F460263

General Info

Members Datasets Scaffolds Average Seq Length
532 267 1064 156

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10319375|Ga0105238_103193752
Length 187
Sequence MAYSTFSLWIFTRQPSLSILRSEGETMNPRIDGHKAAPGAFNAMLALEGYVRKSSRLEPSLLELIRMRASQMNGCAYCLDMHSKDARAAGESEQRLYALNAWRETPFFTDRERAALEWTEAVTRVSEGHVPDNIYEQVRQRFSEEELVNLTLAIVTINGWNRLMVSFRAVPGDYQPGSLHRSKEAGR

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
262 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 0.56
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 2.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10319375 3300009551 Bacteria 1539
2 JGI24746J21847_1024052 3300001977 Bacteria 846
3 JGI24033J26618_1021493 3300002155 Bacteria 829
4 Ga0065712_10067868 3300005290 Bacteria 24325
5 Ga0065707_10129678 3300005295 Bacteria 1943
6 Ga0070658_10008503 3300005327 Bacteria 8253
7 Ga0070658_10278550 3300005327 Bacteria 1423
8 Ga0070658_10294191 3300005327 Bacteria 1384
9 Ga0070658_10639211 3300005327 Bacteria 923
10 Ga0070658_11202070 3300005327 Bacteria 659
11 Ga0070676_10068646 3300005328 Bacteria 2122
12 Ga0070676_10121185 3300005328 Bacteria 1642
13 Ga0070676_10121610 3300005328 Bacteria 1639
14 Ga0070676_10421553 3300005328 Bacteria 933
15 Ga0070683_100070315 3300005329 Bacteria 3264
16 Ga0070683_100708813 3300005329 Bacteria 964
17 Ga0070683_101309504 3300005329 Bacteria 696
18 Ga0070690_101281111 3300005330 Bacteria 587
19 Ga0070670_100001508 3300005331 Bacteria 18750
20 Ga0070670_100019518 3300005331 Bacteria 5818
21 Ga0070670_100289723 3300005331 Bacteria 1431
22 Ga0070677_10013286 3300005333 Bacteria 2877
23 Ga0070677_10022638 3300005333 Bacteria 2317
24 Ga0070677_10056918 3300005333 Bacteria 1601
25 Ga0070677_10378304 3300005333 Bacteria 741
26 Ga0070677_10489704 3300005333 Bacteria 665
27 Ga0068869_100063362 3300005334 Bacteria 2716
28 Ga0068869_100142264 3300005334 Bacteria 1853
29 Ga0068869_100180391 3300005334 Bacteria 1655
30 Ga0068869_100550595 3300005334 Bacteria 969
31 Ga0070666_10060871 3300005335 Bacteria 2556
32 Ga0070666_10145993 3300005335 Bacteria 1649
33 Ga0070666_10219189 3300005335 Bacteria 1342
34 Ga0070682_101337816 3300005337 Bacteria 610
35 Ga0070689_100181026 3300005340 Bacteria 1712
36 Ga0070661_100016528 3300005344 Bacteria 5219
37 Ga0070661_100050063 3300005344 Bacteria 3058
38 Ga0070661_100366485 3300005344 Bacteria 1133
39 Ga0070661_100562980 3300005344 Bacteria 918
40 Ga0070661_101641793 3300005344 Bacteria 544
41 Ga0070668_100039255 3300005347 Bacteria 3621
42 Ga0070668_100051221 3300005347 Bacteria 3180
43 Ga0070668_100755576 3300005347 Bacteria 861
44 Ga0070668_101335259 3300005347 Bacteria 652
45 Ga0070669_100064143 3300005353 Bacteria 2705
46 Ga0070669_100117867 3300005353 Bacteria 2022
47 Ga0070669_100449502 3300005353 Unclassified 1062
48 Ga0070675_100029726 3300005354 Bacteria 4409
49 Ga0070675_100068081 3300005354 Bacteria 2947
50 Ga0070675_100252670 3300005354 Bacteria 1543
51 Ga0070675_100422129 3300005354 Bacteria 1193
52 Ga0070675_100644155 3300005354 Bacteria 963
53 Ga0070671_100324499 3300005355 Bacteria 1312
54 Ga0070674_100000307 3300005356 Bacteria 24081
55 Ga0070674_100011795 3300005356 Bacteria 5335
56 Ga0070674_100364828 3300005356 Bacteria 1170
57 Ga0070674_100576450 3300005356 Bacteria 947
58 Ga0070673_100033131 3300005364 Bacteria 3897
59 Ga0070673_100049430 3300005364 Bacteria 3284
60 Ga0070673_100363753 3300005364 Bacteria 1286
61 Ga0070688_100063068 3300005365 Bacteria 2347
62 Ga0070688_100948976 3300005365 Bacteria 681
63 Ga0070667_100179467 3300005367 Bacteria 1872
64 Ga0070667_100193194 3300005367 Bacteria 1804
65 Ga0070667_100249755 3300005367 Bacteria 1586
66 Ga0070667_101515564 3300005367 Bacteria 630
67 Ga0070667_101784327 3300005367 Bacteria 579
68 Ga0070713_100173508 3300005436 Bacteria 1933
69 Ga0070710_10178165 3300005437 Bacteria 1329
70 Ga0070710_10362452 3300005437 Unclassified 962
71 Ga0070710_10595347 3300005437 Bacteria 769
72 Ga0070701_11046457 3300005438 Bacteria 572
73 Ga0070711_100179103 3300005439 Bacteria 1622
74 Ga0070700_100091961 3300005441 Bacteria 1982
75 Ga0070700_100274031 3300005441 Bacteria 1221
76 Ga0070678_100039242 3300005456 Bacteria 3339
77 Ga0070678_100049483 3300005456 Bacteria 3034
78 Ga0070678_100108645 3300005456 Bacteria 2166
79 Ga0070678_100312345 3300005456 Bacteria 1340
80 Ga0070678_101090967 3300005456 Bacteria 737
81 Ga0070662_100019617 3300005457 Bacteria 4592
82 Ga0070662_100291315 3300005457 Bacteria 1324
83 Ga0070662_100352510 3300005457 Bacteria 1206
84 Ga0070662_100717531 3300005457 Bacteria 847
85 Ga0070681_10543545 3300005458 Unclassified 1075
86 Ga0068867_100093918 3300005459 Bacteria 2280
87 Ga0068867_100175500 3300005459 Bacteria 1700
88 Ga0068867_100781313 3300005459 Bacteria 850
89 Ga0070685_10094264 3300005466 Bacteria 1818
90 Ga0070685_10691473 3300005466 Bacteria 743
91 Ga0070706_101914402 3300005467 Bacteria 538
92 Ga0070698_100011295 3300005471 Bacteria 9483
93 Ga0070699_100777216 3300005518 Bacteria 876
94 Ga0070679_100092128 3300005530 Bacteria 3018
95 Ga0070679_100156317 3300005530 Bacteria 2255
96 Ga0070679_100528857 3300005530 Bacteria 1123
97 Ga0070679_101760569 3300005530 Bacteria 568
98 Ga0070684_100004749 3300005535 Bacteria 10384
99 Ga0070684_100966594 3300005535 Bacteria 799
100 Ga0068853_100065734 3300005539 Bacteria 3147
101 Ga0068853_100118689 3300005539 Bacteria 2357
102 Ga0070672_100092446 3300005543 Bacteria 2442
103 Ga0070672_100434741 3300005543 Bacteria 1129
104 Ga0070672_100453941 3300005543 Bacteria 1104
105 Ga0070686_100244543 3300005544 Bacteria 1308
106 Ga0070686_101659026 3300005544 Bacteria 542
107 Ga0070693_100152656 3300005547 Bacteria 1464
108 Ga0070665_100005832 3300005548 Bacteria 12632
109 Ga0070665_100102249 3300005548 Bacteria 2869
110 Ga0070665_100122795 3300005548 Bacteria 2599
111 Ga0070665_100140322 3300005548 Bacteria 2420
112 Ga0068855_100072919 3300005563 Bacteria 3990
113 Ga0068855_100706435 3300005563 Bacteria 1078
114 Ga0068855_101110821 3300005563 Bacteria 826
115 Ga0068855_101862576 3300005563 Bacteria 610
116 Ga0070664_100009957 3300005564 Bacteria 7705
117 Ga0070664_100019631 3300005564 Bacteria 5561
118 Ga0070664_100349296 3300005564 Bacteria 1345
119 Ga0070664_100928826 3300005564 Bacteria 816
120 Ga0068857_100456489 3300005577 Bacteria 1195
121 Ga0068854_100872544 3300005578 Bacteria 789
122 Ga0068856_100026144 3300005614 Bacteria 5691
123 Ga0068856_100149562 3300005614 Bacteria 2344
124 Ga0068856_100169123 3300005614 Bacteria 2198
125 Ga0068856_100254631 3300005614 Bacteria 1770
126 Ga0068856_100966570 3300005614 Bacteria 870
127 Ga0070702_100575928 3300005615 Bacteria 840
128 Ga0070702_101365824 3300005615 Bacteria 578
129 Ga0068852_100011994 3300005616 Bacteria 6555
130 Ga0068852_100046815 3300005616 Bacteria 3686
131 Ga0068852_101020520 3300005616 Bacteria 846
132 Ga0068852_101163075 3300005616 Bacteria 792
133 Ga0068859_100149100 3300005617 Bacteria 2415
134 Ga0068859_100166983 3300005617 Bacteria 2281
135 Ga0068859_100343856 3300005617 Bacteria 1586
136 Ga0068864_100279218 3300005618 Bacteria 1559
137 Ga0068864_100286816 3300005618 Bacteria 1538
138 Ga0068864_100495297 3300005618 Bacteria 1175
139 Ga0068864_101136605 3300005618 Bacteria 778
140 Ga0068866_10123023 3300005718 Bacteria 1465
141 Ga0068866_10123599 3300005718 Bacteria 1462
142 Ga0068861_100326625 3300005719 Bacteria 1338
143 Ga0068861_100354607 3300005719 Bacteria 1288
144 Ga0068861_100893090 3300005719 Bacteria 841
145 Ga0068870_10066669 3300005840 Bacteria 1951
146 Ga0068870_10075805 3300005840 Bacteria 1846
147 Ga0068870_10107584 3300005840 Bacteria 1587
148 Ga0068870_10241184 3300005840 Bacteria 1116
149 Ga0068863_100007222 3300005841 Bacteria 10896
150 Ga0068863_100011607 3300005841 Bacteria 8524
151 Ga0068863_100125460 3300005841 Bacteria 2449
152 Ga0068863_100130962 3300005841 Bacteria 2395
153 Ga0068863_100954791 3300005841 Bacteria 859
154 Ga0068863_101513073 3300005841 Bacteria 680
155 Ga0068858_100001933 3300005842 Bacteria 21122
156 Ga0068858_101824437 3300005842 Bacteria 601
157 Ga0068860_100001984 3300005843 Bacteria 21604
158 Ga0068860_100449701 3300005843 Bacteria 1281
159 Ga0068860_100488729 3300005843 Bacteria 1228
160 Ga0068862_100195044 3300005844 Bacteria 1824
161 Ga0068862_100761067 3300005844 Unclassified 943
162 Ga0081455_10028119 3300005937 Bacteria 5140
163 Ga0081455_10157120 3300005937 Bacteria 1747
164 Ga0075363_100456879 3300006048 Bacteria 755
165 Ga0070716_100948179 3300006173 Bacteria 677
166 Ga0075367_10066792 3300006178 Bacteria 2155
167 Ga0097621_100058634 3300006237 Bacteria 3150
168 Ga0097621_100455445 3300006237 Bacteria 1153
169 Ga0097621_100493181 3300006237 Bacteria 1109
170 Ga0097621_100557990 3300006237 Bacteria 1043
171 Ga0075370_10085525 3300006353 Bacteria 1816
172 Ga0068871_100006462 3300006358 Bacteria 8294
173 Ga0068871_100039361 3300006358 Bacteria 3783
174 Ga0068871_100041224 3300006358 Bacteria 3701
175 Ga0068871_100109303 3300006358 Bacteria 2324
176 Ga0068871_100469924 3300006358 Bacteria 1130
177 Ga0075428_101134637 3300006844 Bacteria 825
178 Ga0075430_100004107 3300006846 Bacteria 12281
179 Ga0075431_100054725 3300006847 Bacteria 4115
180 Ga0075433_10015048 3300006852 Bacteria 6333
181 Ga0075434_100002958 3300006871 Bacteria 15110
182 Ga0075434_100720792 3300006871 Bacteria 1014
183 Ga0075429_100262794 3300006880 Bacteria 1511
184 Ga0075429_100266825 3300006880 Bacteria 1499
185 Ga0075429_100536952 3300006880 Bacteria 1025
186 Ga0075429_100600714 3300006880 Bacteria 964
187 Ga0068865_100084807 3300006881 Bacteria 2283
188 Ga0068865_100187055 3300006881 Bacteria 1599
189 Ga0075436_100690242 3300006914 Bacteria 756
190 Ga0097620_100149103 3300006931 Bacteria 2415
191 Ga0097620_100166972 3300006931 Bacteria 2281
192 Ga0097620_100343841 3300006931 Bacteria 1586
193 Ga0097620_102230421 3300006931 Bacteria 604
194 Ga0075435_100183784 3300007076 Bacteria 1767
195 Ga0105240_10090331 3300009093 Unclassified 3744
196 Ga0105240_11725901 3300009093 Bacteria 653
197 Ga0111539_10012878 3300009094 Bacteria 10467
198 Ga0111539_10092721 3300009094 Bacteria 3549
199 Ga0111539_10232717 3300009094 Unclassified 2145
200 Ga0111539_10257730 3300009094 Bacteria 2031
201 Ga0111539_10331520 3300009094 Bacteria 1771
202 Ga0111539_11466484 3300009094 Bacteria 791
203 Ga0105245_11577535 3300009098 Bacteria 708
204 Ga0114129_10122989 3300009147 Bacteria 3570
205 Ga0114129_10132868 3300009147 Bacteria 3417
206 Ga0114129_11717061 3300009147 Bacteria 766
207 Ga0105243_11588080 3300009148 Bacteria 680
208 Ga0105241_10121635 3300009174 Bacteria 2103
209 Ga0105241_10316687 3300009174 Bacteria 1344
210 Ga0105241_11041900 3300009174 Bacteria 767
211 Ga0105242_10005335 3300009176 Bacteria 9933
212 Ga0105248_10830734 3300009177 Bacteria 1043
213 Ga0105248_10832225 3300009177 Bacteria 1042
214 Ga0105248_11731398 3300009177 Bacteria 709
215 Ga0105248_11956757 3300009177 Unclassified 666
216 Ga0105237_10171092 3300009545 Bacteria 2172
217 Ga0105237_10709250 3300009545 Bacteria 1013
218 Ga0105237_11358788 3300009545 Bacteria 717
219 Ga0105237_11505144 3300009545 Bacteria 680
220 Ga0105238_10024479 3300009551 Bacteria 6153
221 Ga0105238_10036254 3300009551 Bacteria 5012
222 Ga0105238_10096076 3300009551 Bacteria 2950
223 Ga0105238_10489614 3300009551 Bacteria 1230
224 Ga0105249_10266464 3300009553 Bacteria 1705
225 Ga0105249_10489128 3300009553 Bacteria 1274
226 Ga0105249_10751053 3300009553 Bacteria 1038
227 Ga0105239_10162235 3300010375 Bacteria 2498
228 Ga0105239_10292030 3300010375 Bacteria 1836
229 Ga0105239_10331903 3300010375 Bacteria 1716
230 Ga0105239_10465707 3300010375 Bacteria 1435
231 Ga0105239_10639149 3300010375 Bacteria 1215
232 Ga0105239_11696837 3300010375 Bacteria 731
233 Ga0105246_10693612 3300011119 Bacteria 891
234 Ga0157371_10063343 3300013102 Bacteria 2621
235 Ga0157371_10322738 3300013102 Bacteria 1121
236 Ga0157369_10003780 3300013105 Bacteria 17985
237 Ga0157369_10012959 3300013105 Bacteria 9446
238 Ga0157374_10006728 3300013296 Bacteria 9769
239 Ga0157374_10478994 3300013296 Bacteria 1248
240 Ga0157378_10116179 3300013297 Bacteria 2460
241 Ga0157378_11079062 3300013297 Viruses 839
242 Ga0157378_12237634 3300013297 Bacteria 598
243 Ga0163162_10099024 3300013306 Bacteria 3005
244 Ga0163162_11001780 3300013306 Bacteria 945
245 Ga0157372_10002208 3300013307 Bacteria 21133
246 Ga0157375_10113991 3300013308 Bacteria 2805
247 Ga0157375_10949049 3300013308 Bacteria 1002
248 Ga0163163_10004989 3300014325 Bacteria 11429
249 Ga0163163_10149763 3300014325 Bacteria 2377
250 Ga0163163_10233878 3300014325 Bacteria 1887
251 Ga0163163_10379780 3300014325 Bacteria 1470
252 Ga0163163_10483339 3300014325 Bacteria 1300
253 Ga0157380_10055390 3300014326 Bacteria 3149
254 Ga0157380_10106349 3300014326 Bacteria 2348
255 Ga0157380_10636001 3300014326 Bacteria 1062
256 Ga0157380_10712269 3300014326 Bacteria 1010
257 Ga0157380_12080387 3300014326 Unclassified 630
258 Ga0157377_10185962 3300014745 Bacteria 1310
259 Ga0157376_10001575 3300014969 Bacteria 15075
260 Ga0157376_10249396 3300014969 Bacteria 1657
261 Ga0157376_10803246 3300014969 Bacteria 953
262 Ga0157376_10920256 3300014969 Bacteria 893
263 Ga0157376_11209223 3300014969 Bacteria 784
264 Ga0207656_10018078 3300025321 Bacteria 2769
265 Ga0207682_10007048 3300025893 Bacteria 4509
266 Ga0207682_10025750 3300025893 Bacteria 2333
267 Ga0207682_10067416 3300025893 Bacteria 1510
268 Ga0207682_10109840 3300025893 Bacteria 1213
269 Ga0207692_10448742 3300025898 Bacteria 812
270 Ga0207642_10124919 3300025899 Bacteria 1333
271 Ga0207688_10307394 3300025901 Bacteria 970
272 Ga0207680_10023881 3300025903 Bacteria 3346
273 Ga0207680_10230492 3300025903 Bacteria 1273
274 Ga0207647_10007608 3300025904 Bacteria 7807
275 Ga0207647_10077131 3300025904 Bacteria 2003
276 Ga0207685_10421000 3300025905 Bacteria 689
277 Ga0207699_10006251 3300025906 Bacteria 5752
278 Ga0207645_10103616 3300025907 Bacteria 1837
279 Ga0207645_10139243 3300025907 Bacteria 1581
280 Ga0207645_10551616 3300025907 Bacteria 782
281 Ga0207643_10021864 3300025908 Bacteria 3519
282 Ga0207643_10171631 3300025908 Bacteria 1309
283 Ga0207705_10150140 3300025909 Bacteria 1746
284 Ga0207705_10189876 3300025909 Bacteria 1553
285 Ga0207654_10006128 3300025911 Bacteria 6039
286 Ga0207654_10012913 3300025911 Bacteria 4285
287 Ga0207707_10154728 3300025912 Bacteria 2005
288 Ga0207695_10005085 3300025913 Bacteria 17629
289 Ga0207695_10428196 3300025913 Bacteria 1207
290 Ga0207695_10559747 3300025913 Bacteria 1025
291 Ga0207671_10188524 3300025914 Bacteria 1607
292 Ga0207671_10912095 3300025914 Bacteria 694
293 Ga0207663_10282496 3300025916 Bacteria 1233
294 Ga0207649_10434855 3300025920 Bacteria 988
295 Ga0207652_11307884 3300025921 Bacteria 628
296 Ga0207681_10046914 3300025923 Bacteria 2907
297 Ga0207681_10079126 3300025923 Bacteria 2315
298 Ga0207681_10083201 3300025923 Bacteria 2264
299 Ga0207694_10010612 3300025924 Bacteria 6952
300 Ga0207694_10015703 3300025924 Bacteria 5711
301 Ga0207694_10047674 3300025924 Bacteria 3314
302 Ga0207694_10351982 3300025924 Bacteria 1219
303 Ga0207650_10040354 3300025925 Bacteria 3415
304 Ga0207650_10121018 3300025925 Bacteria 2038
305 Ga0207650_10435509 3300025925 Bacteria 1089
306 Ga0207650_10500849 3300025925 Bacteria 1015
307 Ga0207659_10016387 3300025926 Bacteria 4822
308 Ga0207659_10054607 3300025926 Bacteria 2854
309 Ga0207659_10405609 3300025926 Bacteria 1141
310 Ga0207659_10474730 3300025926 Bacteria 1056
311 Ga0207687_11023525 3300025927 Bacteria 708
312 Ga0207700_10143440 3300025928 Bacteria 1965
313 Ga0207644_10563234 3300025931 Bacteria 944
314 Ga0207706_10015682 3300025933 Bacteria 6849
315 Ga0207706_10220275 3300025933 Bacteria 1661
316 Ga0207686_10676476 3300025934 Bacteria 818
317 Ga0207670_10136325 3300025936 Bacteria 1805
318 Ga0207670_10304021 3300025936 Bacteria 1250
319 Ga0207669_10006929 3300025937 Bacteria 5213
320 Ga0207669_10256373 3300025937 Bacteria 1305
321 Ga0207704_10074386 3300025938 Bacteria 2168
322 Ga0207704_10163697 3300025938 Bacteria 1586
323 Ga0207665_10652159 3300025939 Bacteria 825
324 Ga0207691_10008265 3300025940 Bacteria 9993
325 Ga0207691_10078893 3300025940 Bacteria 2964
326 Ga0207691_10206318 3300025940 Bacteria 1709
327 Ga0207691_10422545 3300025940 Bacteria 1136
328 Ga0207711_10181132 3300025941 Bacteria 1916
329 Ga0207711_10626441 3300025941 Bacteria 1004
330 Ga0207711_10774593 3300025941 Bacteria 894
331 Ga0207689_10213904 3300025942 Bacteria 1593
332 Ga0207689_10269494 3300025942 Bacteria 1410
333 Ga0207661_11259569 3300025944 Bacteria 680
334 Ga0207679_10050109 3300025945 Bacteria 3049
335 Ga0207679_10421720 3300025945 Bacteria 1178
336 Ga0207679_10736631 3300025945 Bacteria 896
337 Ga0207679_11472586 3300025945 Bacteria 624
338 Ga0207667_10012801 3300025949 Bacteria 9638
339 Ga0207667_10127346 3300025949 Bacteria 2623
340 Ga0207651_10030651 3300025960 Bacteria 3428
341 Ga0207651_10349041 3300025960 Bacteria 1245
342 Ga0207712_10803523 3300025961 Bacteria 827
343 Ga0207668_10070232 3300025972 Bacteria 2497
344 Ga0207668_10375678 3300025972 Bacteria 1195
345 Ga0207640_11002755 3300025981 Bacteria 735
346 Ga0207658_10397721 3300025986 Bacteria 1210
347 Ga0207658_10418609 3300025986 Bacteria 1181
348 Ga0207658_10615543 3300025986 Bacteria 976
349 Ga0207658_10763685 3300025986 Bacteria 876
350 Ga0207658_11320943 3300025986 Unclassified 659
351 Ga0207677_10858027 3300026023 Bacteria 816
352 Ga0207703_10003520 3300026035 Bacteria 13097
353 Ga0207639_10055763 3300026041 Bacteria 3026
354 Ga0207639_10062483 3300026041 Bacteria 2880
355 Ga0207678_10011678 3300026067 Bacteria 7713
356 Ga0207678_10056820 3300026067 Bacteria 3368
357 Ga0207708_10155401 3300026075 Bacteria 1804
358 Ga0207702_10000778 3300026078 Bacteria 33764
359 Ga0207702_10180464 3300026078 Bacteria 1944
360 Ga0207702_10192300 3300026078 Bacteria 1886
361 Ga0207641_10000174 3300026088 Bacteria 89117
362 Ga0207641_10003248 3300026088 Bacteria 14498
363 Ga0207641_10160669 3300026088 Bacteria 2043
364 Ga0207641_10253304 3300026088 Bacteria 1645
365 Ga0207641_10327229 3300026088 Bacteria 1455
366 Ga0207641_10343898 3300026088 Bacteria 1420
367 Ga0207648_10192209 3300026089 Bacteria 1809
368 Ga0207648_11216200 3300026089 Bacteria 708
369 Ga0207648_11370234 3300026089 Bacteria 665
370 Ga0207676_10228197 3300026095 Bacteria 1663
371 Ga0207676_10233622 3300026095 Bacteria 1645
372 Ga0207676_11542948 3300026095 Bacteria 661
373 Ga0207674_11102671 3300026116 Bacteria 763
374 Ga0207675_100092203 3300026118 Bacteria 2849
375 Ga0207675_100189831 3300026118 Bacteria 1970
376 Ga0207683_10127703 3300026121 Bacteria 2286
377 Ga0207683_10130294 3300026121 Bacteria 2262
378 Ga0207683_10187193 3300026121 Bacteria 1878
379 Ga0207683_10207486 3300026121 Bacteria 1782
380 Ga0207683_10272531 3300026121 Bacteria 1546
381 Ga0207683_10847606 3300026121 Bacteria 848
382 Ga0207698_10010011 3300026142 Bacteria 6070
383 Ga0207428_10286946 3300027907 Bacteria 1220
384 Ga0207428_10332820 3300027907 Bacteria 1120
385 Ga0268266_10000702 3300028379 Bacteria 45182
386 Ga0268266_10020657 3300028379 Bacteria 5612
387 Ga0268266_10143767 3300028379 Bacteria 2143
388 Ga0268266_10247700 3300028379 Bacteria 1647
389 Ga0268266_10265357 3300028379 Bacteria 1592
390 Ga0268265_10185911 3300028380 Bacteria 1790
391 Ga0268265_10705568 3300028380 Bacteria 975
392 Ga0268265_10769149 3300028380 Bacteria 936
393 Ga0268264_10000088 3300028381 Bacteria 235344
394 Ga0268264_10054129 3300028381 Bacteria 3350
395 Ga0268264_10278050 3300028381 Bacteria 1567
396 Ga0268264_10874336 3300028381 Bacteria 901
397 Ga0307511_10000278 3300030521 Bacteria 53690
398 Ga0265770_1009354 3300030878 Bacteria 1410
399 Ga0307408_100081013 3300031548 Bacteria 2426
400 Ga0307416_100279673 3300032002 Bacteria 1645
401 Ga0307414_11462023 3300032004 Bacteria 636
402 Ga0307415_100484418 3300032126 Bacteria 1078
403 Ga0307510_10000008 3300033180 Bacteria 433990
404 Ga0373940_0234510 3300035088 Bacteria 614
405 Ga0373944_0082395 3300035089 Bacteria 1064
406 Ga0373949_0036182 3300035090 Bacteria 1197
407 Ga0373923_0157817 3300035111 Bacteria 1033
408 Ga0373936_0016784 3300035113 Bacteria 2818
409 Ga0373945_0009547 3300035116 Bacteria 3182
410 Ga0373957_0359200 3300035120 Bacteria 623
411 Ga0373943_0008665 3300035170 Bacteria 4560
412 Ga0373943_0591226 3300035170 Bacteria 653
413 Ga0373946_0003146 3300035171 Bacteria 5847
414 Ga0373931_0510063 3300035691 Bacteria 777
415 Ga0373935_0008938 3300035692 Bacteria 5996
416 Ga0373935_0256652 3300035692 Bacteria 1225
417 Ga0373933_0015472 3300035724 Bacteria 4253
418 Ga0373937_0410369 3300036401 Bacteria 1285
419 Ga0373925_0018504 3300037068 Bacteria 5064
420 Ga0373925_0520673 3300037068 Unclassified 977
421 Ga0436363_0800024 3300039450 Bacteria 654
422 Ga0451577_0383298 3300042876 Bacteria 1276
423 Ga0466969_0000845 3300044656 Bacteria 16627
424 Ga0466966_0000352 3300044684 Bacteria 29833
425 Ga0466961_0000364 3300044693 Bacteria 29379
426 Ga0466964_0000030 3300044706 Bacteria 29509
427 Ga0466971_0000333 3300044719 Bacteria 18049
428 Ga0466970_0000166 3300044765 Bacteria 31421
429 Ga0466957_0003075 3300044842 Bacteria 9080
430 Ga0466957_0006752 3300044842 Bacteria 6483
431 Ga0466959_0028412 3300045049 Unclassified 4147
432 Ga0495638_0179056 3300046460 Bacteria 1211
433 Ga0495580_0066201 3300046472 Bacteria 2530
434 Ga0495582_0529531 3300046473 Bacteria 681
435 Ga0495639_0345438 3300046475 Bacteria 747
436 Ga0495639_0679991 3300046475 Bacteria 531
437 Ga0495594_0330384 3300046499 Bacteria 868
438 Ga0495606_0182522 3300046507 Bacteria 1209
439 Ga0495608_0004122 3300046511 Bacteria 10421
440 Ga0495628_0155893 3300046516 Bacteria 1737
441 Ga0495630_0013504 3300046517 Bacteria 5939
442 Ga0495630_0016035 3300046517 Bacteria 5476
443 Ga0495643_0205678 3300046522 Bacteria 942
444 Ga0495666_0056816 3300046526 Bacteria 1874
445 Ga0495642_0337450 3300046528 Bacteria 662
446 Ga0495665_0062067 3300046531 Bacteria 1973
447 Ga0495665_0314720 3300046531 Bacteria 800
448 Ga0495587_0009223 3300046536 Bacteria 6332
449 Ga0495645_0041544 3300046543 Bacteria 3353
450 Ga0495645_0645435 3300046543 Bacteria 647
451 Ga0495667_0165410 3300046559 Bacteria 1422
452 Ga0495656_0624173 3300046615 Bacteria 578
453 Ga0495668_0089949 3300046616 Bacteria 1682
454 Ga0495634_0333179 3300046642 Bacteria 912
455 Ga0495634_0661417 3300046642 Bacteria 603
456 Ga0495634_0677992 3300046642 Bacteria 594
457 Ga0495635_0351824 3300046663 Bacteria 983
458 Ga0495657_0119642 3300046675 Bacteria 1660
459 Ga0495658_0034262 3300046683 Bacteria 2785
460 Ga0495658_0737958 3300046683 Bacteria 631
461 Ga0495613_0017060 3300046689 Bacteria 5406
462 Ga0495624_0002420 3300046690 Bacteria 14174
463 Ga0495624_0224451 3300046690 Bacteria 1139
464 Ga0495604_0286946 3300047317 Bacteria 1110
465 Ga0495674_0044393 3300047319 Bacteria 3952
466 Ga0495674_0160654 3300047319 Bacteria 1880
467 Ga0495674_0464915 3300047319 Bacteria 1015
468 Ga0495687_062314 3300047443 Bacteria 1531
469 Ga0495684_0000946 3300047471 Bacteria 23638
470 Ga0495684_0003610 3300047471 Bacteria 12060
471 Ga0495614_0298546 3300048089 Bacteria 744
472 Ga0495615_0093443 3300048090 Bacteria 841
473 Ga0496104_0539516 3300048907 Bacteria 1077
474 Ga0496112_0361235 3300048915 Bacteria 1394
475 Ga0496113_1143904 3300048916 Bacteria 609
476 Ga0496121_0025344 3300048924 Bacteria 5632
477 Ga0496125_0000331 3300048928 Bacteria 90719
478 Ga0496126_0058038 3300048929 Bacteria 3490
479 Ga0501033_0069522 3300049570 Unclassified 2588
480 Ga0501034_0326461 3300049571 Bacteria 1466
481 Ga0501034_1150392 3300049571 Bacteria 656
482 Ga0501036_0610706 3300049572 Bacteria 904
483 Ga0501038_0234473 3300049574 Bacteria 1459
484 Ga0501039_0010622 3300049575 Bacteria 7016
485 Ga0501040_1044422 3300049576 Bacteria 592
486 Ga0501042_0365118 3300049578 Bacteria 1045
487 Ga0501043_0110962 3300049579 Bacteria 2153
488 Ga0501047_0010024 3300049581 Bacteria 8957
489 Ga0501070_0011727 3300049586 Bacteria 7403
490 Ga0501072_0097494 3300049588 Bacteria 2337
491 Ga0501073_0382878 3300049589 Bacteria 972
492 Ga0501074_0635353 3300049590 Bacteria 754
493 Ga0501075_0051429 3300049591 Bacteria 3098
494 Ga0501077_0288227 3300049593 Bacteria 1045
495 Ga0501079_0097829 3300049741 Bacteria 2275
496 Ga0501270_106550 3300049767 Bacteria 592
497 Ga0501035_0002893 3300049822 Bacteria 16543
498 Ga0501035_0130231 3300049822 Bacteria 2194
499 nmdc:mga03n38_397743_c1 3300050490 Bacteria 758
500 nmdc:mga07m45_292641_c1 3300050496 Bacteria 947
501 nmdc:mga05p37_18118_c1 3300050507 Bacteria 8507
502 nmdc:mga05p37_68860_c1 3300050507 Bacteria 4352
503 nmdc:mga09592_255244_c1 3300050508 Bacteria 1520
504 nmdc:mga0qj67_11619_c1 3300050509 Bacteria 6603
505 nmdc:mga0qj67_1479186_c1 3300050509 Bacteria 523
506 nmdc:mga0qj67_534393_c1 3300050509 Bacteria 941
507 nmdc:mga06r32_1131403_c1 3300050510 Bacteria 731
508 nmdc:mga06r32_23588_c1 3300050510 Bacteria 5695
509 nmdc:mga08y16_23020_c1 3300050511 Bacteria 6577
510 nmdc:mga08y16_402237_c1 3300050511 Bacteria 1401
511 nmdc:mga08y16_73056_c1 3300050511 Bacteria 3574
512 nmdc:mga08y16_876954_c1 3300050511 Bacteria 885
513 nmdc:mga0n895_395503_c1 3300050512 Bacteria 1398
514 nmdc:mga0n895_74793_c1 3300050512 Bacteria 3366
515 nmdc:mga0rr50_157594_c1 3300050513 Bacteria 1840
516 nmdc:mga0rr50_285615_c1 3300050513 Bacteria 1378
517 nmdc:mga0rr50_324403_c1 3300050513 Bacteria 1291
518 nmdc:mga08x19_380027_c1 3300050514 Bacteria 989
519 nmdc:mga0a205_106254_c2 3300050515 Bacteria 1776
520 nmdc:mga0a205_3568_c1 3300050515 Bacteria 13928
521 nmdc:mga0a205_385613_c1 3300050515 Bacteria 1266
522 Ga0495601_0006836 3300053077 Bacteria 6681
523 Ga0495595_0040667 3300053084 Bacteria 2125
524 Ga0495619_0006075 3300053085 Bacteria 7651
525 Ga0500641_0027866 3300053096 Bacteria 2202
526 Ga0500577_0027430 3300053142 Bacteria 1950
527 Ga0500590_160808 3300053148 Bacteria 1001
528 Ga0500616_0066283 3300053153 Bacteria 1854
529 Ga0500622_0042596 3300053156 Bacteria 2357
530 Ga0500637_0018244 3300053178 Bacteria 3767
531 Ga0466962_0000084 3300061719 Bacteria 37853
532 Ga0530510_0058484 3300061734 Bacteria 2787
533 Ga0105238_10319375
534 JGI24746J21847_1024052
535 JGI24033J26618_1021493
536 Ga0065712_10067868
537 Ga0065707_10129678
538 Ga0070658_10008503
539 Ga0070658_10278550
540 Ga0070658_10294191
541 Ga0070658_10639211
542 Ga0070658_11202070
543 Ga0070676_10068646
544 Ga0070676_10121185
545 Ga0070676_10121610
546 Ga0070676_10421553
547 Ga0070683_100070315
548 Ga0070683_100708813
549 Ga0070683_101309504
550 Ga0070690_101281111
551 Ga0070670_100001508
552 Ga0070670_100019518
553 Ga0070670_100289723
554 Ga0070677_10013286
555 Ga0070677_10022638
556 Ga0070677_10056918
557 Ga0070677_10378304
558 Ga0070677_10489704
559 Ga0068869_100063362
560 Ga0068869_100142264
561 Ga0068869_100180391
562 Ga0068869_100550595
563 Ga0070666_10060871
564 Ga0070666_10145993
565 Ga0070666_10219189
566 Ga0070682_101337816
567 Ga0070689_100181026
568 Ga0070661_100016528
569 Ga0070661_100050063
570 Ga0070661_100366485
571 Ga0070661_100562980
572 Ga0070661_101641793
573 Ga0070668_100039255
574 Ga0070668_100051221
575 Ga0070668_100755576
576 Ga0070668_101335259
577 Ga0070669_100064143
578 Ga0070669_100117867
579 Ga0070669_100449502
580 Ga0070675_100029726
581 Ga0070675_100068081
582 Ga0070675_100252670
583 Ga0070675_100422129
584 Ga0070675_100644155
585 Ga0070671_100324499
586 Ga0070674_100000307
587 Ga0070674_100011795
588 Ga0070674_100364828
589 Ga0070674_100576450
590 Ga0070673_100033131
591 Ga0070673_100049430
592 Ga0070673_100363753
593 Ga0070688_100063068
594 Ga0070688_100948976
595 Ga0070667_100179467
596 Ga0070667_100193194
597 Ga0070667_100249755
598 Ga0070667_101515564
599 Ga0070667_101784327
600 Ga0070713_100173508
601 Ga0070710_10178165
602 Ga0070710_10362452
603 Ga0070710_10595347
604 Ga0070701_11046457
605 Ga0070711_100179103
606 Ga0070700_100091961
607 Ga0070700_100274031
608 Ga0070678_100039242
609 Ga0070678_100049483
610 Ga0070678_100108645
611 Ga0070678_100312345
612 Ga0070678_101090967
613 Ga0070662_100019617
614 Ga0070662_100291315
615 Ga0070662_100352510
616 Ga0070662_100717531
617 Ga0070681_10543545
618 Ga0068867_100093918
619 Ga0068867_100175500
620 Ga0068867_100781313
621 Ga0070685_10094264
622 Ga0070685_10691473
623 Ga0070706_101914402
624 Ga0070698_100011295
625 Ga0070699_100777216
626 Ga0070679_100092128
627 Ga0070679_100156317
628 Ga0070679_100528857
629 Ga0070679_101760569
630 Ga0070684_100004749
631 Ga0070684_100966594
632 Ga0068853_100065734
633 Ga0068853_100118689
634 Ga0070672_100092446
635 Ga0070672_100434741
636 Ga0070672_100453941
637 Ga0070686_100244543
638 Ga0070686_101659026
639 Ga0070693_100152656
640 Ga0070665_100005832
641 Ga0070665_100102249
642 Ga0070665_100122795
643 Ga0070665_100140322
644 Ga0068855_100072919
645 Ga0068855_100706435
646 Ga0068855_101110821
647 Ga0068855_101862576
648 Ga0070664_100009957
649 Ga0070664_100019631
650 Ga0070664_100349296
651 Ga0070664_100928826
652 Ga0068857_100456489
653 Ga0068854_100872544
654 Ga0068856_100026144
655 Ga0068856_100149562
656 Ga0068856_100169123
657 Ga0068856_100254631
658 Ga0068856_100966570
659 Ga0070702_100575928
660 Ga0070702_101365824
661 Ga0068852_100011994
662 Ga0068852_100046815
663 Ga0068852_101020520
664 Ga0068852_101163075
665 Ga0068859_100149100
666 Ga0068859_100166983
667 Ga0068859_100343856
668 Ga0068864_100279218
669 Ga0068864_100286816
670 Ga0068864_100495297
671 Ga0068864_101136605
672 Ga0068866_10123023
673 Ga0068866_10123599
674 Ga0068861_100326625
675 Ga0068861_100354607
676 Ga0068861_100893090
677 Ga0068870_10066669
678 Ga0068870_10075805
679 Ga0068870_10107584
680 Ga0068870_10241184
681 Ga0068863_100007222
682 Ga0068863_100011607
683 Ga0068863_100125460
684 Ga0068863_100130962
685 Ga0068863_100954791
686 Ga0068863_101513073
687 Ga0068858_100001933
688 Ga0068858_101824437
689 Ga0068860_100001984
690 Ga0068860_100449701
691 Ga0068860_100488729
692 Ga0068862_100195044
693 Ga0068862_100761067
694 Ga0081455_10028119
695 Ga0081455_10157120
696 Ga0075363_100456879
697 Ga0070716_100948179
698 Ga0075367_10066792
699 Ga0097621_100058634
700 Ga0097621_100455445
701 Ga0097621_100493181
702 Ga0097621_100557990
703 Ga0075370_10085525
704 Ga0068871_100006462
705 Ga0068871_100039361
706 Ga0068871_100041224
707 Ga0068871_100109303
708 Ga0068871_100469924
709 Ga0075428_101134637
710 Ga0075430_100004107
711 Ga0075431_100054725
712 Ga0075433_10015048
713 Ga0075434_100002958
714 Ga0075434_100720792
715 Ga0075429_100262794
716 Ga0075429_100266825
717 Ga0075429_100536952
718 Ga0075429_100600714
719 Ga0068865_100084807
720 Ga0068865_100187055
721 Ga0075436_100690242
722 Ga0097620_100149103
723 Ga0097620_100166972
724 Ga0097620_100343841
725 Ga0097620_102230421
726 Ga0075435_100183784
727 Ga0105240_10090331
728 Ga0105240_11725901
729 Ga0111539_10012878
730 Ga0111539_10092721
731 Ga0111539_10232717
732 Ga0111539_10257730
733 Ga0111539_10331520
734 Ga0111539_11466484
735 Ga0105245_11577535
736 Ga0114129_10122989
737 Ga0114129_10132868
738 Ga0114129_11717061
739 Ga0105243_11588080
740 Ga0105241_10121635
741 Ga0105241_10316687
742 Ga0105241_11041900
743 Ga0105242_10005335
744 Ga0105248_10830734
745 Ga0105248_10832225
746 Ga0105248_11731398
747 Ga0105248_11956757
748 Ga0105237_10171092
749 Ga0105237_10709250
750 Ga0105237_11358788
751 Ga0105237_11505144
752 Ga0105238_10024479
753 Ga0105238_10036254
754 Ga0105238_10096076
755 Ga0105238_10489614
756 Ga0105249_10266464
757 Ga0105249_10489128
758 Ga0105249_10751053
759 Ga0105239_10162235
760 Ga0105239_10292030
761 Ga0105239_10331903
762 Ga0105239_10465707
763 Ga0105239_10639149
764 Ga0105239_11696837
765 Ga0105246_10693612
766 Ga0157371_10063343
767 Ga0157371_10322738
768 Ga0157369_10003780
769 Ga0157369_10012959
770 Ga0157374_10006728
771 Ga0157374_10478994
772 Ga0157378_10116179
773 Ga0157378_11079062
774 Ga0157378_12237634
775 Ga0163162_10099024
776 Ga0163162_11001780
777 Ga0157372_10002208
778 Ga0157375_10113991
779 Ga0157375_10949049
780 Ga0163163_10004989
781 Ga0163163_10149763
782 Ga0163163_10233878
783 Ga0163163_10379780
784 Ga0163163_10483339
785 Ga0157380_10055390
786 Ga0157380_10106349
787 Ga0157380_10636001
788 Ga0157380_10712269
789 Ga0157380_12080387
790 Ga0157377_10185962
791 Ga0157376_10001575
792 Ga0157376_10249396
793 Ga0157376_10803246
794 Ga0157376_10920256
795 Ga0157376_11209223
796 Ga0207656_10018078
797 Ga0207682_10007048
798 Ga0207682_10025750
799 Ga0207682_10067416
800 Ga0207682_10109840
801 Ga0207692_10448742
802 Ga0207642_10124919
803 Ga0207688_10307394
804 Ga0207680_10023881
805 Ga0207680_10230492
806 Ga0207647_10007608
807 Ga0207647_10077131
808 Ga0207685_10421000
809 Ga0207699_10006251
810 Ga0207645_10103616
811 Ga0207645_10139243
812 Ga0207645_10551616
813 Ga0207643_10021864
814 Ga0207643_10171631
815 Ga0207705_10150140
816 Ga0207705_10189876
817 Ga0207654_10006128
818 Ga0207654_10012913
819 Ga0207707_10154728
820 Ga0207695_10005085
821 Ga0207695_10428196
822 Ga0207695_10559747
823 Ga0207671_10188524
824 Ga0207671_10912095
825 Ga0207663_10282496
826 Ga0207649_10434855
827 Ga0207652_11307884
828 Ga0207681_10046914
829 Ga0207681_10079126
830 Ga0207681_10083201
831 Ga0207694_10010612
832 Ga0207694_10015703
833 Ga0207694_10047674
834 Ga0207694_10351982
835 Ga0207650_10040354
836 Ga0207650_10121018
837 Ga0207650_10435509
838 Ga0207650_10500849
839 Ga0207659_10016387
840 Ga0207659_10054607
841 Ga0207659_10405609
842 Ga0207659_10474730
843 Ga0207687_11023525
844 Ga0207700_10143440
845 Ga0207644_10563234
846 Ga0207706_10015682
847 Ga0207706_10220275
848 Ga0207686_10676476
849 Ga0207670_10136325
850 Ga0207670_10304021
851 Ga0207669_10006929
852 Ga0207669_10256373
853 Ga0207704_10074386
854 Ga0207704_10163697
855 Ga0207665_10652159
856 Ga0207691_10008265
857 Ga0207691_10078893
858 Ga0207691_10206318
859 Ga0207691_10422545
860 Ga0207711_10181132
861 Ga0207711_10626441
862 Ga0207711_10774593
863 Ga0207689_10213904
864 Ga0207689_10269494
865 Ga0207661_11259569
866 Ga0207679_10050109
867 Ga0207679_10421720
868 Ga0207679_10736631
869 Ga0207679_11472586
870 Ga0207667_10012801
871 Ga0207667_10127346
872 Ga0207651_10030651
873 Ga0207651_10349041
874 Ga0207712_10803523
875 Ga0207668_10070232
876 Ga0207668_10375678
877 Ga0207640_11002755
878 Ga0207658_10397721
879 Ga0207658_10418609
880 Ga0207658_10615543
881 Ga0207658_10763685
882 Ga0207658_11320943
883 Ga0207677_10858027
884 Ga0207703_10003520
885 Ga0207639_10055763
886 Ga0207639_10062483
887 Ga0207678_10011678
888 Ga0207678_10056820
889 Ga0207708_10155401
890 Ga0207702_10000778
891 Ga0207702_10180464
892 Ga0207702_10192300
893 Ga0207641_10000174
894 Ga0207641_10003248
895 Ga0207641_10160669
896 Ga0207641_10253304
897 Ga0207641_10327229
898 Ga0207641_10343898
899 Ga0207648_10192209
900 Ga0207648_11216200
901 Ga0207648_11370234
902 Ga0207676_10228197
903 Ga0207676_10233622
904 Ga0207676_11542948
905 Ga0207674_11102671
906 Ga0207675_100092203
907 Ga0207675_100189831
908 Ga0207683_10127703
909 Ga0207683_10130294
910 Ga0207683_10187193
911 Ga0207683_10207486
912 Ga0207683_10272531
913 Ga0207683_10847606
914 Ga0207698_10010011
915 Ga0207428_10286946
916 Ga0207428_10332820
917 Ga0268266_10000702
918 Ga0268266_10020657
919 Ga0268266_10143767
920 Ga0268266_10247700
921 Ga0268266_10265357
922 Ga0268265_10185911
923 Ga0268265_10705568
924 Ga0268265_10769149
925 Ga0268264_10000088
926 Ga0268264_10054129
927 Ga0268264_10278050
928 Ga0268264_10874336
929 Ga0307511_10000278
930 Ga0265770_1009354
931 Ga0307408_100081013
932 Ga0307416_100279673
933 Ga0307414_11462023
934 Ga0307415_100484418
935 Ga0307510_10000008
936 Ga0373940_0234510
937 Ga0373944_0082395
938 Ga0373949_0036182
939 Ga0373923_0157817
940 Ga0373936_0016784
941 Ga0373945_0009547
942 Ga0373957_0359200
943 Ga0373943_0008665
944 Ga0373943_0591226
945 Ga0373946_0003146
946 Ga0373931_0510063
947 Ga0373935_0008938
948 Ga0373935_0256652
949 Ga0373933_0015472
950 Ga0373937_0410369
951 Ga0373925_0018504
952 Ga0373925_0520673
953 Ga0436363_0800024
954 Ga0451577_0383298
955 Ga0466969_0000845
956 Ga0466966_0000352
957 Ga0466961_0000364
958 Ga0466964_0000030
959 Ga0466971_0000333
960 Ga0466970_0000166
961 Ga0466957_0003075
962 Ga0466957_0006752
963 Ga0466959_0028412
964 Ga0495638_0179056
965 Ga0495580_0066201
966 Ga0495582_0529531
967 Ga0495639_0345438
968 Ga0495639_0679991
969 Ga0495594_0330384
970 Ga0495606_0182522
971 Ga0495608_0004122
972 Ga0495628_0155893
973 Ga0495630_0013504
974 Ga0495630_0016035
975 Ga0495643_0205678
976 Ga0495666_0056816
977 Ga0495642_0337450
978 Ga0495665_0062067
979 Ga0495665_0314720
980 Ga0495587_0009223
981 Ga0495645_0041544
982 Ga0495645_0645435
983 Ga0495667_0165410
984 Ga0495656_0624173
985 Ga0495668_0089949
986 Ga0495634_0333179
987 Ga0495634_0661417
988 Ga0495634_0677992
989 Ga0495635_0351824
990 Ga0495657_0119642
991 Ga0495658_0034262
992 Ga0495658_0737958
993 Ga0495613_0017060
994 Ga0495624_0002420
995 Ga0495624_0224451
996 Ga0495604_0286946
997 Ga0495674_0044393
998 Ga0495674_0160654
999 Ga0495674_0464915
1000 Ga0495687_062314
1001 Ga0495684_0000946
1002 Ga0495684_0003610
1003 Ga0495614_0298546
1004 Ga0495615_0093443
1005 Ga0496104_0539516
1006 Ga0496112_0361235
1007 Ga0496113_1143904
1008 Ga0496121_0025344
1009 Ga0496125_0000331
1010 Ga0496126_0058038
1011 Ga0501033_0069522
1012 Ga0501034_0326461
1013 Ga0501034_1150392
1014 Ga0501036_0610706
1015 Ga0501038_0234473
1016 Ga0501039_0010622
1017 Ga0501040_1044422
1018 Ga0501042_0365118
1019 Ga0501043_0110962
1020 Ga0501047_0010024
1021 Ga0501070_0011727
1022 Ga0501072_0097494
1023 Ga0501073_0382878
1024 Ga0501074_0635353
1025 Ga0501075_0051429
1026 Ga0501077_0288227
1027 Ga0501079_0097829
1028 Ga0501270_106550
1029 Ga0501035_0002893
1030 Ga0501035_0130231
1031 nmdc:mga03n38_397743_c1
1032 nmdc:mga07m45_292641_c1
1033 nmdc:mga05p37_18118_c1
1034 nmdc:mga05p37_68860_c1
1035 nmdc:mga09592_255244_c1
1036 nmdc:mga0qj67_11619_c1
1037 nmdc:mga0qj67_1479186_c1
1038 nmdc:mga0qj67_534393_c1
1039 nmdc:mga06r32_1131403_c1
1040 nmdc:mga06r32_23588_c1
1041 nmdc:mga08y16_23020_c1
1042 nmdc:mga08y16_402237_c1
1043 nmdc:mga08y16_73056_c1
1044 nmdc:mga08y16_876954_c1
1045 nmdc:mga0n895_395503_c1
1046 nmdc:mga0n895_74793_c1
1047 nmdc:mga0rr50_157594_c1
1048 nmdc:mga0rr50_285615_c1
1049 nmdc:mga0rr50_324403_c1
1050 nmdc:mga08x19_380027_c1
1051 nmdc:mga0a205_106254_c2
1052 nmdc:mga0a205_3568_c1
1053 nmdc:mga0a205_385613_c1
1054 Ga0495601_0006836
1055 Ga0495595_0040667
1056 Ga0495619_0006075
1057 Ga0500641_0027866
1058 Ga0500577_0027430
1059 Ga0500590_160808
1060 Ga0500616_0066283
1061 Ga0500622_0042596
1062 Ga0500637_0018244
1063 Ga0466962_0000084
1064 Ga0530510_0058484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

38

121

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.966 12 142
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9454 2 147
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.945 12 142
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9392 2 147
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9389 1 145
ID Description Score Start End Superfamily
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9399 2 148 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9338 2 148 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9327 6 142 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9159 2 143 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9134 6 142 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A731Z005-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9859 37 142 GO:0051920
AF-A0A6A7KZW0-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9855 42 154 GO:0051920
AF-A0A7X6Q7T9-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9828 40 154 GO:0051920
AF-A0A7X6P6M7-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9822 28 139 GO:0051920
AF-A0A2V9M429-F1-model_v4 Alkylhydroperoxidase 0.981 44 155 GO:0051920

Map