F460320

General Info

Members Datasets Scaffolds Average Seq Length
532 281 509 169

Family's Representative Sequence

Representative Sequence 3300046531|Ga0495665_0269206|Ga0495665_0269206_179_784
Length 201
Sequence MAGTIPEDLGETIRSARQIIINHKKKKKMKNVLQFDFIADKKKNTLTIRREFLAGRQLVWDCYTKRELLDRWFAPKPLTTKTKSMDFREGGHWHYAMVEPNGNEYWGWTEYRKIKPIDYYTTFDAFSNSEGEINKDMPRADWRVNFTDKGKNTLVETIVTYQSLSDLEKVIQMGMEQGMMATLEKLDELLLTIKAEELSTN

Samples

Sample ID Description Type Environment
1 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
4 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
5 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
6 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
7 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2738543013 Variovorax sp. BT01 Isolate Unclassified
12 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
13 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
14 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
15 2842711865 Duganella sp. R-73148 Isolate Unclassified
16 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
17 2885266251 Ralstonia sp. SET104 Isolate Nodule
18 2928058823 Ralstonia sp. 1138 Isolate Unclassified
19 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
20 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
21 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
22 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
45 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
46 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
47 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
48 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
49 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
61 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
63 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
111 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
253 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
254 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
259 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
262 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
263 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
264 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
265 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
278 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
279 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
280 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
281 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0.94
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.51
Nodule 0.56
Rhizoplane 2.82
Rhizosphere 50.94
Stem 0
Stem Tuber 0
Unclassified 16.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000062 3300001979 Bacteria 34499
2 JGI24740J21852_10000068 3300001979 Bacteria 34079
3 JGI24739J22299_10019673 3300001989 Bacteria 2415
4 JGI24737J22298_10001993 3300001990 Bacteria 7298
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI25155J39150_1000039 3300002704 Bacteria 91670
7 JGI25156J39149_1000096 3300002705 Bacteria 64397
8 JGI25156J39149_1000605 3300002705 Bacteria 19928
9 JGI25156J39149_1009020 3300002705 Bacteria 2457
10 JGI25156J39149_1022615 3300002705 Bacteria 1064
11 JGI25162J39368_1000022 3300002737 Bacteria 239510
12 JGI25154J39366_1000077 3300002738 Bacteria 90455
13 JGI25154J39366_1002516 3300002738 Bacteria 4673
14 JGI25158J39367_1000006 3300002739 Bacteria 58790
15 JGI25157J39369_1000027 3300002741 Bacteria 147448
16 JGI25157J39369_1000065 3300002741 Bacteria 98536
17 JGI25152J39213_1000240 3300002773 Bacteria 36681
18 JGI25150J39212_1000170 3300002774 Bacteria 36653
19 JGI25159J45721_1000955 3300002987 Bacteria 12587
20 JGI25151J46595_10000109 3300003187 Bacteria 112044
21 JGI25153J46596_10000084 3300003215 Bacteria 112044
22 JGI25153J46596_10000384 3300003215 Bacteria 30265
23 JGI25153J46596_10011599 3300003215 Bacteria 3880
24 JGI25153J46596_10035547 3300003215 Bacteria 1612
25 rootH1_10029039 3300003316 Bacteria 16566
26 rootH1_10029241 3300003316 Bacteria 22966
27 rootH2_10138129 3300003320 Bacteria 3653
28 rootH2_10173933 3300003320 Bacteria 1063
29 rootH2_10285773 3300003320 Bacteria 1954
30 rootL2_10011108 3300003322 Bacteria 5247
31 rootL2_10031845 3300003322 Bacteria 4320
32 rootL2_10074573 3300003322 Bacteria 18789
33 rootL2_10094528 3300003322 Bacteria 1712
34 rootL2_10243958 3300003322 Bacteria 1578
35 rootL2_10358003 3300003322 Bacteria 1556
36 rootL2_10371739 3300003322 Unclassified 1634
37 rootH1_10005821 3300003323 Bacteria 129122
38 rootH1_10006108 3300003323 Bacteria 45232
39 rootH1_10064984 3300003323 Bacteria 4125
40 rootH1_10091093 3300003323 Bacteria 10113
41 rootH1_10099652 3300003323 Bacteria 1486
42 rootH1_10143664 3300003323 Bacteria 4069
43 rootH1_10225319 3300003323 Bacteria 4718
44 JGI25160J50197_1009273 3300003354 Bacteria 3668
45 JGI25161J50226_1000052 3300003374 Bacteria 107273
46 Ga0055538_1000010 3300003751 Bacteria 376599
47 Ga0055539_1000015 3300003752 Bacteria 376599
48 Ga0055539_1000081 3300003752 Bacteria 122891
49 Ga0055533_1000018 3300003756 Bacteria 376599
50 Ga0055533_1000131 3300003756 Bacteria 82822
51 Ga0055532_1000005 3300003758 Bacteria 458107
52 Ga0055532_1000048 3300003758 Bacteria 175560
53 Ga0055525_1000020 3300003759 Bacteria 376599
54 Ga0055525_1000527 3300003759 Bacteria 18442
55 Ga0055525_1001710 3300003759 Bacteria 3274
56 Ga0055527_1010497 3300003760 Bacteria 1068
57 Ga0055535_1000035 3300003761 Bacteria 175560
58 Ga0055535_1000183 3300003761 Bacteria 66520
59 Ga0055535_1002937 3300003761 Bacteria 5288
60 Ga0055535_1005431 3300003761 Bacteria 2796
61 Ga0055529_1000064 3300003763 Bacteria 178831
62 Ga0055529_1000079 3300003763 Bacteria 149370
63 Ga0055529_1000101 3300003763 Bacteria 130709
64 Ga0055529_1020913 3300003763 Bacteria 814
65 Ga0055526_1000424 3300003771 Bacteria 33964
66 Ga0055537_1000330 3300003773 Bacteria 32350
67 Ga0055524_1002724 3300003775 Bacteria 8922
68 Ga0055524_1009673 3300003775 Bacteria 3898
69 Ga0055536_1006526 3300003781 Bacteria 5421
70 Ga0055534_1000147 3300003784 Bacteria 52707
71 Ga0055534_1002631 3300003784 Bacteria 6099
72 Ga0055534_1022956 3300003784 Bacteria 1027
73 Ga0055528_1000364 3300003790 Bacteria 36795
74 Ga0055530_10000281 3300003791 Bacteria 46223
75 Ga0055530_10006402 3300003791 Bacteria 5272
76 Ga0055541_1000011 3300003841 Bacteria 376599
77 Ga0055541_1018067 3300003841 Bacteria 879
78 Ga0055543_1000038 3300004625 Bacteria 124032
79 Ga0058862_11507154 3300004803 Bacteria 655
80 Ga0065165_1000117 3300005262 Bacteria 134716
81 Ga0065165_1000857 3300005262 Bacteria 39843
82 Ga0065714_10068968 3300005288 Bacteria 4446
83 Ga0065715_10170229 3300005293 Bacteria 1553
84 Ga0070658_10558538 3300005327 Bacteria 991
85 Ga0070661_100000093 3300005344 Bacteria 73157
86 Ga0070668_100510837 3300005347 Bacteria 1041
87 Ga0070673_100005614 3300005364 Bacteria 8048
88 Ga0070714_100376145 3300005435 Bacteria 1338
89 Ga0070713_100026357 3300005436 Bacteria 4562
90 Ga0070663_100000024 3300005455 Bacteria 108544
91 Ga0070663_100059125 3300005455 Bacteria 2755
92 Ga0068853_100196931 3300005539 Bacteria 1832
93 Ga0068855_100006571 3300005563 Bacteria 14136
94 Ga0068855_100061784 3300005563 Bacteria 4376
95 Ga0068855_100610359 3300005563 Bacteria 1175
96 Ga0070664_100000022 3300005564 Bacteria 108544
97 Ga0068857_100000118 3300005577 Bacteria 47043
98 Ga0068857_100007706 3300005577 Bacteria 9279
99 Ga0068857_100296179 3300005577 Bacteria 1491
100 Ga0068854_100000088 3300005578 Bacteria 65455
101 Ga0068854_100054035 3300005578 Bacteria 2887
102 Ga0068854_100208120 3300005578 Unclassified 1541
103 Ga0068856_100000049 3300005614 Bacteria 108544
104 Ga0068856_100073627 3300005614 Bacteria 3382
105 Ga0068856_100174048 3300005614 Bacteria 2165
106 Ga0068856_100587045 3300005614 Bacteria 1135
107 Ga0068852_100043749 3300005616 Bacteria 3799
108 Ga0068852_100104990 3300005616 Bacteria 2558
109 Ga0068852_101240047 3300005616 Unclassified 767
110 Ga0068861_100153118 3300005719 Bacteria 1894
111 Ga0068851_10679665 3300005834 Bacteria 632
112 Ga0068863_101067987 3300005841 Bacteria 811
113 Ga0068860_100074666 3300005843 Bacteria 3224
114 Ga0068860_100162927 3300005843 Bacteria 2151
115 Ga0075366_10142893 3300006195 Bacteria 1447
116 Ga0097621_100115098 3300006237 Bacteria 2276
117 Ga0075370_10782410 3300006353 Bacteria 581
118 Ga0105244_10006928 3300009036 Bacteria 7266
119 Ga0105240_10157322 3300009093 Bacteria 2702
120 Ga0105240_10197747 3300009093 Bacteria 2358
121 Ga0105240_10286904 3300009093 Bacteria 1889
122 Ga0105240_10639706 3300009093 Bacteria 1167
123 Ga0105240_11029541 3300009093 Unclassified 879
124 Ga0105248_10254867 3300009177 Bacteria 1975
125 Ga0105248_11886564 3300009177 Bacteria 678
126 Ga0105237_10002188 3300009545 Bacteria 24484
127 Ga0105237_10008413 3300009545 Bacteria 11176
128 Ga0105237_10041872 3300009545 Bacteria 4618
129 Ga0105237_10091278 3300009545 Bacteria 3035
130 Ga0105237_10141965 3300009545 Bacteria 2396
131 Ga0105238_10012222 3300009551 Bacteria 8657
132 Ga0105238_10024113 3300009551 Bacteria 6202
133 Ga0105238_10124023 3300009551 Bacteria 2562
134 Ga0105238_10231416 3300009551 Bacteria 1825
135 Ga0105238_10696729 3300009551 Unclassified 1028
136 Ga0105249_11050826 3300009553 Bacteria 884
137 Ga0105239_10012650 3300010375 Bacteria 9390
138 Ga0105239_10012782 3300010375 Bacteria 9339
139 Ga0105239_10019626 3300010375 Bacteria 7462
140 Ga0105239_10254117 3300010375 Bacteria 1974
141 Ga0105239_10434765 3300010375 Unclassified 1488
142 Ga0105239_11381870 3300010375 Bacteria 813
143 Ga0157373_10006107 3300013100 Bacteria 9005
144 Ga0157373_10308273 3300013100 Bacteria 1125
145 Ga0157371_10000089 3300013102 Bacteria 145483
146 Ga0157370_10000002 3300013104 Bacteria 431400
147 Ga0157370_10008088 3300013104 Bacteria 11385
148 Ga0157370_10034396 3300013104 Bacteria 4936
149 Ga0157370_10501356 3300013104 Bacteria 1115
150 Ga0157369_10005069 3300013105 Bacteria 15412
151 Ga0157369_10101180 3300013105 Bacteria 3072
152 Ga0157369_10243364 3300013105 Bacteria 1878
153 Ga0157369_10894739 3300013105 Bacteria 910
154 Ga0157374_10113027 3300013296 Bacteria 2614
155 Ga0157374_10411884 3300013296 Bacteria 1349
156 Ga0163162_10038580 3300013306 Bacteria 4767
157 Ga0163162_10107897 3300013306 Bacteria 2880
158 Ga0163162_10910816 3300013306 Bacteria 992
159 Ga0157372_10000363 3300013307 Bacteria 50093
160 Ga0157372_10623937 3300013307 Bacteria 1256
161 Ga0182008_10000008 3300014497 Bacteria 371823
162 Ga0182008_10000972 3300014497 Bacteria 19898
163 Ga0182008_10132228 3300014497 Unclassified 1244
164 Ga0182008_10431124 3300014497 Bacteria 713
165 Ga0157379_10057987 3300014968 Bacteria 3461
166 Ga0182006_1000897 3300015261 Bacteria 19959
167 Ga0182006_1004679 3300015261 Bacteria 6701
168 Ga0182006_1005509 3300015261 Bacteria 6016
169 Ga0182007_10021484 3300015262 Bacteria 2292
170 Ga0182007_10185297 3300015262 Bacteria 721
171 Ga0163161_10005762 3300017792 Bacteria 8587
172 Ga0206355_1336479 3300020076 Bacteria 1133
173 Ga0206351_10029301 3300020077 Bacteria 3643
174 Ga0154015_1150051 3300020610 Bacteria 8173
175 Ga0213872_10000398 3300021361 Bacteria 36154
176 Ga0213872_10108643 3300021361 Bacteria 1233
177 Ga0224712_10179304 3300022467 Bacteria 954
178 Ga0209435_100043 3300025206 Bacteria 102049
179 Ga0209435_100050 3300025206 Bacteria 91356
180 Ga0209436_100033 3300025208 Bacteria 80428
181 Ga0209784_100024 3300025224 Bacteria 394613
182 Ga0209784_100025 3300025224 Bacteria 376681
183 Ga0209784_101058 3300025224 Bacteria 4716
184 Ga0209566_100018 3300025225 Bacteria 448638
185 Ga0209566_100025 3300025225 Bacteria 376681
186 Ga0209566_101160 3300025225 Bacteria 9647
187 Ga0209674_100042 3300025226 Bacteria 376681
188 Ga0209674_100046 3300025226 Bacteria 357920
189 Ga0209674_100169 3300025226 Bacteria 82874
190 Ga0209674_104270 3300025226 Bacteria 2361
191 Ga0209672_100127 3300025228 Bacteria 78095
192 Ga0209672_103260 3300025228 Bacteria 3439
193 Ga0209147_100008 3300025229 Bacteria 777096
194 Ga0209147_100011 3300025229 Bacteria 702140
195 Ga0209563_100039 3300025230 Bacteria 409717
196 Ga0209563_100046 3300025230 Bacteria 376681
197 Ga0209563_100090 3300025230 Bacteria 169322
198 Ga0209563_100139 3300025230 Bacteria 82846
199 Ga0209563_110787 3300025230 Bacteria 1316
200 Ga0209437_100024 3300025233 Bacteria 592878
201 Ga0209258_100013 3300025242 Bacteria 777096
202 Ga0209258_100124 3300025242 Bacteria 178883
203 Ga0209258_100359 3300025242 Bacteria 61630
204 Ga0209258_100385 3300025242 Bacteria 56396
205 Ga0207425_1000455 3300025245 Bacteria 26503
206 Ga0209646_1000005 3300025246 Bacteria 717627
207 Ga0209646_1000161 3300025246 Bacteria 91356
208 Ga0209646_1000196 3300025246 Bacteria 72959
209 Ga0209026_1000011 3300025250 Bacteria 507291
210 Ga0209026_1000173 3300025250 Bacteria 98585
211 Ga0209026_1000232 3300025250 Bacteria 75219
212 Ga0209677_100024 3300025253 Bacteria 406035
213 Ga0209677_100027 3300025253 Bacteria 376681
214 Ga0209677_100115 3300025253 Bacteria 82874
215 Ga0209677_100237 3300025253 Bacteria 38817
216 Ga0209148_1001103 3300025254 Bacteria 16204
217 Ga0209148_1002698 3300025254 Bacteria 5673
218 Ga0209148_1012337 3300025254 Bacteria 1565
219 Ga0209148_1019567 3300025254 Bacteria 1122
220 Ga0209759_1000107 3300025256 Bacteria 147025
221 Ga0209759_1000169 3300025256 Bacteria 110110
222 Ga0209759_1000980 3300025256 Bacteria 19760
223 Ga0209759_1001128 3300025256 Bacteria 17161
224 Ga0209759_1003995 3300025256 Bacteria 5652
225 Ga0209759_1026711 3300025256 Bacteria 1205
226 Ga0209129_1000202 3300025258 Bacteria 72795
227 Ga0209129_1021343 3300025258 Bacteria 1189
228 Ga0209565_1000003 3300025263 Bacteria 1099648
229 Ga0209565_1007334 3300025263 Bacteria 2983
230 Ga0209455_1000042 3300025272 Bacteria 419638
231 Ga0209455_1000070 3300025272 Bacteria 307867
232 Ga0209455_1000114 3300025272 Bacteria 178883
233 Ga0209455_1001110 3300025272 Bacteria 13190
234 Ga0209455_1005365 3300025272 Bacteria 3979
235 Ga0209673_1000017 3300025273 Bacteria 492994
236 Ga0209673_1076779 3300025273 Bacteria 777
237 Ga0209130_1000059 3300025284 Bacteria 204772
238 Ga0209675_1000053 3300025291 Bacteria 194511
239 Ga0209675_1000119 3300025291 Bacteria 110218
240 Ga0209675_1017688 3300025291 Bacteria 2027
241 Ga0209675_1046786 3300025291 Unclassified 913
242 Ga0209676_1001375 3300025292 Bacteria 23746
243 Ga0209025_1000013 3300025294 Bacteria 871757
244 Ga0209564_1000011 3300025295 Bacteria 822327
245 Ga0209564_1000016 3300025295 Bacteria 613131
246 Ga0209564_1000199 3300025295 Bacteria 138027
247 Ga0209758_1000014 3300025297 Bacteria 871757
248 Ga0209758_1000126 3300025297 Bacteria 189761
249 Ga0209758_1000286 3300025297 Bacteria 99636
250 Ga0209758_1000904 3300025297 Bacteria 40285
251 Ga0209050_1000089 3300025298 Bacteria 256212
252 Ga0209050_1000335 3300025298 Bacteria 93521
253 Ga0209050_1004379 3300025298 Bacteria 9587
254 Ga0209050_1031534 3300025298 Unclassified 1650
255 Ga0209256_1000130 3300025299 Bacteria 163227
256 Ga0209256_1000210 3300025299 Bacteria 110217
257 Ga0209256_1000334 3300025299 Bacteria 78875
258 Ga0207426_1000600 3300025302 Bacteria 47121
259 Ga0209051_1029287 3300025303 Bacteria 2157
260 Ga0207655_1016247 3300025728 Bacteria 4083
261 Ga0207647_10035844 3300025904 Bacteria 3158
262 Ga0207654_10074617 3300025911 Bacteria 2025
263 Ga0207695_10000739 3300025913 Bacteria 63264
264 Ga0207695_10112686 3300025913 Bacteria 2697
265 Ga0207695_10150260 3300025913 Bacteria 2269
266 Ga0207695_10936049 3300025913 Unclassified 746
267 Ga0207671_10001393 3300025914 Bacteria 28100
268 Ga0207671_10016887 3300025914 Bacteria 5651
269 Ga0207671_10156557 3300025914 Bacteria 1763
270 Ga0207694_10004117 3300025924 Bacteria 11421
271 Ga0207694_10104777 3300025924 Bacteria 2245
272 Ga0207694_10356371 3300025924 Bacteria 1212
273 Ga0207664_10399727 3300025929 Bacteria 1222
274 Ga0207679_10000004 3300025945 Bacteria 589021
275 Ga0207667_10005343 3300025949 Bacteria 15657
276 Ga0207667_10382088 3300025949 Bacteria 1435
277 Ga0207667_10397092 3300025949 Bacteria 1404
278 Ga0207667_10507188 3300025949 Unclassified 1223
279 Ga0207667_10676481 3300025949 Bacteria 1036
280 Ga0207651_10007144 3300025960 Bacteria 5933
281 Ga0207668_10487383 3300025972 Bacteria 1058
282 Ga0207640_10000058 3300025981 Bacteria 92862
283 Ga0207640_10134819 3300025981 Bacteria 1791
284 Ga0207640_10222251 3300025981 Bacteria 1447
285 Ga0207639_10114036 3300026041 Bacteria 2208
286 Ga0207639_10130457 3300026041 Bacteria 2080
287 Ga0207678_10000012 3300026067 Bacteria 145324
288 Ga0207678_10066631 3300026067 Bacteria 3092
289 Ga0207702_10000020 3300026078 Bacteria 203299
290 Ga0207702_10054225 3300026078 Bacteria 3397
291 Ga0207702_10058881 3300026078 Bacteria 3270
292 Ga0207702_10668656 3300026078 Bacteria 1022
293 Ga0207641_10992841 3300026088 Bacteria 836
294 Ga0207674_10003295 3300026116 Bacteria 19862
295 Ga0207674_10075982 3300026116 Bacteria 3368
296 Ga0207674_10252536 3300026116 Bacteria 1710
297 Ga0207698_10054581 3300026142 Bacteria 3075
298 Ga0207698_10226228 3300026142 Bacteria 1695
299 Ga0207698_11132655 3300026142 Bacteria 796
300 Ga0268265_10019681 3300028380 Bacteria 4699
301 Ga0268264_10988329 3300028381 Unclassified 848
302 Ga0307509_10324494 3300031507 Bacteria 1274
303 Ga0307509_10695067 3300031507 Unclassified 684
304 Ga0307414_10260193 3300032004 Unclassified 1448
305 Ga0307415_100357563 3300032126 Bacteria 1232
306 Ga0307510_10015870 3300033180 Bacteria 8901
307 Ga0316574_0272107 3300035398 Bacteria 1080
308 Ga0373933_0286663 3300035724 Bacteria 1065
309 Ga0373937_0338937 3300036401 Bacteria 1424
310 Ga0395899_0001549 3300037312 Bacteria 19405
311 Ga0395899_0210658 3300037312 Bacteria 1350
312 Ga0395899_0478388 3300037312 Bacteria 811
313 Ga0395900_0006841 3300037418 Bacteria 11830
314 Ga0395900_0048618 3300037418 Bacteria 4369
315 Ga0395900_0236248 3300037418 Bacteria 1836
316 Ga0395898_0118478 3300037466 Bacteria 2536
317 Ga0395905_0187978 3300037471 Bacteria 1938
318 Ga0395905_0224928 3300037471 Bacteria 1756
319 Ga0395905_0251100 3300037471 Bacteria 1652
320 Ga0395905_0315222 3300037471 Unclassified 1453
321 Ga0395905_0392772 3300037471 Bacteria 1282
322 Ga0395905_1359574 3300037471 Bacteria 614
323 Ga0395901_0163503 3300038443 Bacteria 2337
324 Ga0395901_0291100 3300038443 Bacteria 1695
325 Ga0395901_0413451 3300038443 Bacteria 1384
326 Ga0395901_1650079 3300038443 Bacteria 593
327 Ga0436361_0139067 3300039447 Bacteria 3043
328 Ga0436361_0412777 3300039447 Bacteria 687
329 Ga0436361_0699546 3300039447 Bacteria 1345
330 Ga0436361_1034323 3300039447 Bacteria 7786
331 Ga0451791_1866294 3300041451 Bacteria 829
332 Ga0451798_1003930 3300041458 Bacteria 1096
333 Ga0451807_0893005 3300041486 Bacteria 2178
334 Ga0451853_1584401 3300041512 Bacteria 1198
335 Ga0466969_0273919 3300044656 Unclassified 764
336 Ga0466966_0045731 3300044684 Bacteria 2797
337 Ga0466964_0321704 3300044706 Bacteria 786
338 Ga0466968_0001716 3300044735 Bacteria 7903
339 Ga0466957_0029549 3300044842 Bacteria 3269
340 Ga0466957_0277771 3300044842 Bacteria 1120
341 Ga0495590_0000001 3300046457 Bacteria 762984
342 Ga0495629_0212089 3300046459 Bacteria 1337
343 Ga0495638_0000102 3300046460 Bacteria 137013
344 Ga0495650_0000137 3300046471 Bacteria 171680
345 Ga0495650_0000138 3300046471 Bacteria 171220
346 Ga0495650_0001979 3300046471 Bacteria 18008
347 Ga0495639_0009293 3300046475 Bacteria 4214
348 Ga0495639_0067547 3300046475 Bacteria 1647
349 Ga0495639_0293649 3300046475 Unclassified 809
350 Ga0495585_0000128 3300046492 Bacteria 82002
351 Ga0495585_0151441 3300046492 Unclassified 1209
352 Ga0495607_0024006 3300046501 Bacteria 3807
353 Ga0495583_0000186 3300046506 Bacteria 105198
354 Ga0495606_0000001 3300046507 Bacteria 592123
355 Ga0495606_0000002 3300046507 Bacteria 554637
356 Ga0495606_0005390 3300046507 Bacteria 12265
357 Ga0495606_0016821 3300046507 Bacteria 5557
358 Ga0495606_0055132 3300046507 Bacteria 2572
359 Ga0495606_0279588 3300046507 Bacteria 913
360 Ga0495608_0348799 3300046511 Bacteria 911
361 Ga0495610_0003621 3300046512 Bacteria 11909
362 Ga0495610_0005408 3300046512 Bacteria 9094
363 Ga0495610_0006895 3300046512 Bacteria 7695
364 Ga0495610_0007187 3300046512 Bacteria 7487
365 Ga0495616_0004530 3300046513 Bacteria 8749
366 Ga0495618_0286698 3300046514 Unclassified 1026
367 Ga0495628_0378601 3300046516 Unclassified 1037
368 Ga0495637_0121628 3300046520 Bacteria 1003
369 Ga0495643_0000137 3300046522 Bacteria 117968
370 Ga0495648_0000001 3300046524 Bacteria 696872
371 Ga0495648_0014199 3300046524 Bacteria 5843
372 Ga0495648_0021583 3300046524 Bacteria 4455
373 Ga0495666_0262266 3300046526 Unclassified 786
374 Ga0495642_0005754 3300046528 Bacteria 4755
375 Ga0495652_0098856 3300046529 Bacteria 2371
376 Ga0495652_0526193 3300046529 Bacteria 816
377 Ga0495665_0269206 3300046531 Bacteria 875
378 Ga0495586_0356595 3300046535 Unclassified 840
379 Ga0495587_0126555 3300046536 Bacteria 1462
380 Ga0495609_0011494 3300046538 Bacteria 4216
381 Ga0495609_0039623 3300046538 Bacteria 2120
382 Ga0495622_0000152 3300046557 Bacteria 59373
383 Ga0495622_0054532 3300046557 Unclassified 1855
384 Ga0495633_0000096 3300046558 Bacteria 118933
385 Ga0495633_0003857 3300046558 Bacteria 9801
386 Ga0495633_0006583 3300046558 Bacteria 6865
387 Ga0495633_0014264 3300046558 Bacteria 4161
388 Ga0495667_0400835 3300046559 Unclassified 864
389 Ga0495667_0861818 3300046559 Bacteria 557
390 Ga0495668_0000151 3300046616 Bacteria 105466
391 Ga0495668_0000241 3300046616 Bacteria 78040
392 Ga0495668_0513964 3300046616 Unclassified 660
393 Ga0495634_0315277 3300046642 Bacteria 943
394 Ga0495625_0000005 3300046660 Bacteria 596135
395 Ga0495625_0000065 3300046660 Bacteria 173230
396 Ga0495625_0002959 3300046660 Bacteria 17676
397 Ga0495625_0032012 3300046660 Bacteria 3906
398 Ga0495625_0224015 3300046660 Bacteria 1231
399 Ga0495635_0081065 3300046663 Bacteria 2221
400 Ga0495661_0002667 3300046665 Bacteria 13658
401 Ga0495588_0121700 3300046674 Unclassified 1375
402 Ga0495657_0225383 3300046675 Unclassified 1135
403 Ga0495599_0098086 3300046678 Bacteria 1827
404 Ga0495647_0274115 3300046681 Unclassified 756
405 Ga0495658_0082169 3300046683 Bacteria 1893
406 Ga0495658_0180258 3300046683 Unclassified 1310
407 Ga0495613_0264638 3300046689 Unclassified 1197
408 Ga0495624_0119441 3300046690 Unclassified 1619
409 Ga0495670_0087197 3300046691 Bacteria 1595
410 Ga0495670_0190634 3300046691 Bacteria 1084
411 Ga0495671_0054076 3300046692 Bacteria 1991
412 Ga0495649_0000003 3300046694 Bacteria 880817
413 Ga0495649_0017448 3300046694 Bacteria 4049
414 Ga0495660_0013872 3300046810 Bacteria 4671
415 Ga0495660_0014896 3300046810 Bacteria 4497
416 Ga0495581_0122177 3300047315 Unclassified 1516
417 Ga0495604_0202020 3300047317 Bacteria 1378
418 Ga0495672_0002335 3300047320 Bacteria 17574
419 Ga0495676_0000324 3300047321 Bacteria 38811
420 Ga0495683_0215403 3300047323 Bacteria 859
421 Ga0495687_155930 3300047443 Bacteria 774
422 Ga0495686_0000402 3300047472 Bacteria 68501
423 Ga0495686_0019273 3300047472 Bacteria 4561
424 Ga0495593_0009368 3300047673 Bacteria 5682
425 Ga0495593_0049769 3300047673 Unclassified 2222
426 Ga0495602_0736586 3300048088 Unclassified 666
427 Ga0495614_0026681 3300048089 Bacteria 2490
428 Ga0496101_0730436 3300048904 Bacteria 782
429 Ga0496102_0009914 3300048905 Bacteria 8194
430 Ga0496102_0376321 3300048905 Bacteria 1336
431 Ga0496103_0202887 3300048906 Bacteria 1275
432 Ga0496103_0276026 3300048906 Bacteria 1081
433 Ga0496104_0556801 3300048907 Bacteria 1057
434 Ga0496105_0606408 3300048908 Bacteria 849
435 Ga0496113_0233615 3300048916 Bacteria 1466
436 Ga0496113_0360501 3300048916 Bacteria 1166
437 Ga0496115_0093019 3300048918 Unclassified 2465
438 Ga0496116_0000006 3300048919 Bacteria 811937
439 Ga0496116_0101298 3300048919 Bacteria 1720
440 Ga0496117_0000027 3300048920 Bacteria 412234
441 Ga0496118_0000141 3300048921 Bacteria 126552
442 Ga0496118_0036813 3300048921 Bacteria 3950
443 Ga0496119_0000006 3300048922 Bacteria 505999
444 Ga0496119_0233441 3300048922 Bacteria 935
445 Ga0496121_0218618 3300048924 Bacteria 1344
446 Ga0496122_0000391 3300048925 Bacteria 93479
447 Ga0496122_0001741 3300048925 Bacteria 33738
448 Ga0496122_0002084 3300048925 Bacteria 29646
449 Ga0496122_0008848 3300048925 Bacteria 10743
450 Ga0496123_0001461 3300048926 Bacteria 32867
451 Ga0496123_0011250 3300048926 Bacteria 7780
452 Ga0496123_0277573 3300048926 Bacteria 812
453 Ga0496124_0017492 3300048927 Bacteria 6752
454 Ga0496124_0018315 3300048927 Bacteria 6561
455 Ga0496125_0000256 3300048928 Bacteria 109696
456 Ga0496125_0001989 3300048928 Bacteria 27733
457 Ga0496125_0002001 3300048928 Bacteria 27630
458 Ga0496125_0002112 3300048928 Bacteria 26704
459 Ga0496125_0029245 3300048928 Bacteria 4956
460 Ga0496125_0106071 3300048928 Bacteria 2052
461 Ga0496125_0154894 3300048928 Bacteria 1567
462 Ga0496126_0039136 3300048929 Bacteria 4403
463 Ga0496126_0189370 3300048929 Bacteria 1743
464 Ga0495678_001729 3300049459 Bacteria 16278
465 Ga0495678_006395 3300049459 Bacteria 6274
466 Ga0495678_080107 3300049459 Bacteria 1174
467 Ga0495682_0064469 3300049460 Bacteria 1321
468 Ga0501217_143805 3300049661 Bacteria 708
469 Ga0501044_0993469 3300049823 Bacteria 711
470 nmdc:mga0k408_145547_c1 3300050493 Bacteria 1410
471 nmdc:mga0k408_292290_c1 3300050493 Bacteria 972
472 nmdc:mga0k408_300585_c1 3300050493 Bacteria 958
473 nmdc:mga07m45_350364_c1 3300050496 Bacteria 858
474 Ga0500578_0000244 3300053086 Bacteria 67335
475 Ga0500578_0035158 3300053086 Bacteria 3220
476 Ga0500566_0405443 3300053094 Unclassified 609
477 Ga0500562_019852 3300053108 Bacteria 1742
478 Ga0500562_100650 3300053108 Unclassified 787
479 Ga0500571_000094 3300053110 Bacteria 28973
480 Ga0500597_057611 3300053120 Unclassified 1665
481 Ga0500608_012634 3300053122 Bacteria 3710
482 Ga0500608_085507 3300053122 Unclassified 1482
483 Ga0500618_014478 3300053125 Bacteria 2012
484 Ga0500623_038459 3300053127 Bacteria 2453
485 Ga0500652_019841 3300053131 Bacteria 2505
486 Ga0500652_104680 3300053131 Unclassified 1183
487 Ga0500655_000060 3300053133 Bacteria 30372
488 Ga0500559_0163515 3300053136 Bacteria 1046
489 Ga0500559_0267771 3300053136 Bacteria 804
490 Ga0500568_0010694 3300053139 Bacteria 4286
491 Ga0500586_001546 3300053145 Bacteria 4890
492 Ga0500588_0028674 3300053146 Bacteria 1580
493 Ga0500590_037210 3300053148 Bacteria 2516
494 Ga0500590_115327 3300053148 Bacteria 1268
495 Ga0500604_0002004 3300053151 Bacteria 5637
496 Ga0500604_0010405 3300053151 Bacteria 2489
497 Ga0500616_0212596 3300053153 Bacteria 849
498 Ga0500622_0000015 3300053156 Bacteria 346227
499 Ga0500622_0000022 3300053156 Bacteria 267246
500 Ga0500622_0001421 3300053156 Bacteria 19275
501 Ga0500622_0011232 3300053156 Bacteria 4888
502 Ga0500622_0028521 3300053156 Bacteria 2939
503 Ga0500627_0144154 3300053158 Bacteria 1076
504 Ga0500638_001711 3300053162 Bacteria 7144
505 Ga0500636_0124709 3300053177 Unclassified 1441
506 Ga0500636_0185173 3300053177 Unclassified 1114
507 Ga0500637_0040337 3300053178 Bacteria 2637
508 Ga0500637_0344319 3300053178 Bacteria 796
509 Ga0500565_001698 3300053734 Unclassified 1532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2548876994 2550694952 162
2 iso_pu_bacteria 2818991445 2819594591 162
3 iso_pu_bacteria 2842711865 2842715918 162
4 iso_pu_bacteria 2585428182 2588210294 163
5 iso_pu_bacteria 2585428185 2588223084 163
6 iso_pu_bacteria 2596583598 2597028029 163
7 iso_pu_bacteria 2599185178 2599444701 163
8 iso_pu_bacteria 2599185184 2599478700 163
9 iso_pu_bacteria 2738543013 2739252098 163
10 iso_pu_bacteria 2775506901 2776263878 163
11 iso_pu_bacteria 2818991460 2819680633 163
12 iso_pu_bacteria 2871720351 2871724098 163
13 iso_pu_bacteria 2885266251 2885266372 163
14 iso_pu_bacteria 2928058823 2928059839 163
15 iso_pu_bacteria 2928078545 2928080243 163
16 iso_pu_bacteria 2928147474 2928149585 163
17 iso_pu_bacteria 2929921140 2929924042 163
18 iso_pu_bacteria 2932082852 2932083415 163
19 iso_pu_bacteria 8003151029 8003152489 163
20 3300005435 Ga0070714_100376145 Ga0070714_1003761452 164
21 3300005436 Ga0070713_100026357 Ga0070713_1000263573 164
22 3300015262 Ga0182007_10185297 Ga0182007_101852972 164
23 3300025929 Ga0207664_10399727 Ga0207664_103997272 164
24 3300003323 rootH1_10143664 rootH1_101436647 165
25 3300048922 Ga0496119_0233441 Ga0496119_0233441_139_636 165
26 3300048929 Ga0496126_0039136 Ga0496126_0039136_1953_2450 165
27 iso_pu_bacteria 2585428057 2587727563 165
28 iso_pu_bacteria 2643221592 2643967888 165
29 iso_pu_bacteria 2643221625 2644143212 165
30 iso_pu_bacteria 2643221648 2644271700 165
31 3300002704 JGI25155J39150_1000039 JGI25155J39150_100003953 166
32 3300002705 JGI25156J39149_1000096 JGI25156J39149_100009656 166
33 3300002738 JGI25154J39366_1000077 JGI25154J39366_100007753 166
34 3300002741 JGI25157J39369_1000065 JGI25157J39369_100006553 166
35 3300003316 rootH1_10029039 rootH1_100290398 166
36 3300003320 rootH2_10173933 rootH2_101739332 166
37 3300003320 rootH2_10285773 rootH2_102857733 166
38 3300003322 rootL2_10074573 rootL2_100745736 166
39 3300003322 rootL2_10094528 rootL2_100945282 166
40 3300003322 rootL2_10243958 rootL2_102439583 166
41 3300003322 rootL2_10371739 rootL2_103717392 166
42 3300003323 rootH1_10005821 rootH1_1000582141 166
43 3300003323 rootH1_10064984 rootH1_100649845 166
44 3300003323 rootH1_10099652 rootH1_100996522 166
45 3300003751 Ga0055538_1000010 Ga0055538_1000010164 166
46 3300003752 Ga0055539_1000015 Ga0055539_1000015164 166
47 3300003756 Ga0055533_1000018 Ga0055533_1000018164 166
48 3300003758 Ga0055532_1000005 Ga0055532_1000005359 166
49 3300003759 Ga0055525_1000020 Ga0055525_1000020164 166
50 3300003761 Ga0055535_1002937 Ga0055535_10029374 166
51 3300003763 Ga0055529_1000079 Ga0055529_100007996 166
52 3300003763 Ga0055529_1020913 Ga0055529_10209131 166
53 3300003771 Ga0055526_1000424 Ga0055526_10004248 166
54 3300003773 Ga0055537_1000330 Ga0055537_10003306 166
55 3300003775 Ga0055524_1002724 Ga0055524_10027243 166
56 3300003784 Ga0055534_1000147 Ga0055534_100014710 166
57 3300003790 Ga0055528_1000364 Ga0055528_10003649 166
58 3300003841 Ga0055541_1000011 Ga0055541_1000011164 166
59 3300005539 Ga0068853_100196931 Ga0068853_1001969312 166
60 3300005614 Ga0068856_100174048 Ga0068856_1001740484 166
61 3300005614 Ga0068856_100587045 Ga0068856_1005870451 166
62 3300005616 Ga0068852_100043749 Ga0068852_1000437492 166
63 3300005719 Ga0068861_100153118 Ga0068861_1001531183 166
64 3300005841 Ga0068863_101067987 Ga0068863_1010679872 166
65 3300006353 Ga0075370_10782410 Ga0075370_107824101 166
66 3300009093 Ga0105240_10197747 Ga0105240_101977473 166
67 3300009093 Ga0105240_11029541 Ga0105240_110295412 166
68 3300009545 Ga0105237_10141965 Ga0105237_101419653 166
69 3300009551 Ga0105238_10124023 Ga0105238_101240233 166
70 3300009553 Ga0105249_11050826 Ga0105249_110508262 166
71 3300010375 Ga0105239_10254117 Ga0105239_102541172 166
72 3300013296 Ga0157374_10113027 Ga0157374_101130274 166
73 3300014497 Ga0182008_10431124 Ga0182008_104311241 166
74 3300021361 Ga0213872_10108643 Ga0213872_101086433 166
75 3300025206 Ga0209435_100043 Ga0209435_10004350 166
76 3300025206 Ga0209435_100050 Ga0209435_10005046 166
77 3300025224 Ga0209784_100025 Ga0209784_100025163 166
78 3300025225 Ga0209566_100025 Ga0209566_100025163 166
79 3300025226 Ga0209674_100042 Ga0209674_100042163 166
80 3300025229 Ga0209147_100011 Ga0209147_10001175 166
81 3300025230 Ga0209563_100046 Ga0209563_100046163 166
82 3300025242 Ga0209258_100385 Ga0209258_10038520 166
83 3300025246 Ga0209646_1000161 Ga0209646_100016146 166
84 3300025250 Ga0209026_1000173 Ga0209026_100017349 166
85 3300025253 Ga0209677_100027 Ga0209677_100027163 166
86 3300025254 Ga0209148_1019567 Ga0209148_10195672 166
87 3300025256 Ga0209759_1000169 Ga0209759_100016969 166
88 3300025263 Ga0209565_1000003 Ga0209565_100000322 166
89 3300025272 Ga0209455_1000070 Ga0209455_1000070177 166
90 3300025272 Ga0209455_1005365 Ga0209455_10053653 166
91 3300025273 Ga0209673_1000017 Ga0209673_1000017393 166
92 3300025291 Ga0209675_1000119 Ga0209675_100011922 166
93 3300025295 Ga0209564_1000016 Ga0209564_100001693 166
94 3300025298 Ga0209050_1004379 Ga0209050_10043797 166
95 3300025299 Ga0209256_1000130 Ga0209256_100013020 166
96 3300025299 Ga0209256_1000210 Ga0209256_100021022 166
97 3300025913 Ga0207695_10150260 Ga0207695_101502603 166
98 3300025914 Ga0207671_10156557 Ga0207671_101565572 166
99 3300025924 Ga0207694_10004117 Ga0207694_1000411710 166
100 3300026041 Ga0207639_10114036 Ga0207639_101140363 166
101 3300026078 Ga0207702_10058881 Ga0207702_100588813 166
102 3300026078 Ga0207702_10668656 Ga0207702_106686562 166
103 3300026088 Ga0207641_10992841 Ga0207641_109928412 166
104 3300026142 Ga0207698_10054581 Ga0207698_100545815 166
105 3300035398 Ga0316574_0272107 Ga0316574_0272107_138_638 166
106 3300037471 Ga0395905_1359574 Ga0395905_1359574_84_584 166
107 3300039447 Ga0436361_0412777 Ga0436361_0412777_80_580 166
108 3300041486 Ga0451807_0893005 Ga0451807_0893005_537_1037 166
109 3300046507 Ga0495606_0016821 Ga0495606_0016821_1624_2124 166
110 3300046512 Ga0495610_0003621 Ga0495610_0003621_9279_9779 166
111 3300046512 Ga0495610_0005408 Ga0495610_0005408_7073_7573 166
112 3300046512 Ga0495610_0006895 Ga0495610_0006895_1498_2007 166
113 3300046522 Ga0495643_0000137 Ga0495643_0000137_77359_77859 166
114 3300046524 Ga0495648_0014199 Ga0495648_0014199_1061_1561 166
115 3300046538 Ga0495609_0011494 Ga0495609_0011494_1113_1613 166
116 3300046558 Ga0495633_0003857 Ga0495633_0003857_3833_4342 166
117 3300046660 Ga0495625_0002959 Ga0495625_0002959_266_766 166
118 3300046660 Ga0495625_0032012 Ga0495625_0032012_1547_2047 166
119 3300046691 Ga0495670_0190634 Ga0495670_0190634_193_693 166
120 3300046694 Ga0495649_0017448 Ga0495649_0017448_1351_1851 166
121 3300047320 Ga0495672_0002335 Ga0495672_0002335_10358_10858 166
122 3300048926 Ga0496123_0277573 Ga0496123_0277573_122_622 166
123 3300048928 Ga0496125_0000256 Ga0496125_0000256_72629_73129 166
124 3300049459 Ga0495678_001729 Ga0495678_001729_8337_8837 166
125 3300049460 Ga0495682_0064469 Ga0495682_0064469_166_666 166
126 3300050496 nmdc:mga07m45_350364_c1 nmdc:mga07m45_350364_c1_324_824 166
127 3300053145 Ga0500586_001546 Ga0500586_001546_2565_3074 166
128 3300053153 Ga0500616_0212596 Ga0500616_0212596_270_770 166
129 3300001979 JGI24740J21852_10000062 JGI24740J21852_1000006232 167
130 3300001979 JGI24740J21852_10000068 JGI24740J21852_1000006812 167
131 3300001989 JGI24739J22299_10019673 JGI24739J22299_100196734 167
132 3300001990 JGI24737J22298_10001993 JGI24737J22298_100019938 167
133 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002240 167
134 3300002705 JGI25156J39149_1000605 JGI25156J39149_10006053 167
135 3300002705 JGI25156J39149_1009020 JGI25156J39149_10090203 167
136 3300002705 JGI25156J39149_1022615 JGI25156J39149_10226152 167
137 3300002737 JGI25162J39368_1000022 JGI25162J39368_1000022128 167
138 3300002738 JGI25154J39366_1002516 JGI25154J39366_10025165 167
139 3300002739 JGI25158J39367_1000006 JGI25158J39367_10000065 167
140 3300002741 JGI25157J39369_1000027 JGI25157J39369_1000027146 167
141 3300002773 JGI25152J39213_1000240 JGI25152J39213_100024022 167
142 3300002774 JGI25150J39212_1000170 JGI25150J39212_100017022 167
143 3300002987 JGI25159J45721_1000955 JGI25159J45721_10009553 167
144 3300003187 JGI25151J46595_10000109 JGI25151J46595_1000010913 167
145 3300003215 JGI25153J46596_10000084 JGI25153J46596_1000008413 167
146 3300003215 JGI25153J46596_10000384 JGI25153J46596_1000038429 167
147 3300003215 JGI25153J46596_10011599 JGI25153J46596_100115994 167
148 3300003215 JGI25153J46596_10035547 JGI25153J46596_100355472 167
149 3300003316 rootH1_10029241 rootH1_100292411 167
150 3300003320 rootH2_10138129 rootH2_101381294 167
151 3300003322 rootL2_10011108 rootL2_100111082 167
152 3300003322 rootL2_10031845 rootL2_100318452 167
153 3300003322 rootL2_10358003 rootL2_103580033 167
154 3300003323 rootH1_10006108 rootH1_1000610824 167
155 3300003323 rootH1_10091093 rootH1_100910932 167
156 3300003323 rootH1_10225319 rootH1_102253195 167
157 3300003354 JGI25160J50197_1009273 JGI25160J50197_10092732 167
158 3300003374 JGI25161J50226_1000052 JGI25161J50226_100005230 167
159 3300003752 Ga0055539_1000081 Ga0055539_100008116 167
160 3300003756 Ga0055533_1000131 Ga0055533_100013174 167
161 3300003758 Ga0055532_1000048 Ga0055532_1000048112 167
162 3300003759 Ga0055525_1000527 Ga0055525_100052713 167
163 3300003759 Ga0055525_1001710 Ga0055525_10017102 167
164 3300003760 Ga0055527_1010497 Ga0055527_10104972 167
165 3300003761 Ga0055535_1000035 Ga0055535_1000035112 167
166 3300003761 Ga0055535_1000183 Ga0055535_100018364 167
167 3300003761 Ga0055535_1005431 Ga0055535_10054315 167
168 3300003763 Ga0055529_1000064 Ga0055529_1000064117 167
169 3300003763 Ga0055529_1000101 Ga0055529_100010158 167
170 3300003775 Ga0055524_1009673 Ga0055524_10096733 167
171 3300003781 Ga0055536_1006526 Ga0055536_10065262 167
172 3300003784 Ga0055534_1002631 Ga0055534_10026317 167
173 3300003784 Ga0055534_1022956 Ga0055534_10229562 167
174 3300003791 Ga0055530_10000281 Ga0055530_1000028143 167
175 3300003791 Ga0055530_10006402 Ga0055530_100064022 167
176 3300003841 Ga0055541_1018067 Ga0055541_10180672 167
177 3300004625 Ga0055543_1000038 Ga0055543_100003888 167
178 3300004803 Ga0058862_11507154 Ga0058862_115071542 167
179 3300005262 Ga0065165_1000117 Ga0065165_100011795 167
180 3300005262 Ga0065165_1000857 Ga0065165_10008573 167
181 3300005288 Ga0065714_10068968 Ga0065714_100689687 167
182 3300005293 Ga0065715_10170229 Ga0065715_101702291 167
183 3300005327 Ga0070658_10558538 Ga0070658_105585381 167
184 3300005344 Ga0070661_100000093 Ga0070661_10000009353 167
185 3300005347 Ga0070668_100510837 Ga0070668_1005108372 167
186 3300005364 Ga0070673_100005614 Ga0070673_1000056144 167
187 3300005455 Ga0070663_100000024 Ga0070663_10000002423 167
188 3300005455 Ga0070663_100059125 Ga0070663_1000591254 167
189 3300005563 Ga0068855_100006571 Ga0068855_1000065714 167
190 3300005563 Ga0068855_100061784 Ga0068855_1000617843 167
191 3300005563 Ga0068855_100610359 Ga0068855_1006103593 167
192 3300005564 Ga0070664_100000022 Ga0070664_10000002223 167
193 3300005577 Ga0068857_100000118 Ga0068857_10000011820 167
194 3300005577 Ga0068857_100007706 Ga0068857_10000770611 167
195 3300005577 Ga0068857_100296179 Ga0068857_1002961792 167
196 3300005578 Ga0068854_100000088 Ga0068854_10000008845 167
197 3300005578 Ga0068854_100054035 Ga0068854_1000540353 167
198 3300005578 Ga0068854_100208120 Ga0068854_1002081203 167
199 3300005614 Ga0068856_100000049 Ga0068856_10000004923 167
200 3300005614 Ga0068856_100073627 Ga0068856_1000736272 167
201 3300005616 Ga0068852_100104990 Ga0068852_1001049902 167
202 3300005616 Ga0068852_101240047 Ga0068852_1012400471 167
203 3300005834 Ga0068851_10679665 Ga0068851_106796651 167
204 3300005843 Ga0068860_100074666 Ga0068860_1000746664 167
205 3300005843 Ga0068860_100162927 Ga0068860_1001629272 167
206 3300006195 Ga0075366_10142893 Ga0075366_101428933 167
207 3300006237 Ga0097621_100115098 Ga0097621_1001150982 167
208 3300009036 Ga0105244_10006928 Ga0105244_100069283 167
209 3300009093 Ga0105240_10157322 Ga0105240_101573222 167
210 3300009093 Ga0105240_10286904 Ga0105240_102869042 167
211 3300009093 Ga0105240_10639706 Ga0105240_106397062 167
212 3300009177 Ga0105248_10254867 Ga0105248_102548673 167
213 3300009177 Ga0105248_11886564 Ga0105248_118865642 167
214 3300009545 Ga0105237_10002188 Ga0105237_1000218814 167
215 3300009545 Ga0105237_10008413 Ga0105237_100084134 167
216 3300009545 Ga0105237_10041872 Ga0105237_100418725 167
217 3300009545 Ga0105237_10091278 Ga0105237_100912782 167
218 3300009551 Ga0105238_10012222 Ga0105238_100122226 167
219 3300009551 Ga0105238_10024113 Ga0105238_100241134 167
220 3300009551 Ga0105238_10231416 Ga0105238_102314162 167
221 3300009551 Ga0105238_10696729 Ga0105238_106967292 167
222 3300010375 Ga0105239_10012650 Ga0105239_100126506 167
223 3300010375 Ga0105239_10012782 Ga0105239_100127827 167
224 3300010375 Ga0105239_10019626 Ga0105239_100196264 167
225 3300010375 Ga0105239_10434765 Ga0105239_104347652 167
226 3300010375 Ga0105239_11381870 Ga0105239_113818701 167
227 3300013100 Ga0157373_10006107 Ga0157373_100061075 167
228 3300013100 Ga0157373_10308273 Ga0157373_103082732 167
229 3300013102 Ga0157371_10000089 Ga0157371_1000008923 167
230 3300013104 Ga0157370_10000002 Ga0157370_10000002267 167
231 3300013104 Ga0157370_10008088 Ga0157370_100080886 167
232 3300013104 Ga0157370_10034396 Ga0157370_100343964 167
233 3300013104 Ga0157370_10501356 Ga0157370_105013562 167
234 3300013105 Ga0157369_10005069 Ga0157369_100050692 167
235 3300013105 Ga0157369_10101180 Ga0157369_101011803 167
236 3300013105 Ga0157369_10243364 Ga0157369_102433642 167
237 3300013105 Ga0157369_10894739 Ga0157369_108947392 167
238 3300013296 Ga0157374_10411884 Ga0157374_104118842 167
239 3300013306 Ga0163162_10038580 Ga0163162_100385802 167
240 3300013306 Ga0163162_10107897 Ga0163162_101078973 167
241 3300013306 Ga0163162_10910816 Ga0163162_109108162 167
242 3300013307 Ga0157372_10000363 Ga0157372_1000036323 167
243 3300013307 Ga0157372_10623937 Ga0157372_106239373 167
244 3300014497 Ga0182008_10000008 Ga0182008_10000008141 167
245 3300014497 Ga0182008_10000972 Ga0182008_1000097219 167
246 3300014497 Ga0182008_10132228 Ga0182008_101322282 167
247 3300014968 Ga0157379_10057987 Ga0157379_100579873 167
248 3300015261 Ga0182006_1000897 Ga0182006_100089717 167
249 3300015261 Ga0182006_1004679 Ga0182006_10046796 167
250 3300015261 Ga0182006_1005509 Ga0182006_10055092 167
251 3300015262 Ga0182007_10021484 Ga0182007_100214842 167
252 3300017792 Ga0163161_10005762 Ga0163161_100057625 167
253 3300020076 Ga0206355_1336479 Ga0206355_13364792 167
254 3300020077 Ga0206351_10029301 Ga0206351_100293016 167
255 3300020610 Ga0154015_1150051 Ga0154015_11500515 167
256 3300021361 Ga0213872_10000398 Ga0213872_1000039812 167
257 3300022467 Ga0224712_10179304 Ga0224712_101793042 167
258 3300025208 Ga0209436_100033 Ga0209436_10003329 167
259 3300025224 Ga0209784_100024 Ga0209784_100024241 167
260 3300025224 Ga0209784_101058 Ga0209784_1010583 167
261 3300025225 Ga0209566_100018 Ga0209566_100018241 167
262 3300025225 Ga0209566_101160 Ga0209566_1011603 167
263 3300025226 Ga0209674_100046 Ga0209674_100046122 167
264 3300025226 Ga0209674_100169 Ga0209674_10016975 167
265 3300025226 Ga0209674_104270 Ga0209674_1042703 167
266 3300025228 Ga0209672_100127 Ga0209672_10012723 167
267 3300025228 Ga0209672_103260 Ga0209672_1032605 167
268 3300025229 Ga0209147_100008 Ga0209147_100008130 167
269 3300025230 Ga0209563_100039 Ga0209563_100039122 167
270 3300025230 Ga0209563_100090 Ga0209563_100090117 167
271 3300025230 Ga0209563_100139 Ga0209563_10013975 167
272 3300025230 Ga0209563_110787 Ga0209563_1107873 167
273 3300025233 Ga0209437_100024 Ga0209437_100024442 167
274 3300025242 Ga0209258_100013 Ga0209258_100013130 167
275 3300025242 Ga0209258_100124 Ga0209258_10012462 167
276 3300025242 Ga0209258_100359 Ga0209258_10035944 167
277 3300025245 Ga0207425_1000455 Ga0207425_10004557 167
278 3300025246 Ga0209646_1000005 Ga0209646_1000005173 167
279 3300025246 Ga0209646_1000196 Ga0209646_100019670 167
280 3300025250 Ga0209026_1000011 Ga0209026_10000113 167
281 3300025250 Ga0209026_1000232 Ga0209026_100023222 167
282 3300025253 Ga0209677_100024 Ga0209677_100024120 167
283 3300025253 Ga0209677_100115 Ga0209677_10011575 167
284 3300025253 Ga0209677_100237 Ga0209677_1002373 167
285 3300025254 Ga0209148_1001103 Ga0209148_10011037 167
286 3300025254 Ga0209148_1002698 Ga0209148_10026983 167
287 3300025254 Ga0209148_1012337 Ga0209148_10123372 167
288 3300025256 Ga0209759_1000107 Ga0209759_10001073 167
289 3300025256 Ga0209759_1000980 Ga0209759_100098016 167
290 3300025256 Ga0209759_1001128 Ga0209759_10011284 167
291 3300025256 Ga0209759_1003995 Ga0209759_10039955 167
292 3300025256 Ga0209759_1026711 Ga0209759_10267112 167
293 3300025258 Ga0209129_1000202 Ga0209129_100020214 167
294 3300025258 Ga0209129_1021343 Ga0209129_10213432 167
295 3300025263 Ga0209565_1007334 Ga0209565_10073342 167
296 3300025272 Ga0209455_1000042 Ga0209455_1000042130 167
297 3300025272 Ga0209455_1000114 Ga0209455_1000114117 167
298 3300025272 Ga0209455_1001110 Ga0209455_10011106 167
299 3300025273 Ga0209673_1076779 Ga0209673_10767792 167
300 3300025284 Ga0209130_1000059 Ga0209130_1000059157 167
301 3300025291 Ga0209675_1000053 Ga0209675_100005352 167
302 3300025291 Ga0209675_1017688 Ga0209675_10176882 167
303 3300025291 Ga0209675_1046786 Ga0209675_10467861 167
304 3300025292 Ga0209676_1001375 Ga0209676_100137514 167
305 3300025294 Ga0209025_1000013 Ga0209025_100001314 167
306 3300025295 Ga0209564_1000011 Ga0209564_1000011418 167
307 3300025295 Ga0209564_1000199 Ga0209564_100019960 167
308 3300025297 Ga0209758_1000014 Ga0209758_100001414 167
309 3300025297 Ga0209758_1000126 Ga0209758_100012635 167
310 3300025297 Ga0209758_1000286 Ga0209758_100028662 167
311 3300025297 Ga0209758_1000904 Ga0209758_100090417 167
312 3300025298 Ga0209050_1000089 Ga0209050_100008962 167
313 3300025298 Ga0209050_1000335 Ga0209050_1000335104 167
314 3300025298 Ga0209050_1031534 Ga0209050_10315342 167
315 3300025299 Ga0209256_1000334 Ga0209256_100033457 167
316 3300025302 Ga0207426_1000600 Ga0207426_100060023 167
317 3300025303 Ga0209051_1029287 Ga0209051_10292872 167
318 3300025728 Ga0207655_1016247 Ga0207655_10162474 167
319 3300025904 Ga0207647_10035844 Ga0207647_100358444 167
320 3300025911 Ga0207654_10074617 Ga0207654_100746172 167
321 3300025913 Ga0207695_10000739 Ga0207695_1000073927 167
322 3300025913 Ga0207695_10112686 Ga0207695_101126863 167
323 3300025913 Ga0207695_10936049 Ga0207695_109360491 167
324 3300025914 Ga0207671_10001393 Ga0207671_1000139313 167
325 3300025914 Ga0207671_10016887 Ga0207671_100168876 167
326 3300025924 Ga0207694_10104777 Ga0207694_101047773 167
327 3300025924 Ga0207694_10356371 Ga0207694_103563712 167
328 3300025945 Ga0207679_10000004 Ga0207679_10000004433 167
329 3300025949 Ga0207667_10005343 Ga0207667_100053435 167
330 3300025949 Ga0207667_10382088 Ga0207667_103820881 167
331 3300025949 Ga0207667_10397092 Ga0207667_103970921 167
332 3300025949 Ga0207667_10507188 Ga0207667_105071881 167
333 3300025949 Ga0207667_10676481 Ga0207667_106764812 167
334 3300025960 Ga0207651_10007144 Ga0207651_100071444 167
335 3300025972 Ga0207668_10487383 Ga0207668_104873832 167
336 3300025981 Ga0207640_10000058 Ga0207640_1000005852 167
337 3300025981 Ga0207640_10134819 Ga0207640_101348192 167
338 3300025981 Ga0207640_10222251 Ga0207640_102222512 167
339 3300026041 Ga0207639_10130457 Ga0207639_101304573 167
340 3300026067 Ga0207678_10000012 Ga0207678_1000001223 167
341 3300026067 Ga0207678_10066631 Ga0207678_100666312 167
342 3300026078 Ga0207702_10000020 Ga0207702_1000002076 167
343 3300026078 Ga0207702_10054225 Ga0207702_100542252 167
344 3300026116 Ga0207674_10003295 Ga0207674_1000329517 167
345 3300026116 Ga0207674_10075982 Ga0207674_100759823 167
346 3300026116 Ga0207674_10252536 Ga0207674_102525362 167
347 3300026142 Ga0207698_10226228 Ga0207698_102262283 167
348 3300026142 Ga0207698_11132655 Ga0207698_111326552 167
349 3300028380 Ga0268265_10019681 Ga0268265_100196814 167
350 3300028381 Ga0268264_10988329 Ga0268264_109883292 167
351 3300031507 Ga0307509_10324494 Ga0307509_103244942 167
352 3300031507 Ga0307509_10695067 Ga0307509_106950672 167
353 3300032004 Ga0307414_10260193 Ga0307414_102601931 167
354 3300032126 Ga0307415_100357563 Ga0307415_1003575632 167
355 3300033180 Ga0307510_10015870 Ga0307510_1001587010 167
356 3300035724 Ga0373933_0286663 Ga0373933_0286663_139_660 167
357 3300036401 Ga0373937_0338937 Ga0373937_0338937_785_1294 167
358 3300037312 Ga0395899_0001549 Ga0395899_0001549_16430_16933 167
359 3300037312 Ga0395899_0210658 Ga0395899_0210658_361_864 167
360 3300037312 Ga0395899_0478388 Ga0395899_0478388_105_608 167
361 3300037418 Ga0395900_0006841 Ga0395900_0006841_6334_6852 167
362 3300037418 Ga0395900_0048618 Ga0395900_0048618_508_1011 167
363 3300037418 Ga0395900_0236248 Ga0395900_0236248_93_602 167
364 3300037466 Ga0395898_0118478 Ga0395898_0118478_526_1029 167
365 3300037471 Ga0395905_0187978 Ga0395905_0187978_559_1062 167
366 3300037471 Ga0395905_0224928 Ga0395905_0224928_1165_1668 167
367 3300037471 Ga0395905_0251100 Ga0395905_0251100_78_581 167
368 3300037471 Ga0395905_0315222 Ga0395905_0315222_922_1437 167
369 3300037471 Ga0395905_0392772 Ga0395905_0392772_589_1092 167
370 3300038443 Ga0395901_0163503 Ga0395901_0163503_218_721 167
371 3300038443 Ga0395901_0291100 Ga0395901_0291100_587_1096 167
372 3300038443 Ga0395901_0413451 Ga0395901_0413451_338_841 167
373 3300038443 Ga0395901_1650079 Ga0395901_1650079_67_570 167
374 3300039447 Ga0436361_0139067 Ga0436361_0139067_2066_2575 167
375 3300039447 Ga0436361_0699546 Ga0436361_0699546_34_540 167
376 3300039447 Ga0436361_1034323 Ga0436361_1034323_2083_2586 167
377 3300041451 Ga0451791_1866294 Ga0451791_1866294_21_530 167
378 3300041458 Ga0451798_1003930 Ga0451798_1003930_345_854 167
379 3300041512 Ga0451853_1584401 Ga0451853_1584401_293_802 167
380 3300044656 Ga0466969_0273919 Ga0466969_0273919_13_522 167
381 3300044684 Ga0466966_0045731 Ga0466966_0045731_1629_2138 167
382 3300044706 Ga0466964_0321704 Ga0466964_0321704_160_663 167
383 3300044735 Ga0466968_0001716 Ga0466968_0001716_6882_7385 167
384 3300044842 Ga0466957_0029549 Ga0466957_0029549_1944_2447 167
385 3300044842 Ga0466957_0277771 Ga0466957_0277771_468_977 167
386 3300046457 Ga0495590_0000001 Ga0495590_0000001_453206_453709 167
387 3300046459 Ga0495629_0212089 Ga0495629_0212089_413_934 167
388 3300046460 Ga0495638_0000102 Ga0495638_0000102_8456_8959 167
389 3300046471 Ga0495650_0000137 Ga0495650_0000137_10245_10748 167
390 3300046471 Ga0495650_0000138 Ga0495650_0000138_46314_46817 167
391 3300046471 Ga0495650_0001979 Ga0495650_0001979_9812_10315 167
392 3300046475 Ga0495639_0009293 Ga0495639_0009293_2275_2778 167
393 3300046475 Ga0495639_0067547 Ga0495639_0067547_110_631 167
394 3300046475 Ga0495639_0293649 Ga0495639_0293649_68_583 167
395 3300046492 Ga0495585_0000128 Ga0495585_0000128_30801_31304 167
396 3300046492 Ga0495585_0151441 Ga0495585_0151441_554_1069 167
397 3300046501 Ga0495607_0024006 Ga0495607_0024006_2370_2873 167
398 3300046506 Ga0495583_0000186 Ga0495583_0000186_2017_2520 167
399 3300046507 Ga0495606_0000001 Ga0495606_0000001_581866_582369 167
400 3300046507 Ga0495606_0000002 Ga0495606_0000002_241698_242201 167
401 3300046507 Ga0495606_0005390 Ga0495606_0005390_4329_4832 167
402 3300046507 Ga0495606_0055132 Ga0495606_0055132_352_855 167
403 3300046507 Ga0495606_0279588 Ga0495606_0279588_32_535 167
404 3300046511 Ga0495608_0348799 Ga0495608_0348799_117_632 167
405 3300046512 Ga0495610_0007187 Ga0495610_0007187_644_1147 167
406 3300046513 Ga0495616_0004530 Ga0495616_0004530_5250_5753 167
407 3300046514 Ga0495618_0286698 Ga0495618_0286698_41_556 167
408 3300046516 Ga0495628_0378601 Ga0495628_0378601_507_1022 167
409 3300046520 Ga0495637_0121628 Ga0495637_0121628_346_849 167
410 3300046524 Ga0495648_0000001 Ga0495648_0000001_361877_362380 167
411 3300046524 Ga0495648_0021583 Ga0495648_0021583_444_947 167
412 3300046526 Ga0495666_0262266 Ga0495666_0262266_248_763 167
413 3300046528 Ga0495642_0005754 Ga0495642_0005754_934_1437 167
414 3300046529 Ga0495652_0098856 Ga0495652_0098856_633_1136 167
415 3300046529 Ga0495652_0526193 Ga0495652_0526193_94_603 167
416 3300046531 Ga0495665_0269206 Ga0495665_0269206_179_784 167
417 3300046535 Ga0495586_0356595 Ga0495586_0356595_271_786 167
418 3300046536 Ga0495587_0126555 Ga0495587_0126555_719_1324 167
419 3300046538 Ga0495609_0039623 Ga0495609_0039623_1112_1615 167
420 3300046557 Ga0495622_0000152 Ga0495622_0000152_7405_7908 167
421 3300046557 Ga0495622_0054532 Ga0495622_0054532_1274_1789 167
422 3300046558 Ga0495633_0000096 Ga0495633_0000096_94328_94831 167
423 3300046558 Ga0495633_0006583 Ga0495633_0006583_4437_4940 167
424 3300046558 Ga0495633_0014264 Ga0495633_0014264_1527_2030 167
425 3300046559 Ga0495667_0400835 Ga0495667_0400835_319_834 167
426 3300046559 Ga0495667_0861818 Ga0495667_0861818_37_540 167
427 3300046616 Ga0495668_0000151 Ga0495668_0000151_90277_90780 167
428 3300046616 Ga0495668_0000241 Ga0495668_0000241_13772_14275 167
429 3300046616 Ga0495668_0513964 Ga0495668_0513964_98_613 167
430 3300046642 Ga0495634_0315277 Ga0495634_0315277_64_669 167
431 3300046660 Ga0495625_0000005 Ga0495625_0000005_73058_73561 167
432 3300046660 Ga0495625_0000065 Ga0495625_0000065_63761_64264 167
433 3300046660 Ga0495625_0224015 Ga0495625_0224015_358_861 167
434 3300046663 Ga0495635_0081065 Ga0495635_0081065_716_1237 167
435 3300046665 Ga0495661_0002667 Ga0495661_0002667_1567_2079 167
436 3300046674 Ga0495588_0121700 Ga0495588_0121700_531_1046 167
437 3300046675 Ga0495657_0225383 Ga0495657_0225383_342_857 167
438 3300046678 Ga0495599_0098086 Ga0495599_0098086_1187_1702 167
439 3300046681 Ga0495647_0274115 Ga0495647_0274115_191_706 167
440 3300046683 Ga0495658_0082169 Ga0495658_0082169_1230_1835 167
441 3300046683 Ga0495658_0180258 Ga0495658_0180258_372_887 167
442 3300046689 Ga0495613_0264638 Ga0495613_0264638_150_665 167
443 3300046690 Ga0495624_0119441 Ga0495624_0119441_1024_1539 167
444 3300046691 Ga0495670_0087197 Ga0495670_0087197_1054_1557 167
445 3300046692 Ga0495671_0054076 Ga0495671_0054076_73_576 167
446 3300046694 Ga0495649_0000003 Ga0495649_0000003_73079_73582 167
447 3300046810 Ga0495660_0013872 Ga0495660_0013872_354_857 167
448 3300046810 Ga0495660_0014896 Ga0495660_0014896_2030_2533 167
449 3300047315 Ga0495581_0122177 Ga0495581_0122177_144_659 167
450 3300047317 Ga0495604_0202020 Ga0495604_0202020_746_1261 167
451 3300047321 Ga0495676_0000324 Ga0495676_0000324_30989_31504 167
452 3300047323 Ga0495683_0215403 Ga0495683_0215403_239_742 167
453 3300047443 Ga0495687_155930 Ga0495687_155930_131_634 167
454 3300047472 Ga0495686_0000402 Ga0495686_0000402_61409_61912 167
455 3300047472 Ga0495686_0019273 Ga0495686_0019273_1613_2116 167
456 3300047673 Ga0495593_0009368 Ga0495593_0009368_4979_5494 167
457 3300047673 Ga0495593_0049769 Ga0495593_0049769_73_588 167
458 3300048088 Ga0495602_0736586 Ga0495602_0736586_64_579 167
459 3300048089 Ga0495614_0026681 Ga0495614_0026681_1822_2337 167
460 3300048904 Ga0496101_0730436 Ga0496101_0730436_181_696 167
461 3300048905 Ga0496102_0009914 Ga0496102_0009914_684_1187 167
462 3300048905 Ga0496102_0376321 Ga0496102_0376321_440_943 167
463 3300048906 Ga0496103_0202887 Ga0496103_0202887_362_865 167
464 3300048906 Ga0496103_0276026 Ga0496103_0276026_229_732 167
465 3300048907 Ga0496104_0556801 Ga0496104_0556801_281_784 167
466 3300048908 Ga0496105_0606408 Ga0496105_0606408_326_829 167
467 3300048916 Ga0496113_0233615 Ga0496113_0233615_283_786 167
468 3300048916 Ga0496113_0360501 Ga0496113_0360501_82_585 167
469 3300048918 Ga0496115_0093019 Ga0496115_0093019_1247_1780 167
470 3300048919 Ga0496116_0000006 Ga0496116_0000006_72802_73305 167
471 3300048919 Ga0496116_0101298 Ga0496116_0101298_1053_1556 167
472 3300048920 Ga0496117_0000027 Ga0496117_0000027_283040_283543 167
473 3300048921 Ga0496118_0000141 Ga0496118_0000141_80836_81339 167
474 3300048921 Ga0496118_0036813 Ga0496118_0036813_1465_1983 167
475 3300048922 Ga0496119_0000006 Ga0496119_0000006_306551_307054 167
476 3300048924 Ga0496121_0218618 Ga0496121_0218618_631_1164 167
477 3300048925 Ga0496122_0000391 Ga0496122_0000391_80164_80682 167
478 3300048925 Ga0496122_0001741 Ga0496122_0001741_24136_24639 167
479 3300048925 Ga0496122_0002084 Ga0496122_0002084_6879_7382 167
480 3300048925 Ga0496122_0008848 Ga0496122_0008848_9840_10343 167
481 3300048926 Ga0496123_0001461 Ga0496123_0001461_8362_8865 167
482 3300048926 Ga0496123_0011250 Ga0496123_0011250_2861_3379 167
483 3300048927 Ga0496124_0017492 Ga0496124_0017492_3883_4386 167
484 3300048927 Ga0496124_0018315 Ga0496124_0018315_5846_6349 167
485 3300048928 Ga0496125_0001989 Ga0496125_0001989_19240_19743 167
486 3300048928 Ga0496125_0002001 Ga0496125_0002001_19932_20435 167
487 3300048928 Ga0496125_0002112 Ga0496125_0002112_9613_10131 167
488 3300048928 Ga0496125_0029245 Ga0496125_0029245_1295_1813 167
489 3300048928 Ga0496125_0106071 Ga0496125_0106071_259_762 167
490 3300048928 Ga0496125_0154894 Ga0496125_0154894_77_580 167
491 3300048929 Ga0496126_0189370 Ga0496126_0189370_484_1017 167
492 3300049459 Ga0495678_006395 Ga0495678_006395_223_726 167
493 3300049459 Ga0495678_080107 Ga0495678_080107_449_952 167
494 3300049661 Ga0501217_143805 Ga0501217_143805_139_657 167
495 3300049823 Ga0501044_0993469 Ga0501044_0993469_174_683 167
496 3300050493 nmdc:mga0k408_145547_c1 nmdc:mga0k408_145547_c1_647_1150 167
497 3300050493 nmdc:mga0k408_292290_c1 nmdc:mga0k408_292290_c1_42_545 167
498 3300050493 nmdc:mga0k408_300585_c1 nmdc:mga0k408_300585_c1_284_787 167
499 3300053086 Ga0500578_0000244 Ga0500578_0000244_7464_7967 167
500 3300053086 Ga0500578_0035158 Ga0500578_0035158_700_1209 167
501 3300053094 Ga0500566_0405443 Ga0500566_0405443_43_558 167
502 3300053108 Ga0500562_019852 Ga0500562_019852_76_582 167
503 3300053108 Ga0500562_100650 Ga0500562_100650_10_516 167
504 3300053110 Ga0500571_000094 Ga0500571_000094_4522_5037 167
505 3300053120 Ga0500597_057611 Ga0500597_057611_908_1423 167
506 3300053122 Ga0500608_012634 Ga0500608_012634_308_811 167
507 3300053122 Ga0500608_085507 Ga0500608_085507_690_1205 167
508 3300053125 Ga0500618_014478 Ga0500618_014478_1037_1540 167
509 3300053127 Ga0500623_038459 Ga0500623_038459_1922_2431 167
510 3300053131 Ga0500652_019841 Ga0500652_019841_1799_2386 167
511 3300053131 Ga0500652_104680 Ga0500652_104680_141_650 167
512 3300053133 Ga0500655_000060 Ga0500655_000060_13615_14130 167
513 3300053136 Ga0500559_0163515 Ga0500559_0163515_296_799 167
514 3300053136 Ga0500559_0267771 Ga0500559_0267771_55_558 167
515 3300053139 Ga0500568_0010694 Ga0500568_0010694_643_1152 167
516 3300053146 Ga0500588_0028674 Ga0500588_0028674_267_770 167
517 3300053148 Ga0500590_037210 Ga0500590_037210_1805_2308 167
518 3300053148 Ga0500590_115327 Ga0500590_115327_436_939 167
519 3300053151 Ga0500604_0002004 Ga0500604_0002004_4595_5101 167
520 3300053151 Ga0500604_0010405 Ga0500604_0010405_956_1459 167
521 3300053156 Ga0500622_0000015 Ga0500622_0000015_202097_202603 167
522 3300053156 Ga0500622_0000022 Ga0500622_0000022_39121_39627 167
523 3300053156 Ga0500622_0001421 Ga0500622_0001421_18123_18632 167
524 3300053156 Ga0500622_0011232 Ga0500622_0011232_1377_1880 167
525 3300053156 Ga0500622_0028521 Ga0500622_0028521_1696_2205 167
526 3300053158 Ga0500627_0144154 Ga0500627_0144154_396_902 167
527 3300053162 Ga0500638_001711 Ga0500638_001711_6249_6764 167
528 3300053177 Ga0500636_0124709 Ga0500636_0124709_80_583 167
529 3300053177 Ga0500636_0185173 Ga0500636_0185173_290_805 167
530 3300053178 Ga0500637_0040337 Ga0500637_0040337_1952_2455 167
531 3300053178 Ga0500637_0344319 Ga0500637_0344319_155_664 167
532 3300053734 Ga0500565_001698 Ga0500565_001698_725_1240 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

54

191

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9466 8 159
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9413 5 164
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.925 6 166
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.9196 5 162
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9182 5 164
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9466 8 159 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9413 5 164 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9204 6 166 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9182 5 164 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9076 4 161 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1G9HHE1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 1.004 4 165
AF-A0A848FML0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9991 1 167
AF-A0A3E1NX79-F1-model_v4 SRPBCC domain-containing protein 0.9966 6 161
AF-A0A848FML0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9931 1 167
AF-F4CBB1-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9919 1 167

Feature Viewer

pLDDT pTM Quality
95.53 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map