F460259

General Info

Members Datasets Scaffolds Average Seq Length
532 408 1064 125

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11932820|Ga0105242_119328201
Length 128
Sequence MFAQPETWVAIAFVILMVLFAYLGIHKTVLKALDHRAERIKAELDDARRLKDEASKLLAEYKTKRSSAEREAAEIITRRTKTAEGKIALAEAQAIADVRSTILSQSVKGSVADDLMAKGIAEVRAKLN

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
220 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
227 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
228 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
229 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
230 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
231 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
232 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
233 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
234 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
235 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
236 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
237 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
238 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
239 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
240 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
241 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
242 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
243 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
244 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
245 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
246 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
247 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
248 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
249 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
250 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
251 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
252 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
253 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
254 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
255 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
256 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
257 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
258 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
259 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
260 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
261 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
262 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
263 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
264 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
265 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
266 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
267 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
268 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
269 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
270 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
271 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
272 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
273 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
274 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
275 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
276 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
277 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
278 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
279 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
280 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
281 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
282 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
283 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
284 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
285 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
286 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
287 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
288 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
289 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
290 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
291 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
292 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
293 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
294 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
295 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
296 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
297 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
298 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
299 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
300 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
301 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
302 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
303 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
304 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
305 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
306 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
307 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
308 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
309 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
310 2922368715
311 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
312 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
313 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
314 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
315 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
316 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
317 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
318 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
319 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
320 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
321 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
322 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
323 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
324 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
325 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
326 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
327 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
328 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
329 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
330 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
331 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
332 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
333 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
334 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
335 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
336 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
337 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
338 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
339 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
340 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
341 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
342 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
343 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
344 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
345 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
346 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
347 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
348 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
349 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
350 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
351 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
352 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
353 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
354 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
355 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
356 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
357 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
358 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
359 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
360 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
361 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
362 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
363 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
364 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
365 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
366 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
367 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
368 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
369 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
370 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
371 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
372 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
373 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
374 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
375 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
376 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
377 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
378 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
379 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
380 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
381 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
382 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
383 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
384 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
385 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
386 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
387 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
388 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
389 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
390 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
391 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
392 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
393 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
394 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
395 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
396 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
397 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
398 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
399 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
400 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
401 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
402 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
403 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
404 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
405 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
406 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
407 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
408 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.54
Metatranscriptomes 0.19
Isolates 34.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 25.19
Rhizoplane 3.01
Rhizosphere 56.95
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_11932820 3300009176 Bacteria 631
2 JGI25406J46586_10000076 3300003203 Bacteria 44212
3 JGI25406J46586_10006251 3300003203 Bacteria 5497
4 rootL2_10221282 3300003322 Bacteria 2090
5 JGI25404J52841_10029542 3300003659 Bacteria 1175
6 Ga0070666_10128761 3300005335 Bacteria 1758
7 Ga0070660_100078864 3300005339 Bacteria 2583
8 Ga0070661_100144607 3300005344 Bacteria 1794
9 Ga0070688_100197611 3300005365 Bacteria 1405
10 Ga0070688_100465650 3300005365 Bacteria 947
11 Ga0070659_100276002 3300005366 Bacteria 1397
12 Ga0070667_100284565 3300005367 Bacteria 1485
13 Ga0070714_100076502 3300005435 Bacteria 2906
14 Ga0070710_11026870 3300005437 Bacteria 602
15 Ga0070701_10160274 3300005438 Bacteria 1302
16 Ga0070711_100240267 3300005439 Bacteria 1416
17 Ga0070711_100263423 3300005439 Bacteria 1357
18 Ga0070663_100023783 3300005455 Bacteria 4112
19 Ga0070678_100011340 3300005456 Bacteria 5491
20 Ga0070678_100037737 3300005456 Bacteria 3395
21 Ga0068867_100766828 3300005459 Unclassified 857
22 Ga0070697_100067843 3300005536 Bacteria 2919
23 Ga0070693_100215752 3300005547 Bacteria 1254
24 Ga0068855_100166017 3300005563 Bacteria 2503
25 Ga0068854_100056412 3300005578 Bacteria 2831
26 Ga0068856_100000413 3300005614 Bacteria 47108
27 Ga0068852_100268932 3300005616 Bacteria 1639
28 Ga0068859_100104034 3300005617 Bacteria 2898
29 Ga0068870_10195862 3300005840 Bacteria 1222
30 Ga0068863_100254591 3300005841 Bacteria 1696
31 Ga0068858_100906107 3300005842 Bacteria 862
32 Ga0068860_100000251 3300005843 Bacteria 79943
33 Ga0081455_10106680 3300005937 Bacteria 2235
34 Ga0081540_1001325 3300005983 Bacteria 21608
35 Ga0081540_1002272 3300005983 Bacteria 15794
36 Ga0081540_1032229 3300005983 Bacteria 2866
37 Ga0081540_1048017 3300005983 Bacteria 2142
38 Ga0081539_10000229 3300005985 Bacteria 131455
39 Ga0081539_10002776 3300005985 Bacteria 23545
40 Ga0081539_10111639 3300005985 Bacteria 1375
41 Ga0070717_10026889 3300006028 Bacteria 4595
42 Ga0070717_11070125 3300006028 Bacteria 734
43 Ga0070716_100104884 3300006173 Bacteria 1741
44 Ga0070716_100273959 3300006173 Bacteria 1161
45 Ga0070712_100026520 3300006175 Bacteria 3861
46 Ga0070712_100064131 3300006175 Bacteria 2604
47 Ga0075367_10338744 3300006178 Bacteria 949
48 Ga0097621_100084158 3300006237 Bacteria 2651
49 Ga0068871_100691777 3300006358 Bacteria 934
50 Ga0068871_101330830 3300006358 Bacteria 676
51 Ga0075434_101129593 3300006871 Bacteria 796
52 Ga0068865_100357953 3300006881 Bacteria 1184
53 Ga0097620_100104031 3300006931 Bacteria 2898
54 Ga0075435_101058305 3300007076 Bacteria 709
55 Ga0099794_10012877 3300007265 Bacteria 3625
56 Ga0099794_10320395 3300007265 Bacteria 804
57 Ga0099795_10097929 3300007788 Bacteria 1146
58 Ga0105240_10028257 3300009093 Bacteria 7327
59 Ga0105240_11707592 3300009093 Bacteria 657
60 Ga0105247_10029547 3300009101 Bacteria 3322
61 Ga0105243_10027662 3300009148 Bacteria 4347
62 Ga0105249_10257230 3300009553 Bacteria 1733
63 Ga0105249_10678657 3300009553 Bacteria 1089
64 Ga0105246_10340433 3300011119 Bacteria 1226
65 Ga0157371_10015375 3300013102 Bacteria 5743
66 Ga0157370_10185974 3300013104 Bacteria 1929
67 Ga0157369_11849376 3300013105 Bacteria 613
68 Ga0157378_10736965 3300013297 Bacteria 1007
69 Ga0163162_10449518 3300013306 Bacteria 1421
70 Ga0163163_10293776 3300014325 Bacteria 1677
71 Ga0157380_10264512 3300014326 Bacteria 1564
72 Ga0157380_10759731 3300014326 Bacteria 982
73 Ga0157377_10255830 3300014745 Bacteria 1137
74 Ga0157377_10513953 3300014745 Bacteria 839
75 Ga0163161_10579547 3300017792 Bacteria 923
76 Ga0209564_1000522 3300025295 Bacteria 62793
77 Ga0207688_10580948 3300025901 Bacteria 705
78 Ga0207680_10121974 3300025903 Bacteria 1706
79 Ga0207695_10076701 3300025913 Bacteria 3397
80 Ga0207693_10045819 3300025915 Bacteria 3436
81 Ga0207700_10606010 3300025928 Bacteria 975
82 Ga0207664_10016297 3300025929 Bacteria 5420
83 Ga0207669_10143194 3300025937 Bacteria 1663
84 Ga0207665_10031648 3300025939 Bacteria 3501
85 Ga0207665_10189281 3300025939 Bacteria 1494
86 Ga0207691_10125716 3300025940 Bacteria 2269
87 Ga0207679_10128530 3300025945 Bacteria 2029
88 Ga0207640_10200440 3300025981 Bacteria 1512
89 Ga0207678_10023334 3300026067 Bacteria 5410
90 Ga0207678_10581961 3300026067 Bacteria 981
91 Ga0207702_10000627 3300026078 Bacteria 38862
92 Ga0207641_10343049 3300026088 Bacteria 1422
93 Ga0207641_11299247 3300026088 Bacteria 728
94 Ga0207683_10077790 3300026121 Bacteria 2939
95 Ga0207683_10266818 3300026121 Bacteria 1563
96 Ga0207683_10809509 3300026121 Bacteria 870
97 Ga0209588_1002640 3300027671 Bacteria 4887
98 Ga0209588_1159978 3300027671 Bacteria 711
99 Ga0268264_10000051 3300028381 Bacteria 321565
100 Ga0265332_10043774 3300031238 Bacteria 1932
101 Ga0265328_10230039 3300031239 Bacteria 707
102 Ga0265325_10008912 3300031241 Bacteria 5894
103 Ga0265339_10229994 3300031249 Bacteria 904
104 Ga0265316_10062103 3300031344 Bacteria 2900
105 Ga0307513_10784858 3300031456 Bacteria 658
106 Ga0307509_10200901 3300031507 Bacteria 1831
107 Ga0307509_10490819 3300031507 Bacteria 914
108 Ga0307508_10132619 3300031616 Bacteria 2095
109 Ga0265314_10035979 3300031711 Bacteria 3603
110 Ga0265342_10055031 3300031712 Bacteria 2363
111 Ga0265342_10083077 3300031712 Bacteria 1847
112 Ga0307516_10219653 3300031730 Bacteria 1610
113 Ga0307510_10460422 3300033180 Bacteria 713
114 Ga0373934_0018771 3300035086 Bacteria 2649
115 Ga0373934_0043962 3300035086 Bacteria 1765
116 Ga0373944_0061361 3300035089 Bacteria 1207
117 Ga0373923_0011441 3300035111 Bacteria 3254
118 Ga0373923_0076265 3300035111 Bacteria 1447
119 Ga0373923_0085566 3300035111 Bacteria 1373
120 Ga0373923_0581062 3300035111 Bacteria 551
121 Ga0373953_0006716 3300035117 Bacteria 3809
122 Ga0373953_0026483 3300035117 Bacteria 2221
123 Ga0373954_0000595 3300035118 Bacteria 13724
124 Ga0373954_0020042 3300035118 Bacteria 3021
125 Ga0373954_0227224 3300035118 Bacteria 918
126 Ga0373954_0567931 3300035118 Bacteria 562
127 Ga0373956_0001820 3300035119 Bacteria 8808
128 Ga0373956_0025164 3300035119 Bacteria 2570
129 Ga0373957_0008693 3300035120 Bacteria 3302
130 Ga0373957_0020412 3300035120 Bacteria 2340
131 Ga0373960_0145921 3300035121 Bacteria 805
132 Ga0373943_0039150 3300035170 Bacteria 2283
133 Ga0373955_0001160 3300035172 Bacteria 11184
134 Ga0373955_0099260 3300035172 Bacteria 1669
135 Ga0373924_0006485 3300035410 Bacteria 4192
136 Ga0373924_0365602 3300035410 Bacteria 643
137 Ga0373931_0296605 3300035691 Bacteria 997
138 Ga0373935_0002324 3300035692 Bacteria 10853
139 Ga0373935_0019114 3300035692 Bacteria 4177
140 Ga0373935_0397413 3300035692 Bacteria 989
141 Ga0373927_0027155 3300035695 Bacteria 3739
142 Ga0373927_0530397 3300035695 Bacteria 778
143 Ga0373933_0000290 3300035724 Bacteria 32568
144 Ga0373933_0003732 3300035724 Bacteria 8418
145 Ga0373933_0141094 3300035724 Bacteria 1521
146 Ga0373947_0006994 3300035725 Bacteria 6538
147 Ga0373947_0105240 3300035725 Bacteria 1778
148 Ga0373937_0009343 3300036401 Bacteria 8515
149 Ga0373937_0078481 3300036401 Bacteria 3051
150 Ga0373937_0161186 3300036401 Bacteria 2103
151 Ga0373937_0270902 3300036401 Bacteria 1602
152 Ga0373937_1942990 3300036401 Bacteria 534
153 Ga0372808_060073 3300036459 Bacteria 546
154 Ga0373925_0020742 3300037068 Bacteria 4788
155 Ga0373925_0797313 3300037068 Bacteria 779
156 Ga0395900_0255149 3300037418 Bacteria 1753
157 Ga0436362_0436579 3300039453 Bacteria 726
158 Ga0466966_0019663 3300044684 Bacteria 4443
159 Ga0466963_0246598 3300044694 Bacteria 1253
160 Ga0466967_0241301 3300045976 Bacteria 1724
161 Ga0495592_0041974 3300046454 Bacteria 3426
162 Ga0495592_0058107 3300046454 Bacteria 2853
163 Ga0495592_0112456 3300046454 Bacteria 1925
164 Ga0495603_0001793 3300046455 Bacteria 12674
165 Ga0495603_0184147 3300046455 Bacteria 1208
166 Ga0495629_0000539 3300046459 Bacteria 31196
167 Ga0495629_0002134 3300046459 Bacteria 15342
168 Ga0495629_0104942 3300046459 Bacteria 1971
169 Ga0495638_0030566 3300046460 Bacteria 3466
170 Ga0495638_0451814 3300046460 Bacteria 656
171 Ga0495651_0051032 3300046462 Bacteria 3190
172 Ga0495651_0250279 3300046462 Bacteria 1210
173 Ga0495653_0000647 3300046463 Bacteria 26558
174 Ga0495653_0127858 3300046463 Bacteria 1802
175 Ga0495580_0036016 3300046472 Bacteria 3556
176 Ga0495639_0000442 3300046475 Bacteria 19757
177 Ga0495662_0001304 3300046476 Bacteria 12336
178 Ga0495662_0339291 3300046476 Bacteria 739
179 Ga0495664_0061423 3300046477 Bacteria 2237
180 Ga0495664_0136774 3300046477 Bacteria 1485
181 Ga0495664_0227253 3300046477 Bacteria 1129
182 Ga0495584_0192794 3300046491 Bacteria 1036
183 Ga0495594_0000326 3300046499 Bacteria 23640
184 Ga0495606_0263605 3300046507 Bacteria 950
185 Ga0495608_0004413 3300046511 Bacteria 10072
186 Ga0495628_0044714 3300046516 Bacteria 3522
187 Ga0495628_0242006 3300046516 Bacteria 1349
188 Ga0495628_0328554 3300046516 Bacteria 1127
189 Ga0495630_0008388 3300046517 Bacteria 7411
190 Ga0495630_0806728 3300046517 Bacteria 716
191 Ga0495631_0233357 3300046518 Bacteria 785
192 Ga0495643_0207248 3300046522 Bacteria 938
193 Ga0495666_0063890 3300046526 Bacteria 1757
194 Ga0495652_0005561 3300046529 Bacteria 11853
195 Ga0495652_0191801 3300046529 Bacteria 1559
196 Ga0495652_0208838 3300046529 Bacteria 1476
197 Ga0495652_0328016 3300046529 Bacteria 1103
198 Ga0495665_0003187 3300046531 Bacteria 8884
199 Ga0495640_0023784 3300046533 Bacteria 4457
200 Ga0495640_0037278 3300046533 Bacteria 3431
201 Ga0495587_0036492 3300046536 Bacteria 2956
202 Ga0495645_0014376 3300046543 Bacteria 5616
203 Ga0495645_0031829 3300046543 Bacteria 3845
204 Ga0495622_0006557 3300046557 Bacteria 5399
205 Ga0495622_0040572 3300046557 Bacteria 2166
206 Ga0495667_0001481 3300046559 Bacteria 15461
207 Ga0495667_0101960 3300046559 Bacteria 1856
208 Ga0495634_0001414 3300046642 Bacteria 21458
209 Ga0495634_0099488 3300046642 Bacteria 1880
210 Ga0495634_0115880 3300046642 Bacteria 1719
211 Ga0495625_0385962 3300046660 Bacteria 878
212 Ga0495635_0003883 3300046663 Bacteria 10385
213 Ga0495635_0004531 3300046663 Bacteria 9628
214 Ga0495635_0173413 3300046663 Bacteria 1466
215 Ga0495588_0011200 3300046674 Bacteria 4202
216 Ga0495588_0209333 3300046674 Bacteria 1030
217 Ga0495657_0003293 3300046675 Bacteria 13257
218 Ga0495657_0060289 3300046675 Bacteria 2514
219 Ga0495599_0002192 3300046678 Bacteria 11346
220 Ga0495623_0030552 3300046679 Bacteria 3466
221 Ga0495623_0163267 3300046679 Bacteria 1307
222 Ga0495646_0012783 3300046680 Bacteria 5335
223 Ga0495646_0027705 3300046680 Bacteria 3552
224 Ga0495658_0007062 3300046683 Bacteria 5543
225 Ga0495613_0011725 3300046689 Bacteria 6514
226 Ga0495613_0023321 3300046689 Bacteria 4610
227 Ga0495624_0009575 3300046690 Bacteria 6707
228 Ga0495600_0047705 3300046809 Bacteria 2794
229 Ga0495600_0124094 3300046809 Bacteria 1679
230 Ga0495581_0005238 3300047315 Bacteria 7499
231 Ga0495581_0040387 3300047315 Bacteria 2700
232 Ga0495581_0175562 3300047315 Bacteria 1253
233 Ga0495604_0048514 3300047317 Bacteria 3303
234 Ga0495604_0064434 3300047317 Bacteria 2792
235 Ga0495674_0000879 3300047319 Bacteria 28789
236 Ga0495674_0242076 3300047319 Bacteria 1486
237 Ga0495676_0109537 3300047321 Bacteria 2029
238 Ga0495680_0011023 3300047322 Bacteria 8031
239 Ga0495675_0001613 3300047444 Bacteria 13553
240 Ga0495675_0030727 3300047444 Bacteria 3427
241 Ga0495673_0021978 3300047469 Bacteria 3135
242 Ga0495681_0297911 3300047470 Bacteria 625
243 Ga0495684_0000481 3300047471 Bacteria 32605
244 Ga0495684_0048742 3300047471 Bacteria 3238
245 Ga0495593_0000870 3300047673 Bacteria 17498
246 Ga0495593_0001040 3300047673 Bacteria 16301
247 Ga0495602_0067903 3300048088 Bacteria 3064
248 Ga0495614_0044466 3300048089 Bacteria 1905
249 Ga0496100_0035213 3300048903 Bacteria 3148
250 Ga0496100_0134040 3300048903 Bacteria 1748
251 Ga0496101_0449842 3300048904 Bacteria 1016
252 Ga0496102_0241961 3300048905 Bacteria 1701
253 Ga0496104_0089910 3300048907 Bacteria 2934
254 Ga0496106_0002525 3300048909 Bacteria 13632
255 Ga0496107_0020795 3300048910 Bacteria 4637
256 Ga0496107_0867330 3300048910 Bacteria 659
257 Ga0496108_0000980 3300048911 Bacteria 22218
258 Ga0496109_0002687 3300048912 Bacteria 14913
259 Ga0496110_0007497 3300048913 Bacteria 8718
260 Ga0496112_0000127 3300048915 Bacteria 47440
261 Ga0496112_0001595 3300048915 Bacteria 17524
262 Ga0496114_0165117 3300048917 Bacteria 1927
263 Ga0496114_0753196 3300048917 Bacteria 851
264 Ga0496115_0241732 3300048918 Bacteria 1488
265 Ga0496121_0346760 3300048924 Bacteria 990
266 Ga0496122_0125545 3300048925 Bacteria 1643
267 Ga0496123_0090073 3300048926 Bacteria 1825
268 Ga0496124_0135360 3300048927 Bacteria 1951
269 Ga0496124_0189951 3300048927 Bacteria 1573
270 Ga0496124_0357643 3300048927 Bacteria 1030
271 Ga0496126_0004847 3300048929 Bacteria 15764
272 Ga0496126_0008705 3300048929 Bacteria 10897
273 Ga0496126_0868082 3300048929 Bacteria 687
274 Ga0501031_0000072 3300049568 Bacteria 53648
275 Ga0501031_0046609 3300049568 Bacteria 2826
276 Ga0501032_0000110 3300049569 Bacteria 70189
277 Ga0501032_0016128 3300049569 Bacteria 5258
278 Ga0501033_0000562 3300049570 Bacteria 34520
279 Ga0501033_0010192 3300049570 Bacteria 7215
280 Ga0501034_0000181 3300049571 Bacteria 117767
281 Ga0501034_0226301 3300049571 Bacteria 1821
282 Ga0501034_0895937 3300049571 Bacteria 775
283 Ga0501036_0000520 3300049572 Bacteria 27514
284 Ga0501036_0046069 3300049572 Bacteria 3693
285 Ga0501037_0000059 3300049573 Bacteria 101459
286 Ga0501037_0013465 3300049573 Bacteria 6023
287 Ga0501037_0105699 3300049573 Bacteria 2029
288 Ga0501038_0001227 3300049574 Bacteria 23238
289 Ga0501038_0058649 3300049574 Bacteria 3299
290 Ga0501039_0000400 3300049575 Bacteria 31170
291 Ga0501039_0003873 3300049575 Bacteria 11231
292 Ga0501039_0056975 3300049575 Bacteria 3027
293 Ga0501039_0575371 3300049575 Bacteria 883
294 Ga0501041_0685747 3300049577 Bacteria 655
295 Ga0501042_0038298 3300049578 Bacteria 3406
296 Ga0501043_0000188 3300049579 Bacteria 56057
297 Ga0501043_0034143 3300049579 Bacteria 4001
298 Ga0501043_0761905 3300049579 Bacteria 703
299 Ga0501046_0000153 3300049580 Bacteria 71187
300 Ga0501046_0038533 3300049580 Bacteria 3834
301 Ga0501047_0000230 3300049581 Bacteria 66338
302 Ga0501047_1073899 3300049581 Bacteria 618
303 Ga0501048_0002647 3300049582 Bacteria 13682
304 Ga0501048_0989480 3300049582 Bacteria 605
305 Ga0501067_0001021 3300049583 Bacteria 15051
306 Ga0501067_0090118 3300049583 Bacteria 1702
307 Ga0501068_0001646 3300049584 Bacteria 11935
308 Ga0501069_0027547 3300049585 Bacteria 3113
309 Ga0501070_0002402 3300049586 Bacteria 16428
310 Ga0501071_0049760 3300049587 Bacteria 3017
311 Ga0501072_0004590 3300049588 Bacteria 10515
312 Ga0501073_0000055 3300049589 Bacteria 71726
313 Ga0501074_0000156 3300049590 Bacteria 35744
314 Ga0501076_0225300 3300049592 Bacteria 1532
315 Ga0501079_0008674 3300049741 Bacteria 7709
316 Ga0501080_0006191 3300049742 Bacteria 10738
317 Ga0501081_0082026 3300049743 Bacteria 2259
318 Ga0501083_0001069 3300049744 Bacteria 18274
319 Ga0501035_0014687 3300049822 Bacteria 7229
320 Ga0501035_1317873 3300049822 Bacteria 556
321 Ga0501044_0000716 3300049823 Bacteria 40010
322 Ga0501044_0042473 3300049823 Bacteria 4728
323 Ga0501045_0109721 3300049824 Bacteria 2045
324 nmdc:mga0n895_206227_c1 3300050512 Bacteria 1996
325 nmdc:mga0rr50_142809_c1 3300050513 Bacteria 1927
326 nmdc:mga0sz30_98267_c1 3300050516 Bacteria 1277
327 Ga0495601_0056960 3300053077 Bacteria 2475
328 Ga0495601_0207752 3300053077 Bacteria 1279
329 Ga0495601_0288612 3300053077 Bacteria 1069
330 Ga0495601_0453651 3300053077 Bacteria 829
331 Ga0495601_0583511 3300053077 Bacteria 718
332 Ga0495595_0003736 3300053084 Bacteria 6053
333 Ga0495595_0041058 3300053084 Bacteria 2115
334 Ga0495619_0001635 3300053085 Bacteria 14776
335 Ga0495619_0061206 3300053085 Bacteria 2504
336 Ga0495619_0075847 3300053085 Bacteria 2257
337 Ga0495619_0162328 3300053085 Bacteria 1544
338 Ga0500647_0116712 3300053091 Bacteria 1265
339 Ga0500651_0001724 3300053093 Bacteria 11198
340 Ga0500592_020143 3300053116 Bacteria 1074
341 Ga0500595_020283 3300053119 Bacteria 2396
342 Ga0500595_037978 3300053119 Bacteria 1567
343 Ga0500597_116452 3300053120 Bacteria 1159
344 Ga0500642_0001560 3300053130 Bacteria 6596
345 Ga0500568_0024688 3300053139 Bacteria 2543
346 Ga0500616_0000046 3300053153 Bacteria 333409
347 Ga0500636_0007988 3300053177 Bacteria 6122
348 Ga0500637_0299834 3300053178 Bacteria 877
349 Ga0501084_0009470 3300054114 Bacteria 8060
350 2507505770 2507262055 Bacteria 8048963
351 2508539964 2508501009 Bacteria 7784016
352 2508696031 2508501042 Bacteria 8719808
353 2509150755 2508501128 Bacteria 8613869
354 2511398891 2511231028 Bacteria 8046582
355 2513625664 2513237092 Bacteria 8341956
356 2513641738 2513237094 Bacteria 8789602
357 2513649419 2513237095 Bacteria 8976980
358 2513701264 2513237102 Bacteria 7703324
359 2513715518 2513237104 Bacteria 10034502
360 2513874077 2513237139 Bacteria 8737671
361 2513890588 2513237141 Bacteria 8496279
362 2514010151 2513237161 Bacteria 8871253
363 2515627707 2515154112 Bacteria 8294334
364 2517105826 2517093001 Bacteria 9002274
365 2528851131 2528768022 Bacteria 10457665
366 2617350206 2617270735 Bacteria 9163226
367 2617374291 2617270741 Bacteria 8201522
368 2723849070 2721755755 Bacteria 8322773
369 2728753941 2728368998 Bacteria 8720350
370 2745079817 2744054633 Bacteria 8678936
371 2793059200 2791355196 Bacteria 7323613
372 2805920434 2802429603 Bacteria 8777136
373 2818237097 2816332527 Bacteria 8933356
374 2824603571 2824600985 Bacteria 8488197
375 2824610962 2824609381 Bacteria 8672835
376 2824618712 2824617872 Bacteria 8814715
377 2824628818 2824626560 Bacteria 8813858
378 2824638123 2824635225 Bacteria 8785348
379 2824648010 2824644064 Bacteria 8743947
380 2824654015 2824653114 Bacteria 8493680
381 2824667649 2824661429 Bacteria 9877870
382 2824674518 2824671348 Bacteria 8369588
383 2824682127 2824679649 Bacteria 8248951
384 2824691142 2824687955 Bacteria 8360029
385 2824698588 2824696289 Bacteria 8335049
386 2824708260 2824704595 Bacteria 9667483
387 2824717787 2824714736 Bacteria 8717648
388 2824726180 2824723954 Bacteria 8758240
389 2824735660 2824732956 Bacteria 7810675
390 2824751224 2824746037 Bacteria 7911610
391 2824754888 2824753945 Bacteria 9787441
392 2824765258 2824763712 Bacteria 9792355
393 2824778099 2824773399 Bacteria 8360218
394 2838125936 2838122688 Bacteria 8803140
395 2841942670 2841941048 Bacteria 8688029
396 2841952979 2841949485 Bacteria 8680857
397 2841963407 2841957949 Bacteria 8652217
398 2841970994 2841966195 Bacteria 8673214
399 2841977748 2841974524 Bacteria 8931498
400 2841984690 2841983080 Bacteria 8395090
401 2842041586 2842038055 Bacteria 8002051
402 2842049628 2842045827 Bacteria 8006841
403 2844321626 2844315083 Bacteria 8138177
404 2847939610 2847930680 Bacteria 9342022
405 2847943112 2847939898 Bacteria 8606328
406 2849076858 2849076700 Bacteria 7039503
407 2857513192 2857509624 Bacteria 7472071
408 2874593804 2874590934 Bacteria 8299676
409 2874620481 2874612657 Bacteria 8252029
410 2874621969 2874620515 Bacteria 8290088
411 2874629371 2874628541 Bacteria 8630250
412 2874648043 2874645413 Bacteria 8214782
413 2876772029 2876771140 Bacteria 8287509
414 2876826376 2876818435 Bacteria 8274608
415 2879077591 2879074833 Bacteria 8279565
416 2879091393 2879083081 Bacteria 8587928
417 2879105457 2879099564 Bacteria 10442239
418 2879134328 2879127579 Bacteria 8294491
419 2879147285 2879142872 Bacteria 8267021
420 2881364522 2881364244 Bacteria 7710352
421 2881666136 2881665667 Bacteria 8175609
422 2885369112 2885366525 Bacteria 8326213
423 2885418675 2885409591 Bacteria 9235467
424 2888380193 2888378607 Bacteria 9652610
425 2888390101 2888388044 Bacteria 7304136
426 2888420952 2888419890 Bacteria 7857137
427 2903727799 2903727486 Bacteria 8281579
428 2904669438 2904666416 Bacteria 8226587
429 2904714446 2904711408 Bacteria 9771557
430 2906602716 2906602504 Bacteria 8295279
431 2906634737 2906626472 Bacteria 8826946
432 2906644553 2906643746 Bacteria 8722424
433 2908776770 2908775508 Bacteria 8092255
434 2922377669
435 2922391835 2922386360 Bacteria 7017218
436 2922400198 2922393267 Bacteria 8285685
437 2929623361 2929615660 Bacteria 9193770
438 2929632547 2929624759 Bacteria 9339455
439 2932788166 2932784394 Bacteria 9704911
440 2932794871 2932794094 Bacteria 7915132
441 2932805335 2932801729 Bacteria 7987968
442 2932813537 2932809354 Bacteria 9135765
443 2932820234 2932818245 Bacteria 9955613
444 2932832699 2932828146 Bacteria 9745859
445 2933585266 2933577622 Bacteria 9116884
446 2935614821 2935608549 Bacteria 8203142
447 2935620189 2935616580 Bacteria 9032984
448 2935640508 2935638405 Bacteria 10015038
449 2935649220 2935648319 Bacteria 8801166
450 2935658008 2935656913 Bacteria 8965014
451 2935668701 2935665750 Bacteria 9571747
452 2935682003 2935675223 Bacteria 9928132
453 2935687009 2935684952 Bacteria 9590419
454 2935697021 2935694250 Bacteria 9291695
455 2935709789 2935703347 Bacteria 10242284
456 2935716697 2935713505 Bacteria 9608509
457 2935723178 2935722832 Bacteria 9608746
458 2935734735 2935732158 Bacteria 9706831
459 2935744474 2935741537 Bacteria 9707219
460 2935752975 2935750917 Bacteria 9590372
461 2935766873 2935760218 Bacteria 9817913
462 2935775626 2935769743 Bacteria 7878163
463 2935777922 2935777560 Bacteria 8077691
464 2935791321 2935785616 Bacteria 7962367
465 2935799633 2935793552 Bacteria 8012592
466 2935804621 2935801545 Bacteria 9301974
467 2935815774 2935810662 Bacteria 9401221
468 2935826139 2935819856 Bacteria 8261050
469 2935832014 2935827899 Bacteria 10038562
470 2935841155 2935837841 Bacteria 9454360
471 2935853635 2935847175 Bacteria 8228321
472 2935859075 2935855204 Bacteria 9035059
473 2935864256 2935864058 Bacteria 9784707
474 2935875392 2935873716 Bacteria 9632195
475 2935887582 2935883170 Bacteria 7964738
476 2935910857 2935908558 Bacteria 8568796
477 2935922039 2935916978 Bacteria 9113783
478 2935929824 2935926038 Bacteria 8601059
479 2935937492 2935934488 Bacteria 8602579
480 2935948109 2935942939 Bacteria 8599779
481 2935957670 2935951376 Bacteria 8602333
482 2935964324 2935959822 Bacteria 7869783
483 2935971051 2935967501 Bacteria 8603075
484 2935978372 2935975950 Bacteria 8347125
485 2935985497 2935984226 Bacteria 8302647
486 2935995630 2935992306 Bacteria 9802711
487 2936008049 2936002035 Bacteria 9362176
488 2936012227 2936011229 Bacteria 8801034
489 2936020692 2936019824 Bacteria 8804134
490 2936029520 2936028420 Bacteria 8965941
491 2936041676 2936037263 Bacteria 9446081
492 2936048156 2936046547 Bacteria 8903709
493 2936056733 2936055302 Bacteria 8785755
494 2940558888 2940556831 Bacteria 9590747
495 2941532190 2941531003 Bacteria 7653939
496 2941541583 2941538514 Bacteria 9402094
497 3005490931 3005483717 Bacteria 7877331
498 3005506474 3005506211 Bacteria 6943378
499 3005594314 3005587118 Bacteria 7794411
500 3005602003 3005594810 Bacteria 8716512
501 3005717735 3005710791 Bacteria 7622528
502 3005724783 3005718088 Bacteria 8283608
503 8006929206 8006926726 Bacteria 6749210
504 8016517531 8016511872 Bacteria 9921665
505 8016526784 8016522445 Bacteria 8156687
506 8016531874 8016530956 Bacteria 8155261
507 8016557001 8016548790 Bacteria 8155074
508 8016565350 8016557553 Bacteria 8154380
509 8016570150 8016566248 Bacteria 8158151
510 8016582718 8016575299 Bacteria 8154085
511 8016585600 8016583857 Bacteria 10421953
512 8016602990 8016595262 Bacteria 8149947
513 8016617779 8016613128 Bacteria 8794220
514 8016623796 8016622563 Bacteria 7999408
515 8016635062 8016630954 Bacteria 9217207
516 8017059087 8017057580 Bacteria 10023680
517 8019531695 8019530166 Bacteria 8155624
518 8019539837 8019538911 Bacteria 7872763
519 8019550816 8019547302 Bacteria 7996444
520 8019576550 8019576017 Bacteria 10049540
521 8019594423 8019586578 Bacteria 10212056
522 8019607136 8019597564 Bacteria 10041141
523 8019611371 8019608314 Bacteria 10042931
524 8019622130 8019619141 Bacteria 9218857
525 8019631182 8019629233 Bacteria 8687553
526 8019639436 8019638758 Bacteria 9062356
527 8019667990 8019659431 Bacteria 8577854
528 8019677410 8019668869 Bacteria 8791617
529 8019687542 8019678201 Bacteria 8863603
530 8019695633 8019687851 Bacteria 8712826
531 8055743305 8055742211 Bacteria 9226248
532 8056975504 8056967851 Bacteria 9038162
533 Ga0105242_11932820
534 JGI25406J46586_10000076
535 JGI25406J46586_10006251
536 rootL2_10221282
537 JGI25404J52841_10029542
538 Ga0070666_10128761
539 Ga0070660_100078864
540 Ga0070661_100144607
541 Ga0070688_100197611
542 Ga0070688_100465650
543 Ga0070659_100276002
544 Ga0070667_100284565
545 Ga0070714_100076502
546 Ga0070710_11026870
547 Ga0070701_10160274
548 Ga0070711_100240267
549 Ga0070711_100263423
550 Ga0070663_100023783
551 Ga0070678_100011340
552 Ga0070678_100037737
553 Ga0068867_100766828
554 Ga0070697_100067843
555 Ga0070693_100215752
556 Ga0068855_100166017
557 Ga0068854_100056412
558 Ga0068856_100000413
559 Ga0068852_100268932
560 Ga0068859_100104034
561 Ga0068870_10195862
562 Ga0068863_100254591
563 Ga0068858_100906107
564 Ga0068860_100000251
565 Ga0081455_10106680
566 Ga0081540_1001325
567 Ga0081540_1002272
568 Ga0081540_1032229
569 Ga0081540_1048017
570 Ga0081539_10000229
571 Ga0081539_10002776
572 Ga0081539_10111639
573 Ga0070717_10026889
574 Ga0070717_11070125
575 Ga0070716_100104884
576 Ga0070716_100273959
577 Ga0070712_100026520
578 Ga0070712_100064131
579 Ga0075367_10338744
580 Ga0097621_100084158
581 Ga0068871_100691777
582 Ga0068871_101330830
583 Ga0075434_101129593
584 Ga0068865_100357953
585 Ga0097620_100104031
586 Ga0075435_101058305
587 Ga0099794_10012877
588 Ga0099794_10320395
589 Ga0099795_10097929
590 Ga0105240_10028257
591 Ga0105240_11707592
592 Ga0105247_10029547
593 Ga0105243_10027662
594 Ga0105249_10257230
595 Ga0105249_10678657
596 Ga0105246_10340433
597 Ga0157371_10015375
598 Ga0157370_10185974
599 Ga0157369_11849376
600 Ga0157378_10736965
601 Ga0163162_10449518
602 Ga0163163_10293776
603 Ga0157380_10264512
604 Ga0157380_10759731
605 Ga0157377_10255830
606 Ga0157377_10513953
607 Ga0163161_10579547
608 Ga0209564_1000522
609 Ga0207688_10580948
610 Ga0207680_10121974
611 Ga0207695_10076701
612 Ga0207693_10045819
613 Ga0207700_10606010
614 Ga0207664_10016297
615 Ga0207669_10143194
616 Ga0207665_10031648
617 Ga0207665_10189281
618 Ga0207691_10125716
619 Ga0207679_10128530
620 Ga0207640_10200440
621 Ga0207678_10023334
622 Ga0207678_10581961
623 Ga0207702_10000627
624 Ga0207641_10343049
625 Ga0207641_11299247
626 Ga0207683_10077790
627 Ga0207683_10266818
628 Ga0207683_10809509
629 Ga0209588_1002640
630 Ga0209588_1159978
631 Ga0268264_10000051
632 Ga0265332_10043774
633 Ga0265328_10230039
634 Ga0265325_10008912
635 Ga0265339_10229994
636 Ga0265316_10062103
637 Ga0307513_10784858
638 Ga0307509_10200901
639 Ga0307509_10490819
640 Ga0307508_10132619
641 Ga0265314_10035979
642 Ga0265342_10055031
643 Ga0265342_10083077
644 Ga0307516_10219653
645 Ga0307510_10460422
646 Ga0373934_0018771
647 Ga0373934_0043962
648 Ga0373944_0061361
649 Ga0373923_0011441
650 Ga0373923_0076265
651 Ga0373923_0085566
652 Ga0373923_0581062
653 Ga0373953_0006716
654 Ga0373953_0026483
655 Ga0373954_0000595
656 Ga0373954_0020042
657 Ga0373954_0227224
658 Ga0373954_0567931
659 Ga0373956_0001820
660 Ga0373956_0025164
661 Ga0373957_0008693
662 Ga0373957_0020412
663 Ga0373960_0145921
664 Ga0373943_0039150
665 Ga0373955_0001160
666 Ga0373955_0099260
667 Ga0373924_0006485
668 Ga0373924_0365602
669 Ga0373931_0296605
670 Ga0373935_0002324
671 Ga0373935_0019114
672 Ga0373935_0397413
673 Ga0373927_0027155
674 Ga0373927_0530397
675 Ga0373933_0000290
676 Ga0373933_0003732
677 Ga0373933_0141094
678 Ga0373947_0006994
679 Ga0373947_0105240
680 Ga0373937_0009343
681 Ga0373937_0078481
682 Ga0373937_0161186
683 Ga0373937_0270902
684 Ga0373937_1942990
685 Ga0372808_060073
686 Ga0373925_0020742
687 Ga0373925_0797313
688 Ga0395900_0255149
689 Ga0436362_0436579
690 Ga0466966_0019663
691 Ga0466963_0246598
692 Ga0466967_0241301
693 Ga0495592_0041974
694 Ga0495592_0058107
695 Ga0495592_0112456
696 Ga0495603_0001793
697 Ga0495603_0184147
698 Ga0495629_0000539
699 Ga0495629_0002134
700 Ga0495629_0104942
701 Ga0495638_0030566
702 Ga0495638_0451814
703 Ga0495651_0051032
704 Ga0495651_0250279
705 Ga0495653_0000647
706 Ga0495653_0127858
707 Ga0495580_0036016
708 Ga0495639_0000442
709 Ga0495662_0001304
710 Ga0495662_0339291
711 Ga0495664_0061423
712 Ga0495664_0136774
713 Ga0495664_0227253
714 Ga0495584_0192794
715 Ga0495594_0000326
716 Ga0495606_0263605
717 Ga0495608_0004413
718 Ga0495628_0044714
719 Ga0495628_0242006
720 Ga0495628_0328554
721 Ga0495630_0008388
722 Ga0495630_0806728
723 Ga0495631_0233357
724 Ga0495643_0207248
725 Ga0495666_0063890
726 Ga0495652_0005561
727 Ga0495652_0191801
728 Ga0495652_0208838
729 Ga0495652_0328016
730 Ga0495665_0003187
731 Ga0495640_0023784
732 Ga0495640_0037278
733 Ga0495587_0036492
734 Ga0495645_0014376
735 Ga0495645_0031829
736 Ga0495622_0006557
737 Ga0495622_0040572
738 Ga0495667_0001481
739 Ga0495667_0101960
740 Ga0495634_0001414
741 Ga0495634_0099488
742 Ga0495634_0115880
743 Ga0495625_0385962
744 Ga0495635_0003883
745 Ga0495635_0004531
746 Ga0495635_0173413
747 Ga0495588_0011200
748 Ga0495588_0209333
749 Ga0495657_0003293
750 Ga0495657_0060289
751 Ga0495599_0002192
752 Ga0495623_0030552
753 Ga0495623_0163267
754 Ga0495646_0012783
755 Ga0495646_0027705
756 Ga0495658_0007062
757 Ga0495613_0011725
758 Ga0495613_0023321
759 Ga0495624_0009575
760 Ga0495600_0047705
761 Ga0495600_0124094
762 Ga0495581_0005238
763 Ga0495581_0040387
764 Ga0495581_0175562
765 Ga0495604_0048514
766 Ga0495604_0064434
767 Ga0495674_0000879
768 Ga0495674_0242076
769 Ga0495676_0109537
770 Ga0495680_0011023
771 Ga0495675_0001613
772 Ga0495675_0030727
773 Ga0495673_0021978
774 Ga0495681_0297911
775 Ga0495684_0000481
776 Ga0495684_0048742
777 Ga0495593_0000870
778 Ga0495593_0001040
779 Ga0495602_0067903
780 Ga0495614_0044466
781 Ga0496100_0035213
782 Ga0496100_0134040
783 Ga0496101_0449842
784 Ga0496102_0241961
785 Ga0496104_0089910
786 Ga0496106_0002525
787 Ga0496107_0020795
788 Ga0496107_0867330
789 Ga0496108_0000980
790 Ga0496109_0002687
791 Ga0496110_0007497
792 Ga0496112_0000127
793 Ga0496112_0001595
794 Ga0496114_0165117
795 Ga0496114_0753196
796 Ga0496115_0241732
797 Ga0496121_0346760
798 Ga0496122_0125545
799 Ga0496123_0090073
800 Ga0496124_0135360
801 Ga0496124_0189951
802 Ga0496124_0357643
803 Ga0496126_0004847
804 Ga0496126_0008705
805 Ga0496126_0868082
806 Ga0501031_0000072
807 Ga0501031_0046609
808 Ga0501032_0000110
809 Ga0501032_0016128
810 Ga0501033_0000562
811 Ga0501033_0010192
812 Ga0501034_0000181
813 Ga0501034_0226301
814 Ga0501034_0895937
815 Ga0501036_0000520
816 Ga0501036_0046069
817 Ga0501037_0000059
818 Ga0501037_0013465
819 Ga0501037_0105699
820 Ga0501038_0001227
821 Ga0501038_0058649
822 Ga0501039_0000400
823 Ga0501039_0003873
824 Ga0501039_0056975
825 Ga0501039_0575371
826 Ga0501041_0685747
827 Ga0501042_0038298
828 Ga0501043_0000188
829 Ga0501043_0034143
830 Ga0501043_0761905
831 Ga0501046_0000153
832 Ga0501046_0038533
833 Ga0501047_0000230
834 Ga0501047_1073899
835 Ga0501048_0002647
836 Ga0501048_0989480
837 Ga0501067_0001021
838 Ga0501067_0090118
839 Ga0501068_0001646
840 Ga0501069_0027547
841 Ga0501070_0002402
842 Ga0501071_0049760
843 Ga0501072_0004590
844 Ga0501073_0000055
845 Ga0501074_0000156
846 Ga0501076_0225300
847 Ga0501079_0008674
848 Ga0501080_0006191
849 Ga0501081_0082026
850 Ga0501083_0001069
851 Ga0501035_0014687
852 Ga0501035_1317873
853 Ga0501044_0000716
854 Ga0501044_0042473
855 Ga0501045_0109721
856 nmdc:mga0n895_206227_c1
857 nmdc:mga0rr50_142809_c1
858 nmdc:mga0sz30_98267_c1
859 Ga0495601_0056960
860 Ga0495601_0207752
861 Ga0495601_0288612
862 Ga0495601_0453651
863 Ga0495601_0583511
864 Ga0495595_0003736
865 Ga0495595_0041058
866 Ga0495619_0001635
867 Ga0495619_0061206
868 Ga0495619_0075847
869 Ga0495619_0162328
870 Ga0500647_0116712
871 Ga0500651_0001724
872 Ga0500592_020143
873 Ga0500595_020283
874 Ga0500595_037978
875 Ga0500597_116452
876 Ga0500642_0001560
877 Ga0500568_0024688
878 Ga0500616_0000046
879 Ga0500636_0007988
880 Ga0500637_0299834
881 Ga0501084_0009470
882 2507505770
883 2508539964
884 2508696031
885 2509150755
886 2511398891
887 2513625664
888 2513641738
889 2513649419
890 2513701264
891 2513715518
892 2513874077
893 2513890588
894 2514010151
895 2515627707
896 2517105826
897 2528851131
898 2617350206
899 2617374291
900 2723849070
901 2728753941
902 2745079817
903 2793059200
904 2805920434
905 2818237097
906 2824603571
907 2824610962
908 2824618712
909 2824628818
910 2824638123
911 2824648010
912 2824654015
913 2824667649
914 2824674518
915 2824682127
916 2824691142
917 2824698588
918 2824708260
919 2824717787
920 2824726180
921 2824735660
922 2824751224
923 2824754888
924 2824765258
925 2824778099
926 2838125936
927 2841942670
928 2841952979
929 2841963407
930 2841970994
931 2841977748
932 2841984690
933 2842041586
934 2842049628
935 2844321626
936 2847939610
937 2847943112
938 2849076858
939 2857513192
940 2874593804
941 2874620481
942 2874621969
943 2874629371
944 2874648043
945 2876772029
946 2876826376
947 2879077591
948 2879091393
949 2879105457
950 2879134328
951 2879147285
952 2881364522
953 2881666136
954 2885369112
955 2885418675
956 2888380193
957 2888390101
958 2888420952
959 2903727799
960 2904669438
961 2904714446
962 2906602716
963 2906634737
964 2906644553
965 2908776770
966 2922377669
967 2922391835
968 2922400198
969 2929623361
970 2929632547
971 2932788166
972 2932794871
973 2932805335
974 2932813537
975 2932820234
976 2932832699
977 2933585266
978 2935614821
979 2935620189
980 2935640508
981 2935649220
982 2935658008
983 2935668701
984 2935682003
985 2935687009
986 2935697021
987 2935709789
988 2935716697
989 2935723178
990 2935734735
991 2935744474
992 2935752975
993 2935766873
994 2935775626
995 2935777922
996 2935791321
997 2935799633
998 2935804621
999 2935815774
1000 2935826139
1001 2935832014
1002 2935841155
1003 2935853635
1004 2935859075
1005 2935864256
1006 2935875392
1007 2935887582
1008 2935910857
1009 2935922039
1010 2935929824
1011 2935937492
1012 2935948109
1013 2935957670
1014 2935964324
1015 2935971051
1016 2935978372
1017 2935985497
1018 2935995630
1019 2936008049
1020 2936012227
1021 2936020692
1022 2936029520
1023 2936041676
1024 2936048156
1025 2936056733
1026 2940558888
1027 2941532190
1028 2941541583
1029 3005490931
1030 3005506474
1031 3005594314
1032 3005602003
1033 3005717735
1034 3005724783
1035 8006929206
1036 8016517531
1037 8016526784
1038 8016531874
1039 8016557001
1040 8016565350
1041 8016570150
1042 8016582718
1043 8016585600
1044 8016602990
1045 8016617779
1046 8016623796
1047 8016635062
1048 8017059087
1049 8019531695
1050 8019539837
1051 8019550816
1052 8019576550
1053 8019594423
1054 8019607136
1055 8019611371
1056 8019622130
1057 8019631182
1058 8019639436
1059 8019667990
1060 8019677410
1061 8019687542
1062 8019695633
1063 8055743305
1064 8056975504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00430

ATP-synt_B

ATP synthase B/B' CF(0)

7

105

0.93

PF05405

Mt_ATP-synt_B

Mitochondrial ATP synthase B chain precursor (ATP-synt_B)

3

105

0.86

Map