205_50212_c1
1060 Ga0495601_0081119
1061 Ga0495619_1209976
1062 Ga0500577_0002458
1063 Ga0501084_0485412
1064 Ga0501082_0368668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

6

125

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mqw-assembly2.cif.gz_F crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag 0.9685 2 123
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9683 2 125
3quw-assembly1.cif.gz_A crystal structure of yeast mmf1 0.9663 2 125
3mqw-assembly1.cif.gz_B crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag 0.9633 2 123
2dyy-assembly2.cif.gz_E crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.963 2 124
ID Description Score Start End Superfamily
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9683 2 125 3.30.1330.40
3mqwD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9664 2 123 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9629 2 123 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.962 2 125 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9598 1 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-F2UES7-F1-model_v4 Endoribonuclease L-PSP 0.98 2 125 GO:0005739
GO:0005829
GO:0019239
AF-A0A1D1ZAS0-F1-model_v4 RutC family protein PYRAB12510 0.9793 2 125 GO:0005739
GO:0005829
GO:0019239
AF-A0A6N9GUD3-F1-model_v4 Deaminase 0.9792 1 125 GO:0005829
GO:0019239
AF-A0A0L0HUD4-F1-model_v4 Uncharacterized protein 0.9764 2 125 GO:0005739
GO:0005829
GO:0019239
AF-A0A2Z6RRW5-F1-model_v4 Protein kinase domain-containing protein 0.9764 2 123 GO:0004674
GO:0005524

Map