F460306

General Info

Members Datasets Scaffolds Average Seq Length
532 241 531 262

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0523429|Ga0451577_0523429_91_1011
Length 293
Sequence MKNQLAQLAQYLNLSSGMDEKKKSGGGPTLIDGGKPKTEKPVDRRRPIRVLLLDDREENLLLRSTILRQHGYDVVSSASIEEAQKHLENIDIAVLDYHLGAGKFGTEVAESLRGERPQVPIIILSATLERKFGGIADMHLLKGYSTMDDLLAALRNFEAKRRGKPVVVDARDFYYSRISMAMGDDVVLEILDRDGNWQYVNDYFAALFERKRPYFVGKNMFESFPELGEEWKEIVRTVADTRETYIDRSFRGLPNLPTKNPRWVWNVLAFPLKLHDDRNGVALSARVIEKKSF

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.32
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 5.83
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001321 3300000546 Bacteria 3628
2 rootH1_10332512 3300003323 Bacteria 1620
3 rootH1_10365739 3300003323 Bacteria 1605
4 Ga0058863_10011887 3300004799 Bacteria 2074
5 Ga0058861_10043048 3300004800 Bacteria 1676
6 Ga0058862_10220838 3300004803 Bacteria 2526
7 Ga0070658_10000004 3300005327 Bacteria 402230
8 Ga0070658_10009641 3300005327 Bacteria 7751
9 Ga0070658_10024444 3300005327 Bacteria 4846
10 Ga0070658_10027091 3300005327 Bacteria 4601
11 Ga0070658_10031393 3300005327 Bacteria 4266
12 Ga0070658_10182979 3300005327 Bacteria 1764
13 Ga0070658_10258483 3300005327 Bacteria 1478
14 Ga0070683_100026850 3300005329 Bacteria 5189
15 Ga0070683_100031861 3300005329 Bacteria 4797
16 Ga0070683_100109110 3300005329 Bacteria 2610
17 Ga0070666_10194344 3300005335 Bacteria 1426
18 Ga0070680_100031806 3300005336 Unclassified 4243
19 Ga0070680_100033409 3300005336 Bacteria 4146
20 Ga0070680_100069983 3300005336 Unclassified 2882
21 Ga0070682_100007377 3300005337 Bacteria 6205
22 Ga0068868_100019387 3300005338 Bacteria 5097
23 Ga0070660_100012775 3300005339 Bacteria 6003
24 Ga0070660_100014364 3300005339 Bacteria 5702
25 Ga0070660_100049021 3300005339 Bacteria 3245
26 Ga0070660_100123829 3300005339 Bacteria 2065
27 Ga0070660_100138221 3300005339 Bacteria 1953
28 Ga0070660_100299420 3300005339 Unclassified 1318
29 Ga0070691_10072105 3300005341 Bacteria 1677
30 Ga0070661_100042798 3300005344 Unclassified 3307
31 Ga0070661_100054268 3300005344 Unclassified 2935
32 Ga0070692_10086510 3300005345 Bacteria 1697
33 Ga0070692_10336904 3300005345 Bacteria 933
34 Ga0070671_100006455 3300005355 Bacteria 9374
35 Ga0070673_100291137 3300005364 Unclassified 1435
36 Ga0070659_100000601 3300005366 Bacteria 26412
37 Ga0070709_10019087 3300005434 Bacteria 3956
38 Ga0070714_100058263 3300005435 Bacteria 3309
39 Ga0070714_100065367 3300005435 Bacteria 3132
40 Ga0070714_100194322 3300005435 Bacteria 1853
41 Ga0070713_100010252 3300005436 Bacteria 6765
42 Ga0070713_100087268 3300005436 Unclassified 2676
43 Ga0070713_100205797 3300005436 Bacteria 1779
44 Ga0070713_100487848 3300005436 Bacteria 1161
45 Ga0070710_10425401 3300005437 Unclassified 895
46 Ga0070711_100026570 3300005439 Bacteria 3794
47 Ga0070711_100308081 3300005439 Bacteria 1261
48 Ga0070678_100260326 3300005456 Bacteria 1459
49 Ga0070681_10009446 3300005458 Bacteria 9598
50 Ga0070681_10040779 3300005458 Unclassified 4651
51 Ga0070681_10043372 3300005458 Bacteria 4507
52 Ga0070681_10073266 3300005458 Bacteria 3386
53 Ga0070681_10147684 3300005458 Bacteria 2279
54 Ga0070681_10158617 3300005458 Bacteria 2186
55 Ga0070681_10203179 3300005458 Bacteria 1899
56 Ga0070681_10379564 3300005458 Bacteria 1324
57 Ga0070681_10674690 3300005458 Bacteria 949
58 Ga0070679_100002283 3300005530 Bacteria 17337
59 Ga0070679_100037253 3300005530 Unclassified 4830
60 Ga0070679_100058910 3300005530 Unclassified 3827
61 Ga0070679_100103720 3300005530 Bacteria 2830
62 Ga0070679_100209546 3300005530 Bacteria 1913
63 Ga0070684_100014368 3300005535 Bacteria 6411
64 Ga0070684_100072207 3300005535 Unclassified 3038
65 Ga0070684_100160153 3300005535 Bacteria 2041
66 Ga0070697_100014663 3300005536 Bacteria 6153
67 Ga0070697_100114667 3300005536 Bacteria 2249
68 Ga0068853_100000100 3300005539 Bacteria 58118
69 Ga0068853_100030975 3300005539 Bacteria 4522
70 Ga0068853_100037552 3300005539 Bacteria 4121
71 Ga0068853_100048137 3300005539 Unclassified 3661
72 Ga0068853_100159694 3300005539 Unclassified 2033
73 Ga0068853_100262814 3300005539 Unclassified 1587
74 Ga0068853_100421609 3300005539 Unclassified 1251
75 Ga0070695_100018465 3300005545 Unclassified 4236
76 Ga0070696_100048934 3300005546 Unclassified 2935
77 Ga0070693_100006969 3300005547 Bacteria 5500
78 Ga0070665_100021347 3300005548 Bacteria 6513
79 Ga0070665_100033876 3300005548 Bacteria 5138
80 Ga0070665_100054614 3300005548 Bacteria 4006
81 Ga0068855_100007892 3300005563 Bacteria 12855
82 Ga0068855_100037522 3300005563 Bacteria 5761
83 Ga0068855_100047543 3300005563 Bacteria 5068
84 Ga0068855_100062699 3300005563 Bacteria 4339
85 Ga0068855_100079747 3300005563 Bacteria 3796
86 Ga0068855_100087189 3300005563 Bacteria 3608
87 Ga0068855_100090590 3300005563 Bacteria 3529
88 Ga0068855_100262295 3300005563 Bacteria 1924
89 Ga0068855_100310312 3300005563 Bacteria 1745
90 Ga0070664_100067129 3300005564 Unclassified 3065
91 Ga0070664_100087569 3300005564 Bacteria 2693
92 Ga0068857_100055905 3300005577 Bacteria 3502
93 Ga0068854_100000074 3300005578 Bacteria 72015
94 Ga0068854_100048369 3300005578 Unclassified 3034
95 Ga0068854_100106515 3300005578 Unclassified 2109
96 Ga0068854_100232696 3300005578 Bacteria 1463
97 Ga0068854_100287006 3300005578 Unclassified 1327
98 Ga0068856_100024943 3300005614 Bacteria 5827
99 Ga0068856_100035422 3300005614 Bacteria 4892
100 Ga0068856_100209104 3300005614 Unclassified 1966
101 Ga0068856_100608136 3300005614 Bacteria 1114
102 Ga0068852_100004648 3300005616 Bacteria 9731
103 Ga0068852_100013376 3300005616 Bacteria 6281
104 Ga0068852_100148906 3300005616 Unclassified 2174
105 Ga0068852_100560529 3300005616 Bacteria 1144
106 Ga0068864_100016174 3300005618 Bacteria 6209
107 Ga0068864_100240106 3300005618 Unclassified 1679
108 Ga0068851_10051566 3300005834 Unclassified 2091
109 Ga0068863_100015404 3300005841 Bacteria 7351
110 Ga0068858_100315072 3300005842 Bacteria 1494
111 Ga0081540_1006852 3300005983 Bacteria 8224
112 Ga0070717_10114921 3300006028 Bacteria 2300
113 Ga0070716_100059017 3300006173 Unclassified 2210
114 Ga0070716_100221623 3300006173 Bacteria 1271
115 Ga0070712_100431882 3300006175 Unclassified 1093
116 Ga0075434_100111154 3300006871 Unclassified 2751
117 Ga0075436_100006391 3300006914 Bacteria 8076
118 Ga0075436_100015574 3300006914 Bacteria 5205
119 Ga0075436_100043592 3300006914 Bacteria 3093
120 Ga0105240_10001235 3300009093 Bacteria 44371
121 Ga0105240_10003079 3300009093 Bacteria 26206
122 Ga0105240_10014142 3300009093 Bacteria 10903
123 Ga0105240_10131799 3300009093 Unclassified 2998
124 Ga0105240_10152462 3300009093 Unclassified 2751
125 Ga0105240_10240786 3300009093 Unclassified 2097
126 Ga0105240_10864438 3300009093 Bacteria 975
127 Ga0105245_10029968 3300009098 Bacteria 4811
128 Ga0105245_10181404 3300009098 Bacteria 2012
129 Ga0114129_10106555 3300009147 Unclassified 3872
130 Ga0105241_10261665 3300009174 Bacteria 1470
131 Ga0105241_10563643 3300009174 Bacteria 1024
132 Ga0105248_10014521 3300009177 Bacteria 8670
133 Ga0105248_10110100 3300009177 Bacteria 3105
134 Ga0105248_10627790 3300009177 Unclassified 1212
135 Ga0105248_10876540 3300009177 Unclassified 1013
136 Ga0105237_10012226 3300009545 Bacteria 9048
137 Ga0105237_10194413 3300009545 Unclassified 2028
138 Ga0105237_10273624 3300009545 Unclassified 1691
139 Ga0105237_10774566 3300009545 Bacteria 966
140 Ga0105238_10003571 3300009551 Bacteria 15505
141 Ga0105238_10008859 3300009551 Bacteria 10066
142 Ga0105238_10012260 3300009551 Bacteria 8645
143 Ga0105238_10024665 3300009551 Bacteria 6130
144 Ga0105238_10031252 3300009551 Bacteria 5420
145 Ga0105238_10134679 3300009551 Unclassified 2448
146 Ga0105238_10409069 3300009551 Bacteria 1350
147 Ga0105249_10027220 3300009553 Bacteria 5158
148 Ga0105239_10091987 3300010375 Unclassified 3347
149 Ga0105239_10377975 3300010375 Bacteria 1601
150 Ga0157373_10029579 3300013100 Bacteria 3945
151 Ga0157373_10142761 3300013100 Bacteria 1684
152 Ga0157373_10158566 3300013100 Bacteria 1592
153 Ga0157371_10142235 3300013102 Bacteria 1709
154 Ga0157370_10025296 3300013104 Bacteria 5876
155 Ga0157370_10040457 3300013104 Bacteria 4501
156 Ga0157370_10053172 3300013104 Bacteria 3863
157 Ga0157370_10072305 3300013104 Unclassified 3254
158 Ga0157370_10078802 3300013104 Unclassified 3102
159 Ga0157370_10112312 3300013104 Bacteria 2547
160 Ga0157370_10123159 3300013104 Bacteria 2421
161 Ga0157370_10192381 3300013104 Bacteria 1894
162 Ga0157370_10445656 3300013104 Bacteria 1190
163 Ga0157369_10000442 3300013105 Bacteria 55048
164 Ga0157369_10010057 3300013105 Bacteria 10801
165 Ga0157369_10037540 3300013105 Bacteria 5304
166 Ga0157369_10077474 3300013105 Unclassified 3563
167 Ga0157369_10185635 3300013105 Bacteria 2187
168 Ga0157369_10257396 3300013105 Unclassified 1821
169 Ga0157369_10347084 3300013105 Unclassified 1542
170 Ga0157374_10078895 3300013296 Bacteria 3119
171 Ga0157374_10105455 3300013296 Unclassified 2707
172 Ga0157374_10121862 3300013296 Bacteria 2517
173 Ga0157374_10148518 3300013296 Unclassified 2278
174 Ga0157374_10213067 3300013296 Unclassified 1894
175 Ga0163162_10195832 3300013306 Bacteria 2149
176 Ga0163162_10359752 3300013306 Bacteria 1588
177 Ga0157372_10011458 3300013307 Bacteria 9428
178 Ga0157372_10012096 3300013307 Bacteria 9192
179 Ga0157372_10027551 3300013307 Bacteria 6191
180 Ga0157372_10046707 3300013307 Bacteria 4807
181 Ga0157372_10066432 3300013307 Bacteria 4052
182 Ga0157372_10091926 3300013307 Unclassified 3451
183 Ga0163163_10014577 3300014325 Bacteria 7231
184 Ga0163163_10032768 3300014325 Bacteria 5021
185 Ga0163163_10111459 3300014325 Bacteria 2765
186 Ga0163163_10125578 3300014325 Bacteria 2603
187 Ga0163163_10130084 3300014325 Unclassified 2557
188 Ga0157376_10015169 3300014969 Bacteria 5812
189 Ga0157376_10019146 3300014969 Bacteria 5268
190 Ga0157376_10071351 3300014969 Bacteria 2951
191 Ga0157376_10107877 3300014969 Bacteria 2445
192 Ga0197907_10699666 3300020069 Bacteria 1737
193 Ga0206351_10543794 3300020077 Bacteria 1530
194 Ga0206350_10305681 3300020080 Bacteria 1529
195 Ga0213873_10026075 3300021358 Bacteria 1417
196 Ga0213872_10001885 3300021361 Bacteria 12929
197 Ga0213872_10036642 3300021361 Bacteria 2241
198 Ga0213874_10006679 3300021377 Bacteria 2738
199 Ga0224712_10038652 3300022467 Bacteria 1784
200 Ga0209233_1003364 3300025261 Bacteria 5652
201 Ga0207656_10035881 3300025321 Unclassified 2079
202 Ga0207692_10246187 3300025898 Unclassified 1069
203 Ga0207680_10125310 3300025903 Bacteria 1685
204 Ga0207647_10011377 3300025904 Bacteria 6241
205 Ga0207647_10024120 3300025904 Bacteria 4012
206 Ga0207699_10089170 3300025906 Unclassified 1932
207 Ga0207699_10448075 3300025906 Bacteria 925
208 Ga0207705_10000024 3300025909 Bacteria 259977
209 Ga0207705_10004909 3300025909 Bacteria 10037
210 Ga0207705_10008017 3300025909 Bacteria 7744
211 Ga0207705_10032417 3300025909 Bacteria 3734
212 Ga0207705_10091553 3300025909 Bacteria 2227
213 Ga0207705_10227930 3300025909 Bacteria 1416
214 Ga0207705_10321203 3300025909 Bacteria 1190
215 Ga0207705_10372386 3300025909 Bacteria 1102
216 Ga0207707_10001569 3300025912 Bacteria 21033
217 Ga0207707_10031219 3300025912 Bacteria 4661
218 Ga0207707_10037731 3300025912 Unclassified 4222
219 Ga0207707_10139693 3300025912 Bacteria 2118
220 Ga0207707_10145211 3300025912 Unclassified 2074
221 Ga0207707_10165395 3300025912 Bacteria 1933
222 Ga0207707_10196614 3300025912 Bacteria 1759
223 Ga0207707_10258594 3300025912 Bacteria 1511
224 Ga0207707_10391626 3300025912 Bacteria 1194
225 Ga0207707_10404718 3300025912 Bacteria 1171
226 Ga0207707_10504461 3300025912 Unclassified 1032
227 Ga0207695_10000804 3300025913 Bacteria 58597
228 Ga0207695_10025139 3300025913 Bacteria 6678
229 Ga0207695_10043943 3300025913 Bacteria 4757
230 Ga0207695_10169861 3300025913 Bacteria 2107
231 Ga0207695_10210599 3300025913 Bacteria 1854
232 Ga0207695_10281775 3300025913 Bacteria 1556
233 Ga0207671_10102488 3300025914 Unclassified 2169
234 Ga0207671_10151431 3300025914 Bacteria 1792
235 Ga0207693_10072137 3300025915 Unclassified 2704
236 Ga0207663_10035771 3300025916 Unclassified 2982
237 Ga0207663_10363003 3300025916 Bacteria 1099
238 Ga0207660_10019212 3300025917 Bacteria 4564
239 Ga0207660_10100334 3300025917 Bacteria 2161
240 Ga0207660_10121114 3300025917 Bacteria 1982
241 Ga0207657_10001844 3300025919 Bacteria 22887
242 Ga0207657_10014767 3300025919 Bacteria 7604
243 Ga0207657_10050629 3300025919 Bacteria 3615
244 Ga0207657_10119658 3300025919 Unclassified 2167
245 Ga0207649_10004392 3300025920 Bacteria 7655
246 Ga0207652_10007088 3300025921 Bacteria 9031
247 Ga0207652_10009357 3300025921 Bacteria 7879
248 Ga0207652_10022473 3300025921 Bacteria 5218
249 Ga0207652_10040614 3300025921 Unclassified 3951
250 Ga0207652_10080949 3300025921 Bacteria 2840
251 Ga0207652_10199627 3300025921 Bacteria 1800
252 Ga0207652_10301491 3300025921 Unclassified 1446
253 Ga0207652_10637729 3300025921 Unclassified 953
254 Ga0207694_10007068 3300025924 Bacteria 8523
255 Ga0207694_10011356 3300025924 Bacteria 6723
256 Ga0207694_10051295 3300025924 Unclassified 3198
257 Ga0207694_10237382 3300025924 Bacteria 1489
258 Ga0207650_10318291 3300025925 Unclassified 1274
259 Ga0207687_10147516 3300025927 Bacteria 1791
260 Ga0207687_10556714 3300025927 Bacteria 963
261 Ga0207700_10029536 3300025928 Bacteria 3870
262 Ga0207700_10081445 3300025928 Bacteria 2528
263 Ga0207700_10111035 3300025928 Bacteria 2206
264 Ga0207664_10017642 3300025929 Bacteria 5238
265 Ga0207664_10062609 3300025929 Bacteria 2971
266 Ga0207664_10194843 3300025929 Unclassified 1746
267 Ga0207664_10254327 3300025929 Bacteria 1534
268 Ga0207644_10036539 3300025931 Bacteria 3449
269 Ga0207690_10000389 3300025932 Bacteria 29022
270 Ga0207690_10132768 3300025932 Unclassified 1824
271 Ga0207690_10165343 3300025932 Bacteria 1653
272 Ga0207665_10028881 3300025939 Bacteria 3667
273 Ga0207665_10178333 3300025939 Unclassified 1538
274 Ga0207665_10250815 3300025939 Bacteria 1308
275 Ga0207711_10122225 3300025941 Bacteria 2326
276 Ga0207711_10318901 3300025941 Bacteria 1436
277 Ga0207661_10010698 3300025944 Bacteria 6612
278 Ga0207661_10012161 3300025944 Bacteria 6249
279 Ga0207679_10074055 3300025945 Bacteria 2579
280 Ga0207679_10114327 3300025945 Bacteria 2137
281 Ga0207679_10246486 3300025945 Bacteria 1516
282 Ga0207667_10000538 3300025949 Bacteria 50064
283 Ga0207667_10001884 3300025949 Bacteria 26389
284 Ga0207667_10025095 3300025949 Bacteria 6534
285 Ga0207667_10044675 3300025949 Bacteria 4694
286 Ga0207667_10046020 3300025949 Unclassified 4620
287 Ga0207667_10111220 3300025949 Bacteria 2825
288 Ga0207667_10262409 3300025949 Bacteria 1766
289 Ga0207651_10440503 3300025960 Unclassified 1116
290 Ga0207712_10060293 3300025961 Bacteria 2689
291 Ga0207668_10033030 3300025972 Bacteria 3426
292 Ga0207640_10000010 3300025981 Bacteria 275745
293 Ga0207640_10043549 3300025981 Unclassified 2870
294 Ga0207640_10356682 3300025981 Bacteria 1177
295 Ga0207658_10574196 3300025986 Bacteria 1011
296 Ga0207677_10064948 3300026023 Unclassified 2544
297 Ga0207703_10206680 3300026035 Bacteria 1748
298 Ga0207639_10000023 3300026041 Bacteria 215340
299 Ga0207639_10007682 3300026041 Bacteria 7361
300 Ga0207639_10016113 3300026041 Bacteria 5281
301 Ga0207639_10021322 3300026041 Unclassified 4652
302 Ga0207639_10065535 3300026041 Unclassified 2820
303 Ga0207639_10231889 3300026041 Unclassified 1600
304 Ga0207678_10002077 3300026067 Bacteria 18170
305 Ga0207678_10003233 3300026067 Bacteria 14718
306 Ga0207678_10008839 3300026067 Bacteria 8868
307 Ga0207678_10122710 3300026067 Bacteria 2217
308 Ga0207641_10094207 3300026088 Bacteria 2626
309 Ga0207676_10066636 3300026095 Bacteria 2873
310 Ga0207674_10001311 3300026116 Bacteria 32478
311 Ga0207674_10070239 3300026116 Bacteria 3521
312 Ga0207674_10137252 3300026116 Unclassified 2406
313 Ga0207698_10008297 3300026142 Bacteria 6560
314 Ga0207698_10011913 3300026142 Bacteria 5663
315 Ga0207698_10126760 3300026142 Bacteria 2173
316 Ga0207698_10508631 3300026142 Unclassified 1173
317 Ga0207698_10788343 3300026142 Unclassified 952
318 Ga0268266_10001615 3300028379 Bacteria 26291
319 Ga0268266_10001974 3300028379 Bacteria 22989
320 Ga0268266_10063331 3300028379 Bacteria 3192
321 Ga0268266_10167249 3300028379 Bacteria 1993
322 Ga0265338_10038803 3300028800 Bacteria 4505
323 Ga0265332_10018877 3300031238 Bacteria 3045
324 Ga0265328_10056903 3300031239 Unclassified 1435
325 Ga0265325_10001599 3300031241 Bacteria 15804
326 Ga0265325_10057004 3300031241 Bacteria 1993
327 Ga0265340_10000590 3300031247 Bacteria 20174
328 Ga0265340_10015596 3300031247 Bacteria 3946
329 Ga0265331_10020545 3300031250 Bacteria 3388
330 Ga0265331_10080910 3300031250 Bacteria 1509
331 Ga0265327_10048045 3300031251 Bacteria 2247
332 Ga0265316_10008885 3300031344 Bacteria 9277
333 Ga0265316_10062596 3300031344 Unclassified 2887
334 Ga0307408_100020476 3300031548 Bacteria 4467
335 Ga0307413_10066196 3300031824 Bacteria 2254
336 Ga0307406_10279894 3300031901 Unclassified 1272
337 Ga0307407_10052077 3300031903 Bacteria 2349
338 Ga0307409_100006808 3300031995 Bacteria 6762
339 Ga0307416_100149218 3300032002 Unclassified 2141
340 Ga0307415_100084395 3300032126 Bacteria 2279
341 Ga0307510_10057512 3300033180 Bacteria 4035
342 Ga0307510_10113543 3300033180 Bacteria 2442
343 Ga0373926_0012764 3300035083 Unclassified 2843
344 Ga0373944_0034888 3300035089 Bacteria 1531
345 Ga0373936_0004381 3300035113 Bacteria 5338
346 Ga0373945_0001513 3300035116 Bacteria 7100
347 Ga0373943_0013220 3300035170 Unclassified 3725
348 Ga0373924_0000059 3300035410 Bacteria 28501
349 Ga0373935_0003805 3300035692 Bacteria 8813
350 Ga0373935_0026176 3300035692 Unclassified 3598
351 Ga0373935_0077297 3300035692 Bacteria 2157
352 Ga0373927_0006966 3300035695 Bacteria 7673
353 Ga0373927_0029166 3300035695 Bacteria 3596
354 Ga0373933_0156249 3300035724 Unclassified 1447
355 Ga0373947_0008862 3300035725 Bacteria 5788
356 Ga0373947_0011661 3300035725 Bacteria 5042
357 Ga0373937_0000408 3300036401 Bacteria 40094
358 Ga0373937_0222236 3300036401 Bacteria 1778
359 Ga0373925_0018521 3300037068 Bacteria 5061
360 Ga0373925_0020358 3300037068 Bacteria 4829
361 Ga0395900_0251721 3300037418 Unclassified 1768
362 Ga0395900_0801027 3300037418 Bacteria 870
363 Ga0395898_0117243 3300037466 Bacteria 2551
364 Ga0395898_0199032 3300037466 Bacteria 1913
365 Ga0395898_0263398 3300037466 Bacteria 1644
366 Ga0395905_0018442 3300037471 Bacteria 6624
367 Ga0395905_0032992 3300037471 Unclassified 4868
368 Ga0395905_0035263 3300037471 Bacteria 4698
369 Ga0395905_0101529 3300037471 Bacteria 2700
370 Ga0395901_0298047 3300038443 Bacteria 1672
371 Ga0436360_0105677 3300039438 Unclassified 1243
372 Ga0436360_0366267 3300039438 Unclassified 2743
373 Ga0436360_0505146 3300039438 Bacteria 2277
374 Ga0436361_0330933 3300039447 Bacteria 3726
375 Ga0436361_0861091 3300039447 Bacteria 5968
376 Ga0436361_0889427 3300039447 Unclassified 2710
377 Ga0436363_0707383 3300039450 Bacteria 7601
378 Ga0436363_1127254 3300039450 Bacteria 1292
379 Ga0436363_1443836 3300039450 Bacteria 8455
380 Ga0436362_0930676 3300039453 Bacteria 2512
381 Ga0451577_0523429 3300042876 Bacteria 1077
382 Ga0466963_0044187 3300044694 Unclassified 2932
383 Ga0466957_0000260 3300044842 Bacteria 25409
384 Ga0466959_0014979 3300045049 Bacteria 5651
385 Ga0466958_0052042 3300045836 Bacteria 2481
386 Ga0466958_0157813 3300045836 Unclassified 1432
387 Ga0466967_0223123 3300045976 Bacteria 1792
388 Ga0466967_0365171 3300045976 Bacteria 1399
389 Ga0466967_0609316 3300045976 Bacteria 1078
390 Ga0466967_0677640 3300045976 Unclassified 1020
391 Ga0466967_0695544 3300045976 Bacteria 1007
392 Ga0466967_0881872 3300045976 Bacteria 889
393 Ga0495629_0180025 3300046459 Bacteria 1465
394 Ga0495638_0147454 3300046460 Bacteria 1367
395 Ga0495651_0009116 3300046462 Bacteria 7617
396 Ga0495651_0049678 3300046462 Bacteria 3238
397 Ga0495651_0196009 3300046462 Bacteria 1417
398 Ga0495651_0275500 3300046462 Bacteria 1139
399 Ga0495653_0024553 3300046463 Bacteria 4856
400 Ga0495650_0000029 3300046471 Bacteria 453466
401 Ga0495650_0008610 3300046471 Bacteria 5921
402 Ga0495650_0102368 3300046471 Unclassified 1074
403 Ga0495580_0031276 3300046472 Unclassified 3847
404 Ga0495580_0044017 3300046472 Bacteria 3176
405 Ga0495580_0115857 3300046472 Unclassified 1861
406 Ga0495580_0327922 3300046472 Unclassified 1040
407 Ga0495582_0076700 3300046473 Bacteria 1853
408 Ga0495582_0347273 3300046473 Bacteria 854
409 Ga0495639_0016207 3300046475 Bacteria 3234
410 Ga0495662_0002704 3300046476 Bacteria 8963
411 Ga0495664_0020741 3300046477 Bacteria 3793
412 Ga0495585_0043436 3300046492 Bacteria 2514
413 Ga0495594_0002013 3300046499 Bacteria 10582
414 Ga0495594_0035442 3300046499 Bacteria 2718
415 Ga0495594_0091363 3300046499 Unclassified 1706
416 Ga0495583_0067044 3300046506 Bacteria 1586
417 Ga0495628_0064660 3300046516 Bacteria 2863
418 Ga0495644_0000316 3300046523 Bacteria 22262
419 Ga0495648_0175588 3300046524 Bacteria 1094
420 Ga0495652_0049688 3300046529 Bacteria 3589
421 Ga0495665_0019314 3300046531 Bacteria 3664
422 Ga0495586_0222484 3300046535 Unclassified 1073
423 Ga0495587_0041236 3300046536 Bacteria 2755
424 Ga0495609_0161679 3300046538 Bacteria 949
425 Ga0495645_0084570 3300046543 Bacteria 2272
426 Ga0495622_0032861 3300046557 Bacteria 2422
427 Ga0495633_0039548 3300046558 Bacteria 2251
428 Ga0495667_0093843 3300046559 Bacteria 1943
429 Ga0495667_0195659 3300046559 Bacteria 1295
430 Ga0495634_0008386 3300046642 Bacteria 7700
431 Ga0495611_0096048 3300046648 Bacteria 1372
432 Ga0495625_0001024 3300046660 Bacteria 36797
433 Ga0495625_0081381 3300046660 Bacteria 2254
434 Ga0495625_0081636 3300046660 Bacteria 2250
435 Ga0495635_0214844 3300046663 Bacteria 1302
436 Ga0495659_0029110 3300046664 Bacteria 1916
437 Ga0495661_0049964 3300046665 Bacteria 2534
438 Ga0495599_0066149 3300046678 Bacteria 2258
439 Ga0495623_0224509 3300046679 Bacteria 1068
440 Ga0495646_0048054 3300046680 Bacteria 2595
441 Ga0495669_0005797 3300046684 Bacteria 5151
442 Ga0495669_0008085 3300046684 Bacteria 4415
443 Ga0495669_0018724 3300046684 Bacteria 2980
444 Ga0495669_0029510 3300046684 Bacteria 2405
445 Ga0495669_0130409 3300046684 Bacteria 1183
446 Ga0495613_0058072 3300046689 Bacteria 2840
447 Ga0495624_0106983 3300046690 Bacteria 1721
448 Ga0495600_0001535 3300046809 Bacteria 12828
449 Ga0495600_0319121 3300046809 Bacteria 977
450 Ga0495581_0003151 3300047315 Bacteria 9438
451 Ga0495581_0081019 3300047315 Unclassified 1879
452 Ga0495604_0035821 3300047317 Bacteria 3917
453 Ga0495604_0044413 3300047317 Bacteria 3472
454 Ga0495604_0181146 3300047317 Unclassified 1474
455 Ga0495674_0233755 3300047319 Bacteria 1516
456 Ga0495672_0009742 3300047320 Bacteria 6925
457 Ga0495680_0044789 3300047322 Bacteria 3497
458 Ga0495675_0011199 3300047444 Bacteria 5625
459 Ga0495675_0082427 3300047444 Bacteria 2025
460 Ga0495675_0296196 3300047444 Bacteria 962
461 Ga0495684_0055408 3300047471 Bacteria 3024
462 Ga0495684_0087056 3300047471 Bacteria 2368
463 Ga0495686_0004468 3300047472 Bacteria 11510
464 Ga0495686_0024612 3300047472 Bacteria 3953
465 Ga0495593_0036788 3300047673 Bacteria 2653
466 Ga0496100_0054934 3300048903 Unclassified 2600
467 Ga0496102_0061394 3300048905 Unclassified 3440
468 Ga0496102_0266559 3300048905 Bacteria 1615
469 Ga0496102_0512211 3300048905 Bacteria 1122
470 Ga0496103_0010051 3300048906 Bacteria 5595
471 Ga0496104_0000648 3300048907 Bacteria 29835
472 Ga0496104_0020982 3300048907 Bacteria 5994
473 Ga0496104_0190632 3300048907 Unclassified 1961
474 Ga0496104_0206936 3300048907 Bacteria 1874
475 Ga0496104_0785562 3300048907 Bacteria 858
476 Ga0496105_0000590 3300048908 Bacteria 24188
477 Ga0496105_0077621 3300048908 Bacteria 2743
478 Ga0496105_0227609 3300048908 Bacteria 1516
479 Ga0496107_0595721 3300048910 Unclassified 817
480 Ga0496108_0026130 3300048911 Bacteria 4816
481 Ga0496109_0094912 3300048912 Unclassified 2761
482 Ga0496109_0166095 3300048912 Bacteria 2069
483 Ga0496110_0026711 3300048913 Unclassified 4944
484 Ga0496110_0096398 3300048913 Unclassified 2651
485 Ga0496111_0000490 3300048914 Bacteria 20373
486 Ga0496111_0266855 3300048914 Bacteria 1270
487 Ga0496111_0503889 3300048914 Unclassified 891
488 Ga0496112_0023092 3300048915 Bacteria 5937
489 Ga0496112_0088443 3300048915 Bacteria 3065
490 Ga0496112_0091943 3300048915 Bacteria 3003
491 Ga0496112_0189446 3300048915 Bacteria 2019
492 Ga0496112_0306756 3300048915 Bacteria 1532
493 Ga0496113_0004714 3300048916 Bacteria 8417
494 Ga0496113_0115375 3300048916 Bacteria 2095
495 Ga0496113_0144427 3300048916 Unclassified 1873
496 Ga0496115_0166808 3300048918 Bacteria 1821
497 Ga0496126_0000093 3300048929 Bacteria 208741
498 Ga0496126_0000191 3300048929 Bacteria 137108
499 Ga0496126_0001093 3300048929 Bacteria 45526
500 Ga0496126_0002173 3300048929 Bacteria 27234
501 Ga0496126_0003783 3300048929 Bacteria 18780
502 Ga0496126_0640760 3300048929 Unclassified 833
503 Ga0495682_0020941 3300049460 Bacteria 2452
504 Ga0501031_0026645 3300049568 Bacteria 3768
505 Ga0501032_0002834 3300049569 Bacteria 13488
506 Ga0501032_0262515 3300049569 Bacteria 1120
507 Ga0501034_0004264 3300049571 Bacteria 15952
508 Ga0501037_0001771 3300049573 Bacteria 15679
509 Ga0501037_0266183 3300049573 Bacteria 1197
510 Ga0501038_0000845 3300049574 Bacteria 27143
511 Ga0501038_0245752 3300049574 Bacteria 1419
512 Ga0501039_0267728 3300049575 Bacteria 1343
513 Ga0501043_0002287 3300049579 Bacteria 16248
514 Ga0501046_0004323 3300049580 Bacteria 12931
515 Ga0501047_0001407 3300049581 Bacteria 23589
516 Ga0501047_0208206 3300049581 Bacteria 1815
517 Ga0501073_0009655 3300049589 Bacteria 7115
518 Ga0501073_0035998 3300049589 Bacteria 3518
519 Ga0501080_0009311 3300049742 Bacteria 8955
520 Ga0501035_0005515 3300049822 Bacteria 11956
521 Ga0501035_0182020 3300049822 Bacteria 1810
522 Ga0501044_0002709 3300049823 Bacteria 20135
523 nmdc:mga05p37_201588_c1 3300050507 Bacteria 2409
524 nmdc:mga0n895_111564_c1 3300050512 Unclassified 2751
525 nmdc:mga08x19_14605_c1 3300050514 Bacteria 4765
526 nmdc:mga08x19_374380_c1 3300050514 Bacteria 997
527 nmdc:mga08x19_38896_c1 3300050514 Bacteria 3022
528 Ga0500643_031044 3300053087 Bacteria 1632
529 Ga0500651_0000008 3300053093 Bacteria 287738
530 Ga0500595_000187 3300053119 Bacteria 42083
531 Ga0501084_0030844 3300054114 Bacteria 4482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0020982 Ga0496104_0020982_810_1583 239
2 3300048915 Ga0496112_0023092 Ga0496112_0023092_4068_4841 239
3 3300025261 Ga0209233_1003364 Ga0209233_10033644 242
4 3300046462 Ga0495651_0196009 Ga0495651_0196009_17_754 242
5 3300045976 Ga0466967_0695544 Ga0466967_0695544_217_975 244
6 3300009093 Ga0105240_10001235 Ga0105240_1000123521 245
7 3300009093 Ga0105240_10014142 Ga0105240_100141424 245
8 3300009545 Ga0105237_10012226 Ga0105237_100122266 245
9 3300009551 Ga0105238_10012260 Ga0105238_100122603 245
10 3300013102 Ga0157371_10142235 Ga0157371_101422353 245
11 3300013104 Ga0157370_10072305 Ga0157370_100723053 245
12 3300013307 Ga0157372_10011458 Ga0157372_100114586 245
13 3300025986 Ga0207658_10574196 Ga0207658_105741961 245
14 3300046459 Ga0495629_0180025 Ga0495629_0180025_357_1103 245
15 3300046463 Ga0495653_0024553 Ga0495653_0024553_2914_3660 245
16 3300046473 Ga0495582_0076700 Ga0495582_0076700_99_845 245
17 3300046476 Ga0495662_0002704 Ga0495662_0002704_4439_5185 245
18 3300046499 Ga0495594_0002013 Ga0495594_0002013_7283_8029 245
19 3300046516 Ga0495628_0064660 Ga0495628_0064660_73_819 245
20 3300046529 Ga0495652_0049688 Ga0495652_0049688_862_1608 245
21 3300046531 Ga0495665_0019314 Ga0495665_0019314_1823_2569 245
22 3300046536 Ga0495587_0041236 Ga0495587_0041236_1268_2014 245
23 3300046538 Ga0495609_0161679 Ga0495609_0161679_92_838 245
24 3300046543 Ga0495645_0084570 Ga0495645_0084570_1261_2007 245
25 3300046557 Ga0495622_0032861 Ga0495622_0032861_1006_1752 245
26 3300046559 Ga0495667_0093843 Ga0495667_0093843_337_1083 245
27 3300046642 Ga0495634_0008386 Ga0495634_0008386_512_1258 245
28 3300046664 Ga0495659_0029110 Ga0495659_0029110_675_1421 245
29 3300046678 Ga0495599_0066149 Ga0495599_0066149_562_1308 245
30 3300046689 Ga0495613_0058072 Ga0495613_0058072_880_1626 245
31 3300046809 Ga0495600_0001535 Ga0495600_0001535_4360_5106 245
32 3300047315 Ga0495581_0003151 Ga0495581_0003151_1863_2609 245
33 3300047319 Ga0495674_0233755 Ga0495674_0233755_298_1044 245
34 3300047322 Ga0495680_0044789 Ga0495680_0044789_2355_3101 245
35 3300047444 Ga0495675_0296196 Ga0495675_0296196_45_791 245
36 3300047471 Ga0495684_0055408 Ga0495684_0055408_2246_2992 245
37 3300047471 Ga0495684_0087056 Ga0495684_0087056_529_1275 245
38 3300047472 Ga0495686_0024612 Ga0495686_0024612_1334_2170 245
39 3300048907 Ga0496104_0785562 Ga0496104_0785562_73_819 245
40 3300048929 Ga0496126_0640760 Ga0496126_0640760_79_816 245
41 3300005563 Ga0068855_100037522 Ga0068855_1000375226 246
42 3300005563 Ga0068855_100090590 Ga0068855_1000905901 246
43 3300005578 Ga0068854_100106515 Ga0068854_1001065152 246
44 3300005614 Ga0068856_100209104 Ga0068856_1002091042 246
45 3300005616 Ga0068852_100004648 Ga0068852_1000046486 246
46 3300005616 Ga0068852_100560529 Ga0068852_1005605291 246
47 3300009093 Ga0105240_10003079 Ga0105240_1000307915 246
48 3300009093 Ga0105240_10152462 Ga0105240_101524623 246
49 3300009545 Ga0105237_10194413 Ga0105237_101944133 246
50 3300009551 Ga0105238_10003571 Ga0105238_100035719 246
51 3300009551 Ga0105238_10134679 Ga0105238_101346792 246
52 3300013104 Ga0157370_10078802 Ga0157370_100788024 246
53 3300013105 Ga0157369_10077474 Ga0157369_100774744 246
54 3300013307 Ga0157372_10027551 Ga0157372_100275516 246
55 3300013307 Ga0157372_10091926 Ga0157372_100919262 246
56 3300025913 Ga0207695_10000804 Ga0207695_1000080418 246
57 3300025913 Ga0207695_10210599 Ga0207695_102105992 246
58 3300025929 Ga0207664_10194843 Ga0207664_101948432 246
59 3300025949 Ga0207667_10000538 Ga0207667_1000053810 246
60 3300025981 Ga0207640_10043549 Ga0207640_100435492 246
61 3300026142 Ga0207698_10008297 Ga0207698_100082976 246
62 3300026142 Ga0207698_10508631 Ga0207698_105086311 246
63 3300045976 Ga0466967_0609316 Ga0466967_0609316_107_862 246
64 3300005327 Ga0070658_10009641 Ga0070658_100096415 247
65 3300005327 Ga0070658_10024444 Ga0070658_100244442 247
66 3300005327 Ga0070658_10258483 Ga0070658_102584832 247
67 3300005339 Ga0070660_100012775 Ga0070660_1000127756 247
68 3300005339 Ga0070660_100049021 Ga0070660_1000490212 247
69 3300005344 Ga0070661_100054268 Ga0070661_1000542683 247
70 3300005530 Ga0070679_100037253 Ga0070679_1000372533 247
71 3300005539 Ga0068853_100030975 Ga0068853_1000309753 247
72 3300005563 Ga0068855_100007892 Ga0068855_1000078924 247
73 3300005616 Ga0068852_100148906 Ga0068852_1001489063 247
74 3300009551 Ga0105238_10008859 Ga0105238_100088592 247
75 3300009551 Ga0105238_10409069 Ga0105238_104090691 247
76 3300013105 Ga0157369_10010057 Ga0157369_100100575 247
77 3300013296 Ga0157374_10213067 Ga0157374_102130672 247
78 3300013307 Ga0157372_10012096 Ga0157372_100120964 247
79 3300025909 Ga0207705_10008017 Ga0207705_100080175 247
80 3300025919 Ga0207657_10014767 Ga0207657_100147671 247
81 3300025920 Ga0207649_10004392 Ga0207649_100043928 247
82 3300025921 Ga0207652_10040614 Ga0207652_100406142 247
83 3300025924 Ga0207694_10237382 Ga0207694_102373822 247
84 3300025932 Ga0207690_10132768 Ga0207690_101327682 247
85 3300025945 Ga0207679_10246486 Ga0207679_102464862 247
86 3300025949 Ga0207667_10044675 Ga0207667_100446754 247
87 3300026041 Ga0207639_10007682 Ga0207639_100076824 247
88 3300026142 Ga0207698_10126760 Ga0207698_101267602 247
89 3300025929 Ga0207664_10062609 Ga0207664_100626093 249
90 3300037466 Ga0395898_0199032 Ga0395898_0199032_582_1418 249
91 3300046472 Ga0495580_0327922 Ga0495580_0327922_54_830 249
92 3300046471 Ga0495650_0000029 Ga0495650_0000029_125582_126343 250
93 3300053087 Ga0500643_031044 Ga0500643_031044_162_923 250
94 3300021361 Ga0213872_10036642 Ga0213872_100366422 251
95 3300048929 Ga0496126_0002173 Ga0496126_0002173_20338_21096 251
96 3300048910 Ga0496107_0595721 Ga0496107_0595721_31_789 252
97 3300049573 Ga0501037_0001771 Ga0501037_0001771_1537_2307 252
98 3300049575 Ga0501039_0267728 Ga0501039_0267728_435_1205 252
99 3300049742 Ga0501080_0009311 Ga0501080_0009311_6951_7721 252
100 3300005435 Ga0070714_100058263 Ga0070714_1000582634 253
101 3300005436 Ga0070713_100010252 Ga0070713_1000102521 253
102 3300005437 Ga0070710_10425401 Ga0070710_104254011 253
103 3300005458 Ga0070681_10674690 Ga0070681_106746901 253
104 3300005536 Ga0070697_100114667 Ga0070697_1001146672 253
105 3300006028 Ga0070717_10114921 Ga0070717_101149212 253
106 3300006914 Ga0075436_100006391 Ga0075436_1000063919 253
107 3300006914 Ga0075436_100043592 Ga0075436_1000435922 253
108 3300013100 Ga0157373_10158566 Ga0157373_101585663 253
109 3300013104 Ga0157370_10123159 Ga0157370_101231593 253
110 3300013104 Ga0157370_10192381 Ga0157370_101923812 253
111 3300025898 Ga0207692_10246187 Ga0207692_102461872 253
112 3300025912 Ga0207707_10504461 Ga0207707_105044611 253
113 3300025921 Ga0207652_10301491 Ga0207652_103014912 253
114 3300025928 Ga0207700_10081445 Ga0207700_100814452 253
115 3300025929 Ga0207664_10017642 Ga0207664_100176422 253
116 3300037418 Ga0395900_0251721 Ga0395900_0251721_494_1267 253
117 3300037471 Ga0395905_0032992 Ga0395905_0032992_1176_1949 253
118 3300037471 Ga0395905_0101529 Ga0395905_0101529_1808_2581 253
119 3300046684 Ga0495669_0005797 Ga0495669_0005797_1007_1768 253
120 3300048905 Ga0496102_0512211 Ga0496102_0512211_169_948 253
121 3300050514 nmdc:mga08x19_14605_c1 nmdc:mga08x19_14605_c1_2453_3232 253
122 3300050514 nmdc:mga08x19_374380_c1 nmdc:mga08x19_374380_c1_97_876 253
123 3300005329 Ga0070683_100031861 Ga0070683_1000318612 254
124 3300005329 Ga0070683_100109110 Ga0070683_1001091103 254
125 3300005338 Ga0068868_100019387 Ga0068868_1000193875 254
126 3300005345 Ga0070692_10086510 Ga0070692_100865101 254
127 3300005435 Ga0070714_100065367 Ga0070714_1000653673 254
128 3300005435 Ga0070714_100194322 Ga0070714_1001943222 254
129 3300005436 Ga0070713_100205797 Ga0070713_1002057972 254
130 3300005436 Ga0070713_100487848 Ga0070713_1004878481 254
131 3300005439 Ga0070711_100026570 Ga0070711_1000265702 254
132 3300005439 Ga0070711_100308081 Ga0070711_1003080812 254
133 3300005458 Ga0070681_10203179 Ga0070681_102031791 254
134 3300005535 Ga0070684_100014368 Ga0070684_1000143684 254
135 3300005535 Ga0070684_100160153 Ga0070684_1001601533 254
136 3300005539 Ga0068853_100037552 Ga0068853_1000375523 254
137 3300005539 Ga0068853_100159694 Ga0068853_1001596942 254
138 3300005547 Ga0070693_100006969 Ga0070693_1000069694 254
139 3300005563 Ga0068855_100079747 Ga0068855_1000797474 254
140 3300005578 Ga0068854_100048369 Ga0068854_1000483694 254
141 3300005614 Ga0068856_100024943 Ga0068856_1000249431 254
142 3300005616 Ga0068852_100013376 Ga0068852_1000133765 254
143 3300005834 Ga0068851_10051566 Ga0068851_100515662 254
144 3300006173 Ga0070716_100059017 Ga0070716_1000590173 254
145 3300006175 Ga0070712_100431882 Ga0070712_1004318821 254
146 3300006871 Ga0075434_100111154 Ga0075434_1001111543 254
147 3300009093 Ga0105240_10131799 Ga0105240_101317994 254
148 3300009098 Ga0105245_10029968 Ga0105245_100299682 254
149 3300009098 Ga0105245_10181404 Ga0105245_101814042 254
150 3300009551 Ga0105238_10024665 Ga0105238_100246655 254
151 3300009551 Ga0105238_10031252 Ga0105238_100312525 254
152 3300010375 Ga0105239_10091987 Ga0105239_100919875 254
153 3300010375 Ga0105239_10377975 Ga0105239_103779752 254
154 3300013105 Ga0157369_10037540 Ga0157369_100375404 254
155 3300013296 Ga0157374_10148518 Ga0157374_101485183 254
156 3300025321 Ga0207656_10035881 Ga0207656_100358812 254
157 3300025906 Ga0207699_10448075 Ga0207699_104480751 254
158 3300025912 Ga0207707_10391626 Ga0207707_103916262 254
159 3300025912 Ga0207707_10404718 Ga0207707_104047182 254
160 3300025913 Ga0207695_10169861 Ga0207695_101698613 254
161 3300025915 Ga0207693_10072137 Ga0207693_100721372 254
162 3300025916 Ga0207663_10035771 Ga0207663_100357712 254
163 3300025916 Ga0207663_10363003 Ga0207663_103630032 254
164 3300025924 Ga0207694_10051295 Ga0207694_100512954 254
165 3300025927 Ga0207687_10147516 Ga0207687_101475163 254
166 3300025927 Ga0207687_10556714 Ga0207687_105567141 254
167 3300025928 Ga0207700_10029536 Ga0207700_100295364 254
168 3300025928 Ga0207700_10111035 Ga0207700_101110352 254
169 3300025929 Ga0207664_10254327 Ga0207664_102543272 254
170 3300025939 Ga0207665_10028881 Ga0207665_100288813 254
171 3300025944 Ga0207661_10012161 Ga0207661_100121614 254
172 3300025949 Ga0207667_10025095 Ga0207667_100250956 254
173 3300026023 Ga0207677_10064948 Ga0207677_100649482 254
174 3300026041 Ga0207639_10016113 Ga0207639_100161132 254
175 3300026041 Ga0207639_10065535 Ga0207639_100655354 254
176 3300026116 Ga0207674_10137252 Ga0207674_101372522 254
177 3300026142 Ga0207698_10011913 Ga0207698_100119134 254
178 3300026142 Ga0207698_10788343 Ga0207698_107883431 254
179 3300035116 Ga0373945_0001513 Ga0373945_0001513_5226_5990 254
180 3300035410 Ga0373924_0000059 Ga0373924_0000059_27544_28308 254
181 3300035695 Ga0373927_0029166 Ga0373927_0029166_2345_3109 254
182 3300036401 Ga0373937_0000408 Ga0373937_0000408_7929_8693 254
183 3300037068 Ga0373925_0020358 Ga0373925_0020358_2796_3560 254
184 3300037471 Ga0395905_0018442 Ga0395905_0018442_1621_2388 254
185 3300037471 Ga0395905_0035263 Ga0395905_0035263_126_893 254
186 3300045049 Ga0466959_0014979 Ga0466959_0014979_4349_5113 254
187 3300046462 Ga0495651_0049678 Ga0495651_0049678_2272_3036 254
188 3300046462 Ga0495651_0275500 Ga0495651_0275500_354_1118 254
189 3300046475 Ga0495639_0016207 Ga0495639_0016207_151_915 254
190 3300046499 Ga0495594_0091363 Ga0495594_0091363_30_794 254
191 3300046679 Ga0495623_0224509 Ga0495623_0224509_277_1041 254
192 3300046684 Ga0495669_0018724 Ga0495669_0018724_1385_2149 254
193 3300046809 Ga0495600_0319121 Ga0495600_0319121_196_960 254
194 3300048905 Ga0496102_0266559 Ga0496102_0266559_595_1359 254
195 3300048906 Ga0496103_0010051 Ga0496103_0010051_2726_3490 254
196 3300048907 Ga0496104_0206936 Ga0496104_0206936_547_1311 254
197 3300048908 Ga0496105_0000590 Ga0496105_0000590_10390_11154 254
198 3300048913 Ga0496110_0026711 Ga0496110_0026711_2460_3224 254
199 3300048914 Ga0496111_0000490 Ga0496111_0000490_5295_6059 254
200 3300048915 Ga0496112_0189446 Ga0496112_0189446_108_872 254
201 3300048916 Ga0496113_0115375 Ga0496113_0115375_843_1607 254
202 3300050512 nmdc:mga0n895_111564_c1 nmdc:mga0n895_111564_c1_1410_2174 254
203 3300004799 Ga0058863_10011887 Ga0058863_100118873 255
204 3300004800 Ga0058861_10043048 Ga0058861_100430482 255
205 3300004803 Ga0058862_10220838 Ga0058862_102208383 255
206 3300005336 Ga0070680_100031806 Ga0070680_1000318063 255
207 3300005337 Ga0070682_100007377 Ga0070682_1000073775 255
208 3300005458 Ga0070681_10043372 Ga0070681_100433723 255
209 3300005458 Ga0070681_10073266 Ga0070681_100732663 255
210 3300005458 Ga0070681_10158617 Ga0070681_101586173 255
211 3300005530 Ga0070679_100103720 Ga0070679_1001037202 255
212 3300005539 Ga0068853_100262814 Ga0068853_1002628143 255
213 3300005563 Ga0068855_100310312 Ga0068855_1003103122 255
214 3300005614 Ga0068856_100035422 Ga0068856_1000354223 255
215 3300009093 Ga0105240_10240786 Ga0105240_102407863 255
216 3300009174 Ga0105241_10563643 Ga0105241_105636431 255
217 3300009545 Ga0105237_10273624 Ga0105237_102736242 255
218 3300013100 Ga0157373_10029579 Ga0157373_100295792 255
219 3300013104 Ga0157370_10053172 Ga0157370_100531723 255
220 3300013104 Ga0157370_10112312 Ga0157370_101123123 255
221 3300013105 Ga0157369_10185635 Ga0157369_101856352 255
222 3300013105 Ga0157369_10347084 Ga0157369_103470842 255
223 3300025912 Ga0207707_10001569 Ga0207707_100015694 255
224 3300025912 Ga0207707_10031219 Ga0207707_100312194 255
225 3300025912 Ga0207707_10165395 Ga0207707_101653952 255
226 3300025913 Ga0207695_10281775 Ga0207695_102817752 255
227 3300025917 Ga0207660_10100334 Ga0207660_101003342 255
228 3300025917 Ga0207660_10121114 Ga0207660_101211143 255
229 3300025921 Ga0207652_10009357 Ga0207652_100093576 255
230 3300025921 Ga0207652_10080949 Ga0207652_100809492 255
231 3300025921 Ga0207652_10637729 Ga0207652_106377291 255
232 3300025949 Ga0207667_10262409 Ga0207667_102624091 255
233 3300026041 Ga0207639_10231889 Ga0207639_102318892 255
234 3300037466 Ga0395898_0117243 Ga0395898_0117243_1345_2115 255
235 3300038443 Ga0395901_0298047 Ga0395901_0298047_263_1033 255
236 3300045976 Ga0466967_0677640 Ga0466967_0677640_11_781 255
237 3300048915 Ga0496112_0091943 Ga0496112_0091943_1043_1816 255
238 3300014325 Ga0163163_10014577 Ga0163163_100145776 256
239 3300044694 Ga0466963_0044187 Ga0466963_0044187_2004_2819 256
240 3300044842 Ga0466957_0000260 Ga0466957_0000260_6884_7654 256
241 3300045836 Ga0466958_0052042 Ga0466958_0052042_1636_2406 256
242 3300046462 Ga0495651_0009116 Ga0495651_0009116_3159_3929 256
243 3300047317 Ga0495604_0035821 Ga0495604_0035821_103_903 256
244 3300047317 Ga0495604_0181146 Ga0495604_0181146_373_1143 256
245 3300047444 Ga0495675_0011199 Ga0495675_0011199_3044_3844 256
246 3300047444 Ga0495675_0082427 Ga0495675_0082427_1028_1828 256
247 3300031238 Ga0265332_10018877 Ga0265332_100188772 257
248 3300031239 Ga0265328_10056903 Ga0265328_100569032 257
249 3300031241 Ga0265325_10001599 Ga0265325_1000159914 257
250 3300031247 Ga0265340_10000590 Ga0265340_100005908 257
251 3300031250 Ga0265331_10020545 Ga0265331_100205453 257
252 3300031251 Ga0265327_10048045 Ga0265327_100480451 257
253 3300031344 Ga0265316_10008885 Ga0265316_100088854 257
254 3300035083 Ga0373926_0012764 Ga0373926_0012764_66_839 257
255 3300035089 Ga0373944_0034888 Ga0373944_0034888_650_1423 257
256 3300035113 Ga0373936_0004381 Ga0373936_0004381_3744_4517 257
257 3300035170 Ga0373943_0013220 Ga0373943_0013220_1010_1783 257
258 3300035692 Ga0373935_0003805 Ga0373935_0003805_6276_7049 257
259 3300035692 Ga0373935_0026176 Ga0373935_0026176_1772_2545 257
260 3300035692 Ga0373935_0077297 Ga0373935_0077297_17_790 257
261 3300035695 Ga0373927_0006966 Ga0373927_0006966_4958_5731 257
262 3300035725 Ga0373947_0008862 Ga0373947_0008862_4267_5040 257
263 3300035725 Ga0373947_0011661 Ga0373947_0011661_1765_2538 257
264 3300037068 Ga0373925_0018521 Ga0373925_0018521_2346_3119 257
265 3300046472 Ga0495580_0031276 Ga0495580_0031276_2309_3082 257
266 3300046472 Ga0495580_0115857 Ga0495580_0115857_582_1355 257
267 3300046473 Ga0495582_0347273 Ga0495582_0347273_24_797 257
268 3300046559 Ga0495667_0195659 Ga0495667_0195659_183_956 257
269 3300046663 Ga0495635_0214844 Ga0495635_0214844_507_1280 257
270 3300046690 Ga0495624_0106983 Ga0495624_0106983_624_1397 257
271 3300047315 Ga0495581_0081019 Ga0495581_0081019_848_1621 257
272 3300047472 Ga0495686_0004468 Ga0495686_0004468_5831_6667 257
273 3300047673 Ga0495593_0036788 Ga0495593_0036788_1335_2108 257
274 3300048908 Ga0496105_0077621 Ga0496105_0077621_1374_2147 257
275 3300048914 Ga0496111_0266855 Ga0496111_0266855_80_853 257
276 3300048916 Ga0496113_0004714 Ga0496113_0004714_3022_3795 257
277 3300005336 Ga0070680_100033409 Ga0070680_1000334094 258
278 3300005434 Ga0070709_10019087 Ga0070709_100190873 258
279 3300005436 Ga0070713_100087268 Ga0070713_1000872683 258
280 3300005458 Ga0070681_10009446 Ga0070681_100094466 258
281 3300005530 Ga0070679_100002283 Ga0070679_10000228313 258
282 3300005536 Ga0070697_100014663 Ga0070697_1000146635 258
283 3300005545 Ga0070695_100018465 Ga0070695_1000184652 258
284 3300005546 Ga0070696_100048934 Ga0070696_1000489343 258
285 3300006173 Ga0070716_100221623 Ga0070716_1002216232 258
286 3300006914 Ga0075436_100015574 Ga0075436_1000155743 258
287 3300009147 Ga0114129_10106555 Ga0114129_101065552 258
288 3300013105 Ga0157369_10000442 Ga0157369_1000044234 258
289 3300013296 Ga0157374_10121862 Ga0157374_101218623 258
290 3300014325 Ga0163163_10130084 Ga0163163_101300842 258
291 3300014969 Ga0157376_10107877 Ga0157376_101078774 258
292 3300021358 Ga0213873_10026075 Ga0213873_100260752 258
293 3300021377 Ga0213874_10006679 Ga0213874_100066793 258
294 3300025906 Ga0207699_10089170 Ga0207699_100891702 258
295 3300025912 Ga0207707_10037731 Ga0207707_100377315 258
296 3300025921 Ga0207652_10022473 Ga0207652_100224734 258
297 3300025939 Ga0207665_10178333 Ga0207665_101783333 258
298 3300025939 Ga0207665_10250815 Ga0207665_102508152 258
299 3300028800 Ga0265338_10038803 Ga0265338_100388034 258
300 3300031241 Ga0265325_10057004 Ga0265325_100570042 258
301 3300031247 Ga0265340_10015596 Ga0265340_100155964 258
302 3300031250 Ga0265331_10080910 Ga0265331_100809101 258
303 3300031344 Ga0265316_10062596 Ga0265316_100625961 258
304 3300039450 Ga0436363_1443836 Ga0436363_1443836_6424_7254 258
305 3300039453 Ga0436362_0930676 Ga0436362_0930676_623_1453 258
306 3300042876 Ga0451577_0523429 Ga0451577_0523429_91_1011 258
307 3300045976 Ga0466967_0365171 Ga0466967_0365171_409_1239 258
308 3300050507 nmdc:mga05p37_201588_c1 nmdc:mga05p37_201588_c1_581_1369 258
309 3300050514 nmdc:mga08x19_38896_c1 nmdc:mga08x19_38896_c1_17_847 258
310 iso_pu_bacteria 2884215851 2884216953 259
311 3300005458 Ga0070681_10147684 Ga0070681_101476843 260
312 3300025912 Ga0207707_10145211 Ga0207707_101452112 260
313 3300031548 Ga0307408_100020476 Ga0307408_1000204764 260
314 3300031824 Ga0307413_10066196 Ga0307413_100661961 260
315 3300031901 Ga0307406_10279894 Ga0307406_102798942 260
316 3300031903 Ga0307407_10052077 Ga0307407_100520773 260
317 3300031995 Ga0307409_100006808 Ga0307409_1000068085 260
318 3300032002 Ga0307416_100149218 Ga0307416_1001492182 260
319 3300032126 Ga0307415_100084395 Ga0307415_1000843952 260
320 3300039450 Ga0436363_0707383 Ga0436363_0707383_6712_7497 260
321 3300003323 rootH1_10332512 rootH1_103325121 261
322 3300005339 Ga0070660_100299420 Ga0070660_1002994201 261
323 3300005364 Ga0070673_100291137 Ga0070673_1002911372 261
324 3300005456 Ga0070678_100260326 Ga0070678_1002603262 261
325 3300005539 Ga0068853_100421609 Ga0068853_1004216092 261
326 3300005564 Ga0070664_100087569 Ga0070664_1000875693 261
327 3300005577 Ga0068857_100055905 Ga0068857_1000559054 261
328 3300005618 Ga0068864_100240106 Ga0068864_1002401061 261
329 3300005842 Ga0068858_100315072 Ga0068858_1003150722 261
330 3300009177 Ga0105248_10876540 Ga0105248_108765401 261
331 3300009553 Ga0105249_10027220 Ga0105249_100272206 261
332 3300013104 Ga0157370_10445656 Ga0157370_104456561 261
333 3300014325 Ga0163163_10111459 Ga0163163_101114594 261
334 3300025924 Ga0207694_10011356 Ga0207694_100113562 261
335 3300025925 Ga0207650_10318291 Ga0207650_103182912 261
336 3300025945 Ga0207679_10074055 Ga0207679_100740552 261
337 3300025949 Ga0207667_10046020 Ga0207667_100460201 261
338 3300025960 Ga0207651_10440503 Ga0207651_104405031 261
339 3300025961 Ga0207712_10060293 Ga0207712_100602931 261
340 3300026035 Ga0207703_10206680 Ga0207703_102066802 261
341 3300026088 Ga0207641_10094207 Ga0207641_100942072 261
342 3300026095 Ga0207676_10066636 Ga0207676_100666362 261
343 3300026116 Ga0207674_10070239 Ga0207674_100702393 261
344 3300035724 Ga0373933_0156249 Ga0373933_0156249_563_1363 261
345 3300036401 Ga0373937_0222236 Ga0373937_0222236_856_1656 261
346 3300046535 Ga0495586_0222484 Ga0495586_0222484_95_895 261
347 3300046684 Ga0495669_0008085 Ga0495669_0008085_2749_3549 261
348 3300046684 Ga0495669_0130409 Ga0495669_0130409_188_988 261
349 3300048912 Ga0496109_0166095 Ga0496109_0166095_504_1304 261
350 3300048915 Ga0496112_0088443 Ga0496112_0088443_871_1671 261
351 3300054114 Ga0501084_0030844 Ga0501084_0030844_1018_1806 261
352 3300005335 Ga0070666_10194344 Ga0070666_101943442 262
353 3300005355 Ga0070671_100006455 Ga0070671_1000064552 262
354 3300005548 Ga0070665_100021347 Ga0070665_1000213474 262
355 3300005618 Ga0068864_100016174 Ga0068864_1000161745 262
356 3300005841 Ga0068863_100015404 Ga0068863_1000154047 262
357 3300009093 Ga0105240_10864438 Ga0105240_108644382 262
358 3300009177 Ga0105248_10014521 Ga0105248_100145218 262
359 3300009177 Ga0105248_10110100 Ga0105248_101101003 262
360 3300009545 Ga0105237_10774566 Ga0105237_107745661 262
361 3300013296 Ga0157374_10078895 Ga0157374_100788953 262
362 3300013306 Ga0163162_10195832 Ga0163162_101958323 262
363 3300013306 Ga0163162_10359752 Ga0163162_103597521 262
364 3300014325 Ga0163163_10125578 Ga0163163_101255782 262
365 3300014969 Ga0157376_10015169 Ga0157376_100151696 262
366 3300014969 Ga0157376_10071351 Ga0157376_100713512 262
367 3300025903 Ga0207680_10125310 Ga0207680_101253103 262
368 3300025914 Ga0207671_10151431 Ga0207671_101514312 262
369 3300025919 Ga0207657_10119658 Ga0207657_101196582 262
370 3300025931 Ga0207644_10036539 Ga0207644_100365394 262
371 3300025941 Ga0207711_10122225 Ga0207711_101222251 262
372 3300025972 Ga0207668_10033030 Ga0207668_100330302 262
373 3300028379 Ga0268266_10167249 Ga0268266_101672492 262
374 3300033180 Ga0307510_10057512 Ga0307510_100575125 262
375 3300046460 Ga0495638_0147454 Ga0495638_0147454_424_1227 262
376 3300046472 Ga0495580_0044017 Ga0495580_0044017_2100_2903 262
377 3300046477 Ga0495664_0020741 Ga0495664_0020741_1415_2218 262
378 3300046492 Ga0495585_0043436 Ga0495585_0043436_639_1442 262
379 3300046499 Ga0495594_0035442 Ga0495594_0035442_1816_2619 262
380 3300046506 Ga0495583_0067044 Ga0495583_0067044_211_1014 262
381 3300046523 Ga0495644_0000316 Ga0495644_0000316_16859_17662 262
382 3300046524 Ga0495648_0175588 Ga0495648_0175588_269_1072 262
383 3300046558 Ga0495633_0039548 Ga0495633_0039548_1360_2163 262
384 3300046648 Ga0495611_0096048 Ga0495611_0096048_555_1358 262
385 3300046660 Ga0495625_0081381 Ga0495625_0081381_970_1773 262
386 3300046660 Ga0495625_0081636 Ga0495625_0081636_520_1323 262
387 3300046665 Ga0495661_0049964 Ga0495661_0049964_591_1394 262
388 3300046680 Ga0495646_0048054 Ga0495646_0048054_686_1489 262
389 3300046684 Ga0495669_0029510 Ga0495669_0029510_1513_2316 262
390 3300047317 Ga0495604_0044413 Ga0495604_0044413_124_927 262
391 3300048908 Ga0496105_0227609 Ga0496105_0227609_685_1488 262
392 3300048929 Ga0496126_0001093 Ga0496126_0001093_36940_37743 262
393 3300049460 Ga0495682_0020941 Ga0495682_0020941_1126_1929 262
394 3300053093 Ga0500651_0000008 Ga0500651_0000008_127141_127944 262
395 3300053119 Ga0500595_000187 Ga0500595_000187_22813_23616 262
396 3300005548 Ga0070665_100033876 Ga0070665_1000338763 263
397 3300025941 Ga0207711_10318901 Ga0207711_103189011 263
398 3300028379 Ga0268266_10001615 Ga0268266_100016152 263
399 3300028379 Ga0268266_10001974 Ga0268266_1000197411 263
400 3300033180 Ga0307510_10113543 Ga0307510_101135433 263
401 3300046471 Ga0495650_0008610 Ga0495650_0008610_3470_4276 263
402 3300046471 Ga0495650_0102368 Ga0495650_0102368_205_1011 263
403 3300046660 Ga0495625_0001024 Ga0495625_0001024_2338_3144 263
404 3300047320 Ga0495672_0009742 Ga0495672_0009742_1712_2518 263
405 3300049568 Ga0501031_0026645 Ga0501031_0026645_612_1415 263
406 3300049569 Ga0501032_0002834 Ga0501032_0002834_2277_3080 263
407 3300049569 Ga0501032_0262515 Ga0501032_0262515_64_867 263
408 3300049571 Ga0501034_0004264 Ga0501034_0004264_7931_8734 263
409 3300049574 Ga0501038_0000845 Ga0501038_0000845_7327_8130 263
410 3300049574 Ga0501038_0245752 Ga0501038_0245752_233_1036 263
411 3300049579 Ga0501043_0002287 Ga0501043_0002287_6933_7736 263
412 3300049580 Ga0501046_0004323 Ga0501046_0004323_6506_7309 263
413 3300049581 Ga0501047_0001407 Ga0501047_0001407_10469_11272 263
414 3300049589 Ga0501073_0009655 Ga0501073_0009655_5461_6264 263
415 3300049822 Ga0501035_0005515 Ga0501035_0005515_3117_3920 263
416 3300049822 Ga0501035_0182020 Ga0501035_0182020_582_1385 263
417 3300049823 Ga0501044_0002709 Ga0501044_0002709_3891_4694 263
418 3300005327 Ga0070658_10182979 Ga0070658_101829792 264
419 3300005339 Ga0070660_100138221 Ga0070660_1001382213 264
420 3300005530 Ga0070679_100209546 Ga0070679_1002095462 264
421 3300005563 Ga0068855_100047543 Ga0068855_1000475435 264
422 3300005578 Ga0068854_100232696 Ga0068854_1002326962 264
423 3300013104 Ga0157370_10025296 Ga0157370_100252964 264
424 3300013307 Ga0157372_10066432 Ga0157372_100664322 264
425 3300020069 Ga0197907_10699666 Ga0197907_106996662 264
426 3300025909 Ga0207705_10321203 Ga0207705_103212031 264
427 3300025909 Ga0207705_10372386 Ga0207705_103723861 264
428 3300025981 Ga0207640_10356682 Ga0207640_103566822 264
429 3300026067 Ga0207678_10002077 Ga0207678_100020776 264
430 3300045976 Ga0466967_0223123 Ga0466967_0223123_146_973 264
431 3300005327 Ga0070658_10000004 Ga0070658_10000004169 265
432 3300005563 Ga0068855_100062699 Ga0068855_1000626992 265
433 3300005614 Ga0068856_100608136 Ga0068856_1006081362 265
434 3300025909 Ga0207705_10000024 Ga0207705_10000024149 265
435 3300025909 Ga0207705_10032417 Ga0207705_100324172 265
436 3300025949 Ga0207667_10001884 Ga0207667_1000188423 265
437 3300048907 Ga0496104_0000648 Ga0496104_0000648_12399_13214 265
438 3300003323 rootH1_10365739 rootH1_103657393 266
439 3300005983 Ga0081540_1006852 Ga0081540_10068524 266
440 3300014969 Ga0157376_10019146 Ga0157376_100191463 266
441 3300039438 Ga0436360_0105677 Ga0436360_0105677_218_1042 266
442 3300048929 Ga0496126_0000093 Ga0496126_0000093_110748_111581 266
443 3300048929 Ga0496126_0000191 Ga0496126_0000191_111492_112307 266
444 3300005327 Ga0070658_10027091 Ga0070658_100270912 267
445 3300005327 Ga0070658_10031393 Ga0070658_100313932 267
446 3300005329 Ga0070683_100026850 Ga0070683_1000268504 267
447 3300005336 Ga0070680_100069983 Ga0070680_1000699832 267
448 3300005339 Ga0070660_100014364 Ga0070660_1000143643 267
449 3300005339 Ga0070660_100123829 Ga0070660_1001238291 267
450 3300005341 Ga0070691_10072105 Ga0070691_100721051 267
451 3300005344 Ga0070661_100042798 Ga0070661_1000427982 267
452 3300005345 Ga0070692_10336904 Ga0070692_103369041 267
453 3300005366 Ga0070659_100000601 Ga0070659_1000006019 267
454 3300005458 Ga0070681_10040779 Ga0070681_100407795 267
455 3300005458 Ga0070681_10379564 Ga0070681_103795641 267
456 3300005530 Ga0070679_100058910 Ga0070679_1000589103 267
457 3300005535 Ga0070684_100072207 Ga0070684_1000722074 267
458 3300005539 Ga0068853_100000100 Ga0068853_10000010029 267
459 3300005539 Ga0068853_100048137 Ga0068853_1000481373 267
460 3300005548 Ga0070665_100054614 Ga0070665_1000546142 267
461 3300005563 Ga0068855_100087189 Ga0068855_1000871892 267
462 3300005563 Ga0068855_100262295 Ga0068855_1002622952 267
463 3300005564 Ga0070664_100067129 Ga0070664_1000671293 267
464 3300005578 Ga0068854_100000074 Ga0068854_10000007420 267
465 3300005578 Ga0068854_100287006 Ga0068854_1002870062 267
466 3300009174 Ga0105241_10261665 Ga0105241_102616652 267
467 3300013100 Ga0157373_10142761 Ga0157373_101427612 267
468 3300013104 Ga0157370_10040457 Ga0157370_100404575 267
469 3300013307 Ga0157372_10046707 Ga0157372_100467074 267
470 3300020077 Ga0206351_10543794 Ga0206351_105437943 267
471 3300020080 Ga0206350_10305681 Ga0206350_103056812 267
472 3300021361 Ga0213872_10001885 Ga0213872_100018858 267
473 3300022467 Ga0224712_10038652 Ga0224712_100386523 267
474 3300025904 Ga0207647_10011377 Ga0207647_100113774 267
475 3300025909 Ga0207705_10004909 Ga0207705_100049095 267
476 3300025909 Ga0207705_10091553 Ga0207705_100915532 267
477 3300025909 Ga0207705_10227930 Ga0207705_102279302 267
478 3300025912 Ga0207707_10139693 Ga0207707_101396933 267
479 3300025912 Ga0207707_10196614 Ga0207707_101966141 267
480 3300025912 Ga0207707_10258594 Ga0207707_102585942 267
481 3300025913 Ga0207695_10025139 Ga0207695_100251394 267
482 3300025913 Ga0207695_10043943 Ga0207695_100439434 267
483 3300025914 Ga0207671_10102488 Ga0207671_101024881 267
484 3300025917 Ga0207660_10019212 Ga0207660_100192125 267
485 3300025919 Ga0207657_10001844 Ga0207657_100018445 267
486 3300025919 Ga0207657_10050629 Ga0207657_100506293 267
487 3300025921 Ga0207652_10007088 Ga0207652_100070883 267
488 3300025921 Ga0207652_10199627 Ga0207652_101996272 267
489 3300025924 Ga0207694_10007068 Ga0207694_100070683 267
490 3300025932 Ga0207690_10000389 Ga0207690_100003897 267
491 3300025932 Ga0207690_10165343 Ga0207690_101653432 267
492 3300025944 Ga0207661_10010698 Ga0207661_100106984 267
493 3300025945 Ga0207679_10114327 Ga0207679_101143273 267
494 3300025949 Ga0207667_10111220 Ga0207667_101112204 267
495 3300025981 Ga0207640_10000010 Ga0207640_10000010189 267
496 3300026041 Ga0207639_10000023 Ga0207639_10000023169 267
497 3300026041 Ga0207639_10021322 Ga0207639_100213224 267
498 3300026067 Ga0207678_10003233 Ga0207678_100032339 267
499 3300026067 Ga0207678_10008839 Ga0207678_100088393 267
500 3300026067 Ga0207678_10122710 Ga0207678_101227102 267
501 3300026116 Ga0207674_10001311 Ga0207674_100013114 267
502 3300028379 Ga0268266_10063331 Ga0268266_100633312 267
503 3300037418 Ga0395900_0801027 Ga0395900_0801027_11_823 267
504 3300037466 Ga0395898_0263398 Ga0395898_0263398_798_1610 267
505 3300039438 Ga0436360_0366267 Ga0436360_0366267_1175_1978 267
506 3300039438 Ga0436360_0505146 Ga0436360_0505146_630_1433 267
507 3300039447 Ga0436361_0330933 Ga0436361_0330933_2050_2898 267
508 3300039447 Ga0436361_0861091 Ga0436361_0861091_2231_3034 267
509 3300039447 Ga0436361_0889427 Ga0436361_0889427_776_1579 267
510 3300049573 Ga0501037_0266183 Ga0501037_0266183_10_867 267
511 3300049581 Ga0501047_0208206 Ga0501047_0208206_76_933 267
512 3300049589 Ga0501073_0035998 Ga0501073_0035998_1697_2554 267
513 3300000546 LJNas_1001321 LJNas_10013213 268
514 3300009177 Ga0105248_10627790 Ga0105248_106277901 268
515 3300013105 Ga0157369_10257396 Ga0157369_102573963 268
516 3300013296 Ga0157374_10105455 Ga0157374_101054551 268
517 3300014325 Ga0163163_10032768 Ga0163163_100327686 268
518 3300025904 Ga0207647_10024120 Ga0207647_100241202 268
519 3300039450 Ga0436363_1127254 Ga0436363_1127254_164_970 268
520 3300045836 Ga0466958_0157813 Ga0466958_0157813_562_1368 268
521 3300045976 Ga0466967_0881872 Ga0466967_0881872_49_855 268
522 3300048903 Ga0496100_0054934 Ga0496100_0054934_1684_2490 268
523 3300048905 Ga0496102_0061394 Ga0496102_0061394_107_913 268
524 3300048907 Ga0496104_0190632 Ga0496104_0190632_375_1181 268
525 3300048911 Ga0496108_0026130 Ga0496108_0026130_1872_2678 268
526 3300048912 Ga0496109_0094912 Ga0496109_0094912_271_1077 268
527 3300048913 Ga0496110_0096398 Ga0496110_0096398_1632_2438 268
528 3300048914 Ga0496111_0503889 Ga0496111_0503889_50_856 268
529 3300048915 Ga0496112_0306756 Ga0496112_0306756_550_1356 268
530 3300048916 Ga0496113_0144427 Ga0496113_0144427_889_1695 268
531 3300048918 Ga0496115_0166808 Ga0496115_0166808_727_1533 268
532 3300048929 Ga0496126_0003783 Ga0496126_0003783_3261_4067 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

50

155

0.92

PF08448

PAS_4

PAS fold

184

291

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rdm-assembly1.cif.gz_A crystal structure of response regulator receiver protein from sinorhizobium medicae wsm419 0.8935 20 131
3q15-assembly2.cif.gz_D-3 crystal structure of raph complexed with spo0f 0.8836 23 131
3hv2-assembly1.cif.gz_B crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5 0.881 20 137
2iyn-assembly3.cif.gz_C the co-factor-induced pre-active conformation in phob 0.8728 23 131
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.868 22 131
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9194 20 100 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9149 21 100 3.40.50.2300
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9079 24 99 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9046 22 100 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9023 22 100 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3A4N723-F1-model_v4 Response regulator 0.9151 21 131 GO:0000160
AF-F5LB24-F1-model_v4 Response regulator receiver protein 0.904 20 103 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6I3KMD0-F1-model_v4 Response regulator 0.8904 14 131 GO:0000160
AF-A0A7S7J1D8-F1-model_v4 Stage 0 sporulation protein A homolog 0.8888 18 103 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A350LT45-F1-model_v4 DNA-binding response regulator 0.8864 17 103 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
74.35 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map