F460338

General Info

Members Datasets Scaffolds Average Seq Length
532 293 1064 130

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_474124_c1|nmdc:mga0a205_474124_c1_77_472
Length 122
Sequence LAATIEYYGTGKRKNAVARVLLRPGQGEIKINDRDIETYFPSAVLRTVVRSPLLVTETAERFNMAGQAGAVRHGISRALLEYNTELRMKLKEAGFLTRDSRIKERKKYGQKGARKRFQFSKR

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
161 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
162 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
163 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
192 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
193 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
194 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
195 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
196 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 2.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 1.88
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_474124_c1 3300050515 Bacteria 1110
2 JGI24034J26672_10071135 3300002239 Bacteria 623
3 JGI24742J22300_10016149 3300002244 Bacteria 1259
4 rootL2_10015203 3300003322 Bacteria 2099
5 Ga0065714_10137061 3300005288 Bacteria 1201
6 Ga0065712_10003855 3300005290 Bacteria 5392
7 Ga0065715_10143316 3300005293 Bacteria 1822
8 Ga0065707_10008765 3300005295 Bacteria 2558
9 Ga0065707_10097393 3300005295 Bacteria 3178
10 Ga0070676_10023072 3300005328 Bacteria 3495
11 Ga0070676_10167156 3300005328 Bacteria 1420
12 Ga0070690_100066053 3300005330 Bacteria 2340
13 Ga0070690_100237886 3300005330 Bacteria 1283
14 Ga0070690_100365598 3300005330 Bacteria 1051
15 Ga0070670_100011000 3300005331 Bacteria 7730
16 Ga0068869_100122584 3300005334 Bacteria 1990
17 Ga0068869_100188931 3300005334 Bacteria 1619
18 Ga0068869_100264147 3300005334 Bacteria 1379
19 Ga0068869_100501258 3300005334 Bacteria 1014
20 Ga0070666_10022827 3300005335 Bacteria 4066
21 Ga0070666_10127318 3300005335 Bacteria 1768
22 Ga0070680_100492119 3300005336 Bacteria 1049
23 Ga0070682_100085309 3300005337 Bacteria 2054
24 Ga0070689_100879759 3300005340 Bacteria 792
25 Ga0070687_100278628 3300005343 Bacteria 1051
26 Ga0070687_101269176 3300005343 Bacteria 546
27 Ga0070692_10209495 3300005345 Bacteria 1146
28 Ga0070668_100509239 3300005347 Bacteria 1043
29 Ga0070669_100000164 3300005353 Bacteria 58203
30 Ga0070669_100065955 3300005353 Bacteria 2667
31 Ga0070669_100682001 3300005353 Bacteria 866
32 Ga0070669_101295211 3300005353 Bacteria 631
33 Ga0070675_100319443 3300005354 Bacteria 1371
34 Ga0070675_100356665 3300005354 Bacteria 1298
35 Ga0070674_101148759 3300005356 Bacteria 687
36 Ga0070673_100044423 3300005364 Bacteria 3440
37 Ga0070673_100238814 3300005364 Bacteria 1579
38 Ga0070688_100353334 3300005365 Bacteria 1076
39 Ga0070688_100654026 3300005365 Bacteria 810
40 Ga0070688_100664474 3300005365 Bacteria 804
41 Ga0070688_101044665 3300005365 Bacteria 651
42 Ga0070659_101669334 3300005366 Bacteria 569
43 Ga0070667_102097513 3300005367 Bacteria 532
44 Ga0070703_10169917 3300005406 Bacteria 834
45 Ga0070709_10000083 3300005434 Bacteria 70658
46 Ga0070709_10272640 3300005434 Bacteria 1227
47 Ga0070709_11224656 3300005434 Unclassified 604
48 Ga0070713_101524428 3300005436 Bacteria 649
49 Ga0070710_10232429 3300005437 Bacteria 1178
50 Ga0070701_10087987 3300005438 Bacteria 1696
51 Ga0070700_100119768 3300005441 Bacteria 1762
52 Ga0070700_100347971 3300005441 Bacteria 1098
53 Ga0070700_100486101 3300005441 Bacteria 947
54 Ga0070694_100001347 3300005444 Bacteria 14324
55 Ga0070708_101104893 3300005445 Bacteria 743
56 Ga0070708_101469618 3300005445 Bacteria 635
57 Ga0070708_101867310 3300005445 Bacteria 557
58 Ga0070663_100582943 3300005455 Bacteria 938
59 Ga0070663_100642522 3300005455 Bacteria 896
60 Ga0070663_100682182 3300005455 Unclassified 872
61 Ga0070662_100043656 3300005457 Bacteria 3208
62 Ga0070681_10266198 3300005458 Bacteria 1625
63 Ga0068867_100319593 3300005459 Bacteria 1286
64 Ga0068867_101437055 3300005459 Bacteria 640
65 Ga0070685_10002620 3300005466 Bacteria 9214
66 Ga0070685_10500286 3300005466 Bacteria 860
67 Ga0070685_11084095 3300005466 Bacteria 604
68 Ga0070706_100253590 3300005467 Bacteria 1642
69 Ga0070706_100686934 3300005467 Bacteria 950
70 Ga0070698_100041601 3300005471 Bacteria 4717
71 Ga0070699_100000291 3300005518 Bacteria 48229
72 Ga0070699_100069114 3300005518 Bacteria 3069
73 Ga0070699_101261717 3300005518 Bacteria 678
74 Ga0070679_100061330 3300005530 Bacteria 3748
75 Ga0070684_100454525 3300005535 Bacteria 1184
76 Ga0070697_100004085 3300005536 Bacteria 11195
77 Ga0070697_100049641 3300005536 Bacteria 3406
78 Ga0070672_100169632 3300005543 Bacteria 1814
79 Ga0070672_100511948 3300005543 Bacteria 1039
80 Ga0070686_100078006 3300005544 Bacteria 2186
81 Ga0070695_100117342 3300005545 Bacteria 1816
82 Ga0070693_100716578 3300005547 Bacteria 734
83 Ga0070665_100000280 3300005548 Bacteria 83526
84 Ga0070704_100030445 3300005549 Bacteria 3617
85 Ga0070704_100141791 3300005549 Bacteria 1877
86 Ga0070704_100158377 3300005549 Bacteria 1788
87 Ga0070704_100380185 3300005549 Bacteria 1199
88 Ga0070704_100832523 3300005549 Bacteria 826
89 Ga0068855_100605004 3300005563 Bacteria 1182
90 Ga0068857_100313554 3300005577 Bacteria 1447
91 Ga0068857_100331733 3300005577 Bacteria 1406
92 Ga0068854_100250909 3300005578 Bacteria 1413
93 Ga0070702_101497065 3300005615 Bacteria 555
94 Ga0068859_100002086 3300005617 Bacteria 20362
95 Ga0068859_100002935 3300005617 Bacteria 17320
96 Ga0068859_100640559 3300005617 Bacteria 1155
97 Ga0068864_100192204 3300005618 Bacteria 1872
98 Ga0068866_10279762 3300005718 Bacteria 1033
99 Ga0068861_100020307 3300005719 Bacteria 4756
100 Ga0068861_100389986 3300005719 Bacteria 1233
101 Ga0068861_100426016 3300005719 Bacteria 1183
102 Ga0068863_100581767 3300005841 Bacteria 1107
103 Ga0068863_100938365 3300005841 Bacteria 866
104 Ga0068858_100260529 3300005842 Bacteria 1648
105 Ga0068860_100729509 3300005843 Bacteria 1002
106 Ga0068860_100872934 3300005843 Bacteria 915
107 Ga0068860_102532044 3300005843 Bacteria 533
108 Ga0068862_100001494 3300005844 Bacteria 21448
109 Ga0068862_100175623 3300005844 Unclassified 1920
110 Ga0081455_10102296 3300005937 Bacteria 2297
111 Ga0081455_10145173 3300005937 Bacteria 1837
112 Ga0081539_10000558 3300005985 Bacteria 77001
113 Ga0070717_10172670 3300006028 Bacteria 1881
114 Ga0070717_10371355 3300006028 Bacteria 1281
115 Ga0075368_10020789 3300006042 Bacteria 2487
116 Ga0075368_10034245 3300006042 Bacteria 1978
117 Ga0075363_100150966 3300006048 Bacteria 1311
118 Ga0075364_10450390 3300006051 Bacteria 879
119 Ga0070715_10515768 3300006163 Bacteria 687
120 Ga0070716_100012129 3300006173 Bacteria 4360
121 Ga0070712_100765704 3300006175 Bacteria 827
122 Ga0075367_10240034 3300006178 Bacteria 1135
123 Ga0075427_10115501 3300006194 Bacteria 508
124 Ga0075366_10051128 3300006195 Bacteria 2455
125 Ga0075370_10044896 3300006353 Bacteria 2498
126 Ga0068871_100390955 3300006358 Bacteria 1237
127 Ga0068871_100541759 3300006358 Bacteria 1053
128 Ga0068871_101112681 3300006358 Bacteria 739
129 Ga0075428_100006266 3300006844 Bacteria 13226
130 Ga0075428_100018361 3300006844 Bacteria 7733
131 Ga0075428_100413861 3300006844 Bacteria 1444
132 Ga0075431_100027553 3300006847 Bacteria 5832
133 Ga0075431_100330565 3300006847 Bacteria 1535
134 Ga0075431_100575504 3300006847 Bacteria 1112
135 Ga0075431_100699802 3300006847 Bacteria 991
136 Ga0075433_10024087 3300006852 Bacteria 5133
137 Ga0075433_10076205 3300006852 Bacteria 2953
138 Ga0075433_10366838 3300006852 Bacteria 1272
139 Ga0075433_10821858 3300006852 Bacteria 812
140 Ga0075434_100057271 3300006871 Bacteria 3873
141 Ga0075434_100134374 3300006871 Bacteria 2493
142 Ga0075434_100287013 3300006871 Bacteria 1665
143 Ga0075434_100318467 3300006871 Bacteria 1576
144 Ga0075434_100530671 3300006871 Bacteria 1197
145 Ga0075434_101569744 3300006871 Bacteria 667
146 Ga0068865_100323411 3300006881 Bacteria 1241
147 Ga0068865_100732029 3300006881 Bacteria 848
148 Ga0068865_101121506 3300006881 Bacteria 694
149 Ga0075436_100019506 3300006914 Bacteria 4647
150 Ga0097620_100002086 3300006931 Bacteria 20362
151 Ga0097620_100002935 3300006931 Bacteria 17320
152 Ga0097620_100640571 3300006931 Bacteria 1155
153 Ga0075435_100032075 3300007076 Bacteria 4147
154 Ga0075435_100066042 3300007076 Bacteria 2942
155 Ga0075435_100421965 3300007076 Bacteria 1149
156 Ga0105240_10102383 3300009093 Bacteria 3480
157 Ga0111539_10053096 3300009094 Bacteria 4824
158 Ga0111539_10165868 3300009094 Bacteria 2582
159 Ga0111539_10166749 3300009094 Bacteria 2575
160 Ga0111539_10421578 3300009094 Bacteria 1554
161 Ga0105245_10043090 3300009098 Bacteria 4026
162 Ga0114129_10028282 3300009147 Bacteria 7943
163 Ga0114129_10037893 3300009147 Bacteria 6803
164 Ga0114129_10241081 3300009147 Bacteria 2430
165 Ga0114129_10378323 3300009147 Bacteria 1870
166 Ga0114129_10869930 3300009147 Bacteria 1144
167 Ga0114129_10981291 3300009147 Bacteria 1065
168 Ga0114129_11684671 3300009147 Bacteria 774
169 Ga0114129_11687242 3300009147 Bacteria 773
170 Ga0105243_10379088 3300009148 Bacteria 1308
171 Ga0105243_11191632 3300009148 Bacteria 774
172 Ga0105241_10096797 3300009174 Bacteria 2339
173 Ga0105242_10155632 3300009176 Bacteria 1996
174 Ga0105242_10520256 3300009176 Bacteria 1135
175 Ga0105242_10632897 3300009176 Bacteria 1038
176 Ga0105238_11227710 3300009551 Bacteria 774
177 Ga0105249_10116457 3300009553 Bacteria 2533
178 Ga0105249_10226052 3300009553 Bacteria 1844
179 Ga0105249_10512621 3300009553 Bacteria 1246
180 Ga0105249_10760271 3300009553 Bacteria 1031
181 Ga0105249_12235691 3300009553 Bacteria 620
182 Ga0105249_13400426 3300009553 Bacteria 512
183 Ga0157369_10279877 3300013105 Bacteria 1737
184 Ga0157378_10455153 3300013297 Bacteria 1271
185 Ga0163162_11315190 3300013306 Bacteria 821
186 Ga0163162_11339418 3300013306 Bacteria 814
187 Ga0157375_10037412 3300013308 Bacteria 4650
188 Ga0157375_10367711 3300013308 Bacteria 1604
189 Ga0157375_10497625 3300013308 Bacteria 1383
190 Ga0163163_10131955 3300014325 Bacteria 2538
191 Ga0163163_11131908 3300014325 Bacteria 846
192 Ga0163163_12880754 3300014325 Unclassified 537
193 Ga0157380_10963869 3300014326 Bacteria 884
194 Ga0157380_12470345 3300014326 Bacteria 585
195 Ga0157380_12751764 3300014326 Bacteria 558
196 Ga0157377_10657843 3300014745 Bacteria 755
197 Ga0163161_10259788 3300017792 Bacteria 1356
198 Ga0206356_10280488 3300020070 Bacteria 2190
199 Ga0224712_10078995 3300022467 Bacteria 1354
200 Ga0207697_10354283 3300025315 Bacteria 652
201 Ga0207653_10138597 3300025885 Bacteria 888
202 Ga0207692_10212724 3300025898 Bacteria 1142
203 Ga0207688_10022213 3300025901 Bacteria 3470
204 Ga0207680_10073099 3300025903 Bacteria 2131
205 Ga0207680_10310372 3300025903 Bacteria 1101
206 Ga0207680_10723624 3300025903 Bacteria 713
207 Ga0207699_10000084 3300025906 Bacteria 70467
208 Ga0207699_10228473 3300025906 Bacteria 1274
209 Ga0207699_10884597 3300025906 Unclassified 659
210 Ga0207645_10013115 3300025907 Bacteria 5599
211 Ga0207645_10904726 3300025907 Bacteria 599
212 Ga0207645_11066913 3300025907 Bacteria 546
213 Ga0207705_10019852 3300025909 Bacteria 4807
214 Ga0207695_10117274 3300025913 Bacteria 2635
215 Ga0207660_10631401 3300025917 Bacteria 873
216 Ga0207652_10397720 3300025921 Bacteria 1243
217 Ga0207646_10521441 3300025922 Bacteria 1070
218 Ga0207681_10000056 3300025923 Bacteria 106145
219 Ga0207681_10050655 3300025923 Bacteria 2810
220 Ga0207681_11224867 3300025923 Bacteria 630
221 Ga0207694_10743660 3300025924 Bacteria 828
222 Ga0207650_10152892 3300025925 Bacteria 1822
223 Ga0207650_10315765 3300025925 Bacteria 1279
224 Ga0207659_10276960 3300025926 Bacteria 1370
225 Ga0207659_11310176 3300025926 Bacteria 622
226 Ga0207700_10140695 3300025928 Bacteria 1982
227 Ga0207700_11001870 3300025928 Bacteria 748
228 Ga0207700_11031704 3300025928 Unclassified 736
229 Ga0207706_10228635 3300025933 Bacteria 1628
230 Ga0207706_10855485 3300025933 Bacteria 770
231 Ga0207686_10445831 3300025934 Bacteria 995
232 Ga0207709_10415395 3300025935 Bacteria 1032
233 Ga0207709_10851898 3300025935 Bacteria 738
234 Ga0207670_10192965 3300025936 Bacteria 1542
235 Ga0207670_10639848 3300025936 Bacteria 876
236 Ga0207669_10006694 3300025937 Bacteria 5284
237 Ga0207704_10316650 3300025938 Bacteria 1202
238 Ga0207704_10495668 3300025938 Bacteria 983
239 Ga0207704_10654450 3300025938 Bacteria 866
240 Ga0207704_11191794 3300025938 Bacteria 649
241 Ga0207665_10014606 3300025939 Bacteria 5169
242 Ga0207691_10012366 3300025940 Bacteria 8181
243 Ga0207691_10801599 3300025940 Unclassified 791
244 Ga0207711_11067443 3300025941 Unclassified 748
245 Ga0207689_10057239 3300025942 Bacteria 3207
246 Ga0207689_10092815 3300025942 Bacteria 2480
247 Ga0207689_10143324 3300025942 Bacteria 1969
248 Ga0207689_11002748 3300025942 Bacteria 704
249 Ga0207667_11514451 3300025949 Bacteria 641
250 Ga0207651_10099523 3300025960 Bacteria 2153
251 Ga0207651_10418676 3300025960 Bacteria 1143
252 Ga0207712_10250909 3300025961 Bacteria 1430
253 Ga0207712_10363984 3300025961 Bacteria 1206
254 Ga0207712_10565236 3300025961 Bacteria 980
255 Ga0207712_12003210 3300025961 Bacteria 518
256 Ga0207658_10903684 3300025986 Bacteria 804
257 Ga0207677_11652512 3300026023 Bacteria 593
258 Ga0207703_10494871 3300026035 Bacteria 1147
259 Ga0207678_10088138 3300026067 Bacteria 2652
260 Ga0207678_10304998 3300026067 Bacteria 1369
261 Ga0207708_10007629 3300026075 Bacteria 8005
262 Ga0207708_10103163 3300026075 Bacteria 2209
263 Ga0207708_10445239 3300026075 Bacteria 1078
264 Ga0207708_11096905 3300026075 Bacteria 694
265 Ga0207702_11741863 3300026078 Bacteria 616
266 Ga0207641_10757831 3300026088 Bacteria 959
267 Ga0207648_10170150 3300026089 Bacteria 1926
268 Ga0207676_10105833 3300026095 Bacteria 2343
269 Ga0207676_10641639 3300026095 Bacteria 1024
270 Ga0207674_10488762 3300026116 Bacteria 1190
271 Ga0207674_10883406 3300026116 Bacteria 862
272 Ga0207675_100043836 3300026118 Bacteria 4179
273 Ga0207675_100063773 3300026118 Bacteria 3443
274 Ga0207675_100982722 3300026118 Bacteria 862
275 Ga0207683_11711497 3300026121 Bacteria 578
276 Ga0207683_11822542 3300026121 Bacteria 557
277 Ga0207698_12543170 3300026142 Bacteria 522
278 Ga0209813_10028285 3300027866 Bacteria 1634
279 Ga0209813_10115076 3300027866 Bacteria 930
280 Ga0209813_10184074 3300027866 Bacteria 766
281 Ga0207428_10168769 3300027907 Bacteria 1658
282 Ga0207428_10294840 3300027907 Bacteria 1201
283 Ga0268266_10001178 3300028379 Bacteria 32300
284 Ga0268265_10000230 3300028380 Bacteria 63968
285 Ga0268265_10284570 3300028380 Bacteria 1481
286 Ga0268265_10587260 3300028380 Bacteria 1063
287 Ga0268264_10102310 3300028381 Bacteria 2493
288 Ga0268264_10255483 3300028381 Bacteria 1630
289 Ga0268264_11144258 3300028381 Bacteria 787
290 Ga0268264_11193180 3300028381 Bacteria 770
291 Ga0268264_11535887 3300028381 Bacteria 676
292 Ga0268264_12041901 3300028381 Bacteria 582
293 Ga0307511_10021467 3300030521 Bacteria 6081
294 Ga0307408_101311951 3300031548 Bacteria 679
295 Ga0316575_10013931 3300031665 Bacteria 3013
296 Ga0316576_10061175 3300031727 Bacteria 2759
297 Ga0316576_10091432 3300031727 Bacteria 2267
298 Ga0316576_10094456 3300031727 Bacteria 2230
299 Ga0316576_10104774 3300031727 Bacteria 2117
300 Ga0316576_10213457 3300031727 Bacteria 1452
301 Ga0316578_10017974 3300031728 Bacteria 3862
302 Ga0316578_10026254 3300031728 Bacteria 3283
303 Ga0316577_10059560 3300031733 Bacteria 2131
304 Ga0316577_10243189 3300031733 Bacteria 1018
305 Ga0316577_10311415 3300031733 Bacteria 892
306 Ga0307416_102041733 3300032002 Bacteria 676
307 Ga0316583_10003154 3300032133 Bacteria 5794
308 Ga0316583_10004720 3300032133 Bacteria 4865
309 Ga0316583_10029653 3300032133 Bacteria 1950
310 Ga0316583_10131006 3300032133 Bacteria 874
311 Ga0316585_10001279 3300032137 Bacteria 6587
312 Ga0316580_10141064 3300032139 Bacteria 739
313 Ga0316593_10032088 3300032168 Bacteria 1714
314 Ga0316593_10056123 3300032168 Bacteria 1339
315 Ga0316593_10149565 3300032168 Bacteria 849
316 Ga0373929_0000001 3300035085 Bacteria 956023
317 Ga0373934_0008552 3300035086 Bacteria 3816
318 Ga0373923_0451656 3300035111 Bacteria 623
319 Ga0373941_0287476 3300035115 Bacteria 652
320 Ga0373954_0027288 3300035118 Bacteria 2620
321 Ga0373956_0119716 3300035119 Bacteria 1229
322 Ga0373956_0402060 3300035119 Bacteria 653
323 Ga0373957_0289497 3300035120 Bacteria 693
324 Ga0373943_0262970 3300035170 Bacteria 972
325 Ga0373955_0711254 3300035172 Bacteria 617
326 Ga0316574_0020417 3300035398 Bacteria 3921
327 Ga0316574_0081022 3300035398 Bacteria 2061
328 Ga0316574_0483000 3300035398 Bacteria 774
329 Ga0316574_0537124 3300035398 Bacteria 727
330 Ga0373935_0277291 3300035692 Bacteria 1180
331 Ga0373933_0010133 3300035724 Bacteria 5160
332 Ga0373933_0768769 3300035724 Bacteria 634
333 Ga0373937_0002505 3300036401 Bacteria 15255
334 Ga0373937_0006813 3300036401 Bacteria 9859
335 Ga0316582_0038604 3300036647 Bacteria 2969
336 Ga0316582_0092199 3300036647 Bacteria 1996
337 Ga0316582_0257144 3300036647 Bacteria 1197
338 Ga0316584_0093223 3300036712 Bacteria 2255
339 Ga0316584_0165820 3300036712 Bacteria 1640
340 Ga0400483_015074 3300039062 Bacteria 1960
341 Ga0451789_0711377 3300041443 Bacteria 1197
342 Ga0451797_1350670 3300041453 Bacteria 1073
343 Ga0451795_0324929 3300041456 Bacteria 657
344 Ga0451802_0479589 3300041460 Bacteria 2023
345 Ga0451802_1679855 3300041460 Bacteria 1053
346 Ga0451807_0377212 3300041486 Bacteria 1876
347 Ga0451807_2063280 3300041486 Bacteria 1527
348 Ga0451841_0760955 3300041498 Bacteria 540
349 Ga0439431_0050350 3300041997 Bacteria 1079
350 Ga0439433_0065882 3300041999 Bacteria 869
351 Ga0439442_037960 3300042002 Bacteria 1010
352 Ga0439445_0165698 3300042004 Bacteria 646
353 Ga0439449_0093936 3300042007 Bacteria 1108
354 Ga0450920_012036 3300042122 Bacteria 1618
355 Ga0450895_001666 3300042132 Bacteria 1571
356 Ga0450896_001923 3300042133 Bacteria 2636
357 Ga0450906_012541 3300042145 Bacteria 1570
358 Ga0450910_033902 3300042147 Bacteria 809
359 Ga0450908_016281 3300042184 Bacteria 1327
360 Ga0451577_0056839 3300042876 Bacteria 3490
361 Ga0451577_0082175 3300042876 Bacteria 2873
362 Ga0451577_1198408 3300042876 Bacteria 677
363 Ga0451577_1584705 3300042876 Bacteria 578
364 Ga0453683_0113285 3300044673 Bacteria 1706
365 Ga0453683_0833824 3300044673 Bacteria 608
366 Ga0453683_1143828 3300044673 Bacteria 520
367 Ga0453684_0101505 3300044712 Bacteria 3520
368 Ga0453684_0549334 3300044712 Bacteria 1272
369 Ga0453684_1622476 3300044712 Bacteria 663
370 Ga0466960_0025774 3300044901 Bacteria 2664
371 Ga0451576_0041983 3300045051 Bacteria 4830
372 Ga0451576_1159845 3300045051 Bacteria 807
373 Ga0466967_2217173 3300045976 Bacteria 545
374 Ga0495629_0001085 3300046459 Bacteria 21608
375 Ga0495629_0018969 3300046459 Bacteria 4919
376 Ga0495638_0006310 3300046460 Bacteria 8643
377 Ga0495638_0255107 3300046460 Bacteria 965
378 Ga0495651_0305636 3300046462 Bacteria 1065
379 Ga0495582_0007932 3300046473 Bacteria 5866
380 Ga0495639_0002890 3300046475 Bacteria 7477
381 Ga0495639_0016731 3300046475 Bacteria 3184
382 Ga0495662_0038269 3300046476 Bacteria 2318
383 Ga0495594_0004579 3300046499 Bacteria 7116
384 Ga0495594_0540581 3300046499 Bacteria 661
385 Ga0495596_0176640 3300046500 Bacteria 830
386 Ga0495630_1296817 3300046517 Bacteria 549
387 Ga0495644_0386885 3300046523 Bacteria 553
388 Ga0495663_0142217 3300046525 Bacteria 815
389 Ga0495640_0663727 3300046533 Bacteria 627
390 Ga0495586_0063358 3300046535 Bacteria 2014
391 Ga0495587_0127747 3300046536 Bacteria 1454
392 Ga0495587_0292827 3300046536 Bacteria 911
393 Ga0495598_0059278 3300046537 Bacteria 1176
394 Ga0495621_0067321 3300046539 Bacteria 1312
395 Ga0495645_0759853 3300046543 Bacteria 584
396 Ga0495622_0221978 3300046557 Bacteria 837
397 Ga0495633_0114400 3300046558 Bacteria 1251
398 Ga0495656_0217655 3300046615 Bacteria 954
399 Ga0495668_0296147 3300046616 Bacteria 887
400 Ga0495634_0860124 3300046642 Bacteria 515
401 Ga0495635_0001421 3300046663 Bacteria 15967
402 Ga0495658_0000401 3300046683 Bacteria 24251
403 Ga0495669_0678074 3300046684 Bacteria 501
404 Ga0495600_0901904 3300046809 Bacteria 521
405 Ga0495581_0000586 3300047315 Bacteria 19006
406 Ga0495581_0053939 3300047315 Bacteria 2321
407 Ga0495636_0421282 3300047318 Bacteria 638
408 Ga0495672_0205463 3300047320 Bacteria 982
409 Ga0495676_0130421 3300047321 Bacteria 1815
410 Ga0495680_0003220 3300047322 Bacteria 16223
411 Ga0495680_0148675 3300047322 Bacteria 1709
412 Ga0495602_0325974 3300048088 Bacteria 1116
413 Ga0495602_0539759 3300048088 Bacteria 810
414 Ga0495614_0095409 3300048089 Bacteria 1296
415 Ga0496103_0235257 3300048906 Bacteria 1179
416 Ga0496104_1056706 3300048907 Bacteria 716
417 Ga0496109_0749565 3300048912 Bacteria 914
418 Ga0501306_013195 3300049127 Bacteria 1075
419 Ga0501311_041273 3300049527 Bacteria 700
420 Ga0501316_044664 3300049532 Bacteria 626
421 Ga0501324_019133 3300049540 Bacteria 690
422 Ga0501032_0390246 3300049569 Bacteria 895
423 Ga0501033_0924096 3300049570 Bacteria 586
424 Ga0501037_0370105 3300049573 Bacteria 986
425 Ga0501038_0005479 3300049574 Bacteria 11789
426 Ga0501038_0208259 3300049574 Bacteria 1566
427 Ga0501039_0199847 3300049575 Bacteria 1572
428 Ga0501039_0434341 3300049575 Bacteria 1031
429 Ga0501039_0879123 3300049575 Bacteria 698
430 Ga0501040_0147414 3300049576 Bacteria 1659
431 Ga0501040_0722678 3300049576 Bacteria 720
432 Ga0501041_0053510 3300049577 Bacteria 2462
433 Ga0501042_0228606 3300049578 Bacteria 1342
434 Ga0501042_0444645 3300049578 Unclassified 940
435 Ga0501043_0014065 3300049579 Bacteria 6264
436 Ga0501046_0096966 3300049580 Bacteria 2265
437 Ga0501047_0002850 3300049581 Bacteria 16394
438 Ga0501047_1249521 3300049581 Bacteria 556
439 Ga0501048_0255283 3300049582 Bacteria 1245
440 Ga0501067_0002959 3300049583 Bacteria 9375
441 Ga0501068_0000298 3300049584 Bacteria 24810
442 Ga0501068_0274123 3300049584 Unclassified 1077
443 Ga0501069_0011603 3300049585 Bacteria 4670
444 Ga0501070_0115439 3300049586 Bacteria 2218
445 Ga0501071_0495094 3300049587 Bacteria 937
446 Ga0501072_0000013 3300049588 Bacteria 172318
447 Ga0501073_0001560 3300049589 Bacteria 16979
448 Ga0501073_0264198 3300049589 Bacteria 1188
449 Ga0501073_0315907 3300049589 Bacteria 1078
450 Ga0501074_0001093 3300049590 Bacteria 17708
451 Ga0501074_0902534 3300049590 Bacteria 622
452 Ga0501075_0462092 3300049591 Bacteria 968
453 Ga0501076_0005208 3300049592 Bacteria 9316
454 Ga0501076_0140135 3300049592 Bacteria 1964
455 Ga0501076_1148669 3300049592 Bacteria 639
456 Ga0501077_0042009 3300049593 Bacteria 2909
457 Ga0501230_168431 3300049667 Bacteria 502
458 Ga0501079_0000583 3300049741 Bacteria 24201
459 Ga0501079_0063163 3300049741 Bacteria 2857
460 Ga0501079_0426994 3300049741 Bacteria 1040
461 Ga0501080_0084855 3300049742 Bacteria 2942
462 Ga0501080_0246537 3300049742 Bacteria 1629
463 Ga0501080_0439657 3300049742 Bacteria 1170
464 Ga0501080_1292158 3300049742 Bacteria 625
465 Ga0501080_1713744 3300049742 Bacteria 530
466 Ga0501081_0070245 3300049743 Bacteria 2440
467 Ga0501081_0259804 3300049743 Bacteria 1269
468 Ga0501081_0932991 3300049743 Bacteria 655
469 Ga0501083_0002132 3300049744 Bacteria 13574
470 Ga0501083_0004309 3300049744 Bacteria 10023
471 Ga0501083_0006433 3300049744 Bacteria 8333
472 Ga0501083_0280312 3300049744 Bacteria 1084
473 Ga0501263_021577 3300049760 Bacteria 870
474 Ga0501035_0437120 3300049822 Unclassified 1084
475 Ga0501044_0061437 3300049823 Bacteria 3843
476 Ga0501045_0180083 3300049824 Bacteria 1575
477 Ga0501045_0965338 3300049824 Bacteria 625
478 nmdc:mga00v17_289450_c1 3300050491 Bacteria 1064
479 nmdc:mga0k408_16714_c2 3300050493 Bacteria 3730
480 nmdc:mga0k408_292593_c1 3300050493 Bacteria 972
481 nmdc:mga06z11_15279_c1 3300050494 Bacteria 3423
482 nmdc:mga04h51_102557_c1 3300050495 Bacteria 1044
483 nmdc:mga04h51_248068_c1 3300050495 Bacteria 713
484 nmdc:mga04h51_39600_c1 3300050495 Bacteria 1532
485 nmdc:mga07m45_151571_c1 3300050496 Bacteria 1345
486 nmdc:mga05p37_116790_c1 3300050507 Bacteria 3279
487 nmdc:mga05p37_1221939_c1 3300050507 Bacteria 774
488 nmdc:mga05p37_1629851_c1 3300050507 Bacteria 634
489 nmdc:mga05p37_367163_c1 3300050507 Bacteria 1690
490 nmdc:mga05p37_45244_c1 3300050507 Bacteria 5415
491 nmdc:mga05p37_720777_c1 3300050507 Bacteria 1104
492 nmdc:mga05p37_7671_c1 3300050507 Bacteria 12731
493 nmdc:mga05p37_89941_c1 3300050507 Bacteria 3783
494 nmdc:mga06r32_361101_c1 3300050510 Bacteria 1436
495 nmdc:mga06r32_49737_c2 3300050510 Bacteria 1033
496 nmdc:mga06r32_532091_c1 3300050510 Bacteria 759
497 nmdc:mga06r32_648054_c1 3300050510 Bacteria 1024
498 nmdc:mga08y16_154847_c1 3300050511 Bacteria 2382
499 nmdc:mga08y16_1757066_c1 3300050511 Bacteria 574
500 nmdc:mga08y16_483482_c1 3300050511 Bacteria 1260
501 nmdc:mga0n895_105622_c1 3300050512 Bacteria 2829
502 nmdc:mga0n895_1750244_c1 3300050512 Bacteria 583
503 nmdc:mga0n895_246885_c1 3300050512 Bacteria 1812
504 nmdc:mga0n895_442043_c1 3300050512 Bacteria 1314
505 nmdc:mga0n895_83882_c1 3300050512 Bacteria 3179
506 nmdc:mga0rr50_223925_c1 3300050513 Bacteria 1554
507 nmdc:mga0rr50_253929_c1 3300050513 Bacteria 1461
508 nmdc:mga0rr50_43944_c1 3300050513 Bacteria 3273
509 nmdc:mga0rr50_67190_c1 3300050513 Bacteria 2722
510 nmdc:mga0rr50_697722_c1 3300050513 Bacteria 866
511 nmdc:mga08x19_449669_c1 3300050514 Bacteria 907
512 nmdc:mga0a205_174267_c1 3300050515 Bacteria 2047
513 nmdc:mga0a205_194006_c1 3300050515 Bacteria 1922
514 nmdc:mga0a205_556941_c1 3300050515 Bacteria 1001
515 nmdc:mga0a205_601841_c1 3300050515 Bacteria 952
516 Ga0495619_0006248 3300053085 Bacteria 7557
517 Ga0495619_0710808 3300053085 Bacteria 683
518 Ga0495619_0753490 3300053085 Bacteria 660
519 Ga0500592_028656 3300053116 Bacteria 898
520 Ga0500568_0004595 3300053139 Bacteria 7346
521 Ga0501084_0000136 3300054114 Bacteria 55694
522 Ga0501084_0035628 3300054114 Bacteria 4160
523 Ga0501084_0649817 3300054114 Bacteria 890
524 Ga0501084_1445030 3300054114 Bacteria 576
525 Ga0587066_160779 3300059490 Bacteria 564
526 Ga0587111_0023103 3300060346 Bacteria 1213
527 Ga0501082_0000651 3300060353 Bacteria 30636
528 Ga0501082_0051914 3300060353 Bacteria 3534
529 Ga0501082_0053520 3300060353 Bacteria 3479
530 Ga0530510_0011015 3300061734 Bacteria 6344
531 Ga0530510_0108011 3300061734 Bacteria 2037
532 Ga0530510_0234601 3300061734 Bacteria 1365
533 nmdc:mga0a205_474124_c1
534 JGI24034J26672_10071135
535 JGI24742J22300_10016149
536 rootL2_10015203
537 Ga0065714_10137061
538 Ga0065712_10003855
539 Ga0065715_10143316
540 Ga0065707_10008765
541 Ga0065707_10097393
542 Ga0070676_10023072
543 Ga0070676_10167156
544 Ga0070690_100066053
545 Ga0070690_100237886
546 Ga0070690_100365598
547 Ga0070670_100011000
548 Ga0068869_100122584
549 Ga0068869_100188931
550 Ga0068869_100264147
551 Ga0068869_100501258
552 Ga0070666_10022827
553 Ga0070666_10127318
554 Ga0070680_100492119
555 Ga0070682_100085309
556 Ga0070689_100879759
557 Ga0070687_100278628
558 Ga0070687_101269176
559 Ga0070692_10209495
560 Ga0070668_100509239
561 Ga0070669_100000164
562 Ga0070669_100065955
563 Ga0070669_100682001
564 Ga0070669_101295211
565 Ga0070675_100319443
566 Ga0070675_100356665
567 Ga0070674_101148759
568 Ga0070673_100044423
569 Ga0070673_100238814
570 Ga0070688_100353334
571 Ga0070688_100654026
572 Ga0070688_100664474
573 Ga0070688_101044665
574 Ga0070659_101669334
575 Ga0070667_102097513
576 Ga0070703_10169917
577 Ga0070709_10000083
578 Ga0070709_10272640
579 Ga0070709_11224656
580 Ga0070713_101524428
581 Ga0070710_10232429
582 Ga0070701_10087987
583 Ga0070700_100119768
584 Ga0070700_100347971
585 Ga0070700_100486101
586 Ga0070694_100001347
587 Ga0070708_101104893
588 Ga0070708_101469618
589 Ga0070708_101867310
590 Ga0070663_100582943
591 Ga0070663_100642522
592 Ga0070663_100682182
593 Ga0070662_100043656
594 Ga0070681_10266198
595 Ga0068867_100319593
596 Ga0068867_101437055
597 Ga0070685_10002620
598 Ga0070685_10500286
599 Ga0070685_11084095
600 Ga0070706_100253590
601 Ga0070706_100686934
602 Ga0070698_100041601
603 Ga0070699_100000291
604 Ga0070699_100069114
605 Ga0070699_101261717
606 Ga0070679_100061330
607 Ga0070684_100454525
608 Ga0070697_100004085
609 Ga0070697_100049641
610 Ga0070672_100169632
611 Ga0070672_100511948
612 Ga0070686_100078006
613 Ga0070695_100117342
614 Ga0070693_100716578
615 Ga0070665_100000280
616 Ga0070704_100030445
617 Ga0070704_100141791
618 Ga0070704_100158377
619 Ga0070704_100380185
620 Ga0070704_100832523
621 Ga0068855_100605004
622 Ga0068857_100313554
623 Ga0068857_100331733
624 Ga0068854_100250909
625 Ga0070702_101497065
626 Ga0068859_100002086
627 Ga0068859_100002935
628 Ga0068859_100640559
629 Ga0068864_100192204
630 Ga0068866_10279762
631 Ga0068861_100020307
632 Ga0068861_100389986
633 Ga0068861_100426016
634 Ga0068863_100581767
635 Ga0068863_100938365
636 Ga0068858_100260529
637 Ga0068860_100729509
638 Ga0068860_100872934
639 Ga0068860_102532044
640 Ga0068862_100001494
641 Ga0068862_100175623
642 Ga0081455_10102296
643 Ga0081455_10145173
644 Ga0081539_10000558
645 Ga0070717_10172670
646 Ga0070717_10371355
647 Ga0075368_10020789
648 Ga0075368_10034245
649 Ga0075363_100150966
650 Ga0075364_10450390
651 Ga0070715_10515768
652 Ga0070716_100012129
653 Ga0070712_100765704
654 Ga0075367_10240034
655 Ga0075427_10115501
656 Ga0075366_10051128
657 Ga0075370_10044896
658 Ga0068871_100390955
659 Ga0068871_100541759
660 Ga0068871_101112681
661 Ga0075428_100006266
662 Ga0075428_100018361
663 Ga0075428_100413861
664 Ga0075431_100027553
665 Ga0075431_100330565
666 Ga0075431_100575504
667 Ga0075431_100699802
668 Ga0075433_10024087
669 Ga0075433_10076205
670 Ga0075433_10366838
671 Ga0075433_10821858
672 Ga0075434_100057271
673 Ga0075434_100134374
674 Ga0075434_100287013
675 Ga0075434_100318467
676 Ga0075434_100530671
677 Ga0075434_101569744
678 Ga0068865_100323411
679 Ga0068865_100732029
680 Ga0068865_101121506
681 Ga0075436_100019506
682 Ga0097620_100002086
683 Ga0097620_100002935
684 Ga0097620_100640571
685 Ga0075435_100032075
686 Ga0075435_100066042
687 Ga0075435_100421965
688 Ga0105240_10102383
689 Ga0111539_10053096
690 Ga0111539_10165868
691 Ga0111539_10166749
692 Ga0111539_10421578
693 Ga0105245_10043090
694 Ga0114129_10028282
695 Ga0114129_10037893
696 Ga0114129_10241081
697 Ga0114129_10378323
698 Ga0114129_10869930
699 Ga0114129_10981291
700 Ga0114129_11684671
701 Ga0114129_11687242
702 Ga0105243_10379088
703 Ga0105243_11191632
704 Ga0105241_10096797
705 Ga0105242_10155632
706 Ga0105242_10520256
707 Ga0105242_10632897
708 Ga0105238_11227710
709 Ga0105249_10116457
710 Ga0105249_10226052
711 Ga0105249_10512621
712 Ga0105249_10760271
713 Ga0105249_12235691
714 Ga0105249_13400426
715 Ga0157369_10279877
716 Ga0157378_10455153
717 Ga0163162_11315190
718 Ga0163162_11339418
719 Ga0157375_10037412
720 Ga0157375_10367711
721 Ga0157375_10497625
722 Ga0163163_10131955
723 Ga0163163_11131908
724 Ga0163163_12880754
725 Ga0157380_10963869
726 Ga0157380_12470345
727 Ga0157380_12751764
728 Ga0157377_10657843
729 Ga0163161_10259788
730 Ga0206356_10280488
731 Ga0224712_10078995
732 Ga0207697_10354283
733 Ga0207653_10138597
734 Ga0207692_10212724
735 Ga0207688_10022213
736 Ga0207680_10073099
737 Ga0207680_10310372
738 Ga0207680_10723624
739 Ga0207699_10000084
740 Ga0207699_10228473
741 Ga0207699_10884597
742 Ga0207645_10013115
743 Ga0207645_10904726
744 Ga0207645_11066913
745 Ga0207705_10019852
746 Ga0207695_10117274
747 Ga0207660_10631401
748 Ga0207652_10397720
749 Ga0207646_10521441
750 Ga0207681_10000056
751 Ga0207681_10050655
752 Ga0207681_11224867
753 Ga0207694_10743660
754 Ga0207650_10152892
755 Ga0207650_10315765
756 Ga0207659_10276960
757 Ga0207659_11310176
758 Ga0207700_10140695
759 Ga0207700_11001870
760 Ga0207700_11031704
761 Ga0207706_10228635
762 Ga0207706_10855485
763 Ga0207686_10445831
764 Ga0207709_10415395
765 Ga0207709_10851898
766 Ga0207670_10192965
767 Ga0207670_10639848
768 Ga0207669_10006694
769 Ga0207704_10316650
770 Ga0207704_10495668
771 Ga0207704_10654450
772 Ga0207704_11191794
773 Ga0207665_10014606
774 Ga0207691_10012366
775 Ga0207691_10801599
776 Ga0207711_11067443
777 Ga0207689_10057239
778 Ga0207689_10092815
779 Ga0207689_10143324
780 Ga0207689_11002748
781 Ga0207667_11514451
782 Ga0207651_10099523
783 Ga0207651_10418676
784 Ga0207712_10250909
785 Ga0207712_10363984
786 Ga0207712_10565236
787 Ga0207712_12003210
788 Ga0207658_10903684
789 Ga0207677_11652512
790 Ga0207703_10494871
791 Ga0207678_10088138
792 Ga0207678_10304998
793 Ga0207708_10007629
794 Ga0207708_10103163
795 Ga0207708_10445239
796 Ga0207708_11096905
797 Ga0207702_11741863
798 Ga0207641_10757831
799 Ga0207648_10170150
800 Ga0207676_10105833
801 Ga0207676_10641639
802 Ga0207674_10488762
803 Ga0207674_10883406
804 Ga0207675_100043836
805 Ga0207675_100063773
806 Ga0207675_100982722
807 Ga0207683_11711497
808 Ga0207683_11822542
809 Ga0207698_12543170
810 Ga0209813_10028285
811 Ga0209813_10115076
812 Ga0209813_10184074
813 Ga0207428_10168769
814 Ga0207428_10294840
815 Ga0268266_10001178
816 Ga0268265_10000230
817 Ga0268265_10284570
818 Ga0268265_10587260
819 Ga0268264_10102310
820 Ga0268264_10255483
821 Ga0268264_11144258
822 Ga0268264_11193180
823 Ga0268264_11535887
824 Ga0268264_12041901
825 Ga0307511_10021467
826 Ga0307408_101311951
827 Ga0316575_10013931
828 Ga0316576_10061175
829 Ga0316576_10091432
830 Ga0316576_10094456
831 Ga0316576_10104774
832 Ga0316576_10213457
833 Ga0316578_10017974
834 Ga0316578_10026254
835 Ga0316577_10059560
836 Ga0316577_10243189
837 Ga0316577_10311415
838 Ga0307416_102041733
839 Ga0316583_10003154
840 Ga0316583_10004720
841 Ga0316583_10029653
842 Ga0316583_10131006
843 Ga0316585_10001279
844 Ga0316580_10141064
845 Ga0316593_10032088
846 Ga0316593_10056123
847 Ga0316593_10149565
848 Ga0373929_0000001
849 Ga0373934_0008552
850 Ga0373923_0451656
851 Ga0373941_0287476
852 Ga0373954_0027288
853 Ga0373956_0119716
854 Ga0373956_0402060
855 Ga0373957_0289497
856 Ga0373943_0262970
857 Ga0373955_0711254
858 Ga0316574_0020417
859 Ga0316574_0081022
860 Ga0316574_0483000
861 Ga0316574_0537124
862 Ga0373935_0277291
863 Ga0373933_0010133
864 Ga0373933_0768769
865 Ga0373937_0002505
866 Ga0373937_0006813
867 Ga0316582_0038604
868 Ga0316582_0092199
869 Ga0316582_0257144
870 Ga0316584_0093223
871 Ga0316584_0165820
872 Ga0400483_015074
873 Ga0451789_0711377
874 Ga0451797_1350670
875 Ga0451795_0324929
876 Ga0451802_0479589
877 Ga0451802_1679855
878 Ga0451807_0377212
879 Ga0451807_2063280
880 Ga0451841_0760955
881 Ga0439431_0050350
882 Ga0439433_0065882
883 Ga0439442_037960
884 Ga0439445_0165698
885 Ga0439449_0093936
886 Ga0450920_012036
887 Ga0450895_001666
888 Ga0450896_001923
889 Ga0450906_012541
890 Ga0450910_033902
891 Ga0450908_016281
892 Ga0451577_0056839
893 Ga0451577_0082175
894 Ga0451577_1198408
895 Ga0451577_1584705
896 Ga0453683_0113285
897 Ga0453683_0833824
898 Ga0453683_1143828
899 Ga0453684_0101505
900 Ga0453684_0549334
901 Ga0453684_1622476
902 Ga0466960_0025774
903 Ga0451576_0041983
904 Ga0451576_1159845
905 Ga0466967_2217173
906 Ga0495629_0001085
907 Ga0495629_0018969
908 Ga0495638_0006310
909 Ga0495638_0255107
910 Ga0495651_0305636
911 Ga0495582_0007932
912 Ga0495639_0002890
913 Ga0495639_0016731
914 Ga0495662_0038269
915 Ga0495594_0004579
916 Ga0495594_0540581
917 Ga0495596_0176640
918 Ga0495630_1296817
919 Ga0495644_0386885
920 Ga0495663_0142217
921 Ga0495640_0663727
922 Ga0495586_0063358
923 Ga0495587_0127747
924 Ga0495587_0292827
925 Ga0495598_0059278
926 Ga0495621_0067321
927 Ga0495645_0759853
928 Ga0495622_0221978
929 Ga0495633_0114400
930 Ga0495656_0217655
931 Ga0495668_0296147
932 Ga0495634_0860124
933 Ga0495635_0001421
934 Ga0495658_0000401
935 Ga0495669_0678074
936 Ga0495600_0901904
937 Ga0495581_0000586
938 Ga0495581_0053939
939 Ga0495636_0421282
940 Ga0495672_0205463
941 Ga0495676_0130421
942 Ga0495680_0003220
943 Ga0495680_0148675
944 Ga0495602_0325974
945 Ga0495602_0539759
946 Ga0495614_0095409
947 Ga0496103_0235257
948 Ga0496104_1056706
949 Ga0496109_0749565
950 Ga0501306_013195
951 Ga0501311_041273
952 Ga0501316_044664
953 Ga0501324_019133
954 Ga0501032_0390246
955 Ga0501033_0924096
956 Ga0501037_0370105
957 Ga0501038_0005479
958 Ga0501038_0208259
959 Ga0501039_0199847
960 Ga0501039_0434341
961 Ga0501039_0879123
962 Ga0501040_0147414
963 Ga0501040_0722678
964 Ga0501041_0053510
965 Ga0501042_0228606
966 Ga0501042_0444645
967 Ga0501043_0014065
968 Ga0501046_0096966
969 Ga0501047_0002850
970 Ga0501047_1249521
971 Ga0501048_0255283
972 Ga0501067_0002959
973 Ga0501068_0000298
974 Ga0501068_0274123
975 Ga0501069_0011603
976 Ga0501070_0115439
977 Ga0501071_0495094
978 Ga0501072_0000013
979 Ga0501073_0001560
980 Ga0501073_0264198
981 Ga0501073_0315907
982 Ga0501074_0001093
983 Ga0501074_0902534
984 Ga0501075_0462092
985 Ga0501076_0005208
986 Ga0501076_0140135
987 Ga0501076_1148669
988 Ga0501077_0042009
989 Ga0501230_168431
990 Ga0501079_0000583
991 Ga0501079_0063163
992 Ga0501079_0426994
993 Ga0501080_0084855
994 Ga0501080_0246537
995 Ga0501080_0439657
996 Ga0501080_1292158
997 Ga0501080_1713744
998 Ga0501081_0070245
999 Ga0501081_0259804
1000 Ga0501081_0932991
1001 Ga0501083_0002132
1002 Ga0501083_0004309
1003 Ga0501083_0006433
1004 Ga0501083_0280312
1005 Ga0501263_021577
1006 Ga0501035_0437120
1007 Ga0501044_0061437
1008 Ga0501045_0180083
1009 Ga0501045_0965338
1010 nmdc:mga00v17_289450_c1
1011 nmdc:mga0k408_16714_c2
1012 nmdc:mga0k408_292593_c1
1013 nmdc:mga06z11_15279_c1
1014 nmdc:mga04h51_102557_c1
1015 nmdc:mga04h51_248068_c1
1016 nmdc:mga04h51_39600_c1
1017 nmdc:mga07m45_151571_c1
1018 nmdc:mga05p37_116790_c1
1019 nmdc:mga05p37_1221939_c1
1020 nmdc:mga05p37_1629851_c1
1021 nmdc:mga05p37_367163_c1
1022 nmdc:mga05p37_45244_c1
1023 nmdc:mga05p37_720777_c1
1024 nmdc:mga05p37_7671_c1
1025 nmdc:mga05p37_89941_c1
1026 nmdc:mga06r32_361101_c1
1027 nmdc:mga06r32_49737_c2
1028 nmdc:mga06r32_532091_c1
1029 nmdc:mga06r32_648054_c1
1030 nmdc:mga08y16_154847_c1
1031 nmdc:mga08y16_1757066_c1
1032 nmdc:mga08y16_483482_c1
1033 nmdc:mga0n895_105622_c1
1034 nmdc:mga0n895_1750244_c1
1035 nmdc:mga0n895_246885_c1
1036 nmdc:mga0n895_442043_c1
1037 nmdc:mga0n895_83882_c1
1038 nmdc:mga0rr50_223925_c1
1039 nmdc:mga0rr50_253929_c1
1040 nmdc:mga0rr50_43944_c1
1041 nmdc:mga0rr50_67190_c1
1042 nmdc:mga0rr50_697722_c1
1043 nmdc:mga08x19_449669_c1
1044 nmdc:mga0a205_174267_c1
1045 nmdc:mga0a205_194006_c1
1046 nmdc:mga0a205_556941_c1
1047 nmdc:mga0a205_601841_c1
1048 Ga0495619_0006248
1049 Ga0495619_0710808
1050 Ga0495619_0753490
1051 Ga0500592_028656
1052 Ga0500568_0004595
1053 Ga0501084_0000136
1054 Ga0501084_0035628
1055 Ga0501084_0649817
1056 Ga0501084_1445030
1057 Ga0587066_160779
1058 Ga0587111_0023103
1059 Ga0501082_0000651
1060 Ga0501082_0051914
1061 Ga0501082_0053520
1062 Ga0530510_0011015
1063 Ga0530510_0108011
1064 Ga0530510_0234601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00380

Ribosomal_S9

Ribosomal protein S9/S16

11

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9741 6 102
4v48-assembly1.cif.gz_BI real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9454 6 102
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.9342 4 108
6osi-assembly1.cif.gz_QI unmodified trna(pro) bound to thermus thermophilus 70s (near cognate) 0.9257 4 108
8d8l-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 3) 0.9192 5 113
ID Description Score Start End Superfamily
af_Q7XAM9_269_415_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8025 5 130 3.30.230.10
af_O94150_208_336_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7995 5 130 3.30.230.10
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7985 6 130 3.30.230.10
af_O14006_146_271_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7955 7 130 3.30.230.10
af_Q8IHZ4_170_300_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7955 5 130 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A6P0EFT4-F1-model_v4 deleted 0.9962 1 104
AF-A0A2E8BEA7-F1-model_v4 30S ribosomal protein S9 0.9953 7 105 GO:0003723
GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A7C8MVV8-F1-model_v4 Small ribosomal subunit protein uS9m (37S ribosomal protein S9, mitochondrial) 0.9949 5 100 GO:0003723
GO:0003735
GO:0005763
GO:0006412
AF-A0A6P0EFT4-F1-model_v4 deleted 0.9867 1 104
AF-A0A2H5NLP5-F1-model_v4 deleted 0.9819 5 106

Map