F460230

General Info

Members Datasets Scaffolds Average Seq Length
532 191 532 71

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_101090489|Ga0070659_1010904891
Length 66
Sequence MTGFVVIGAIALVAGLALLVTGIRKHKAQHPKHVAMLIGGMMLTAFGFAIAYQNAAPLDLNSAGAR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
164 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
165 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
166 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 2.44
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1019907 3300001915 Bacteria 1060
2 JGI24740J21852_10034403 3300001979 Bacteria 1596
3 JGI24740J21852_10120275 3300001979 Bacteria 658
4 JGI24739J22299_10014998 3300001989 Bacteria 2817
5 JGI24739J22299_10067257 3300001989 Bacteria 1120
6 JGI24739J22299_10179874 3300001989 Bacteria 622
7 JGI24737J22298_10008400 3300001990 Bacteria 3458
8 JGI24737J22298_10046299 3300001990 Bacteria 1327
9 JGI24737J22298_10257598 3300001990 Bacteria 515
10 JGI24735J21928_10003989 3300002067 Bacteria 4994
11 JGI24735J21928_10019600 3300002067 Bacteria 2078
12 JGI24735J21928_10027277 3300002067 Bacteria 1712
13 JGI24735J21928_10028502 3300002067 Bacteria 1667
14 JGI24735J21928_10107510 3300002067 Bacteria 802
15 JGI24738J21930_10015874 3300002075 Bacteria 1597
16 JGI24744J21845_10006036 3300002077 Bacteria 2512
17 Ga0065712_10710289 3300005290 Bacteria 543
18 Ga0070658_10214329 3300005327 Bacteria 1627
19 Ga0070658_10222894 3300005327 Bacteria 1595
20 Ga0070658_10265867 3300005327 Bacteria 1457
21 Ga0070658_10349965 3300005327 Bacteria 1264
22 Ga0070658_10447712 3300005327 Bacteria 1112
23 Ga0070658_10587689 3300005327 Bacteria 965
24 Ga0070658_11078481 3300005327 Bacteria 699
25 Ga0070658_11281720 3300005327 Bacteria 636
26 Ga0070658_11505209 3300005327 Bacteria 583
27 Ga0070658_11715757 3300005327 Bacteria 543
28 Ga0070658_11751870 3300005327 Bacteria 537
29 Ga0070676_10040852 3300005328 Bacteria 2687
30 Ga0070676_10609062 3300005328 Bacteria 788
31 Ga0070683_100220989 3300005329 Bacteria 1800
32 Ga0070683_100239009 3300005329 Bacteria 1727
33 Ga0070683_100254949 3300005329 Bacteria 1669
34 Ga0070683_101437837 3300005329 Bacteria 663
35 Ga0070670_100284392 3300005331 Bacteria 1444
36 Ga0070670_100685694 3300005331 Bacteria 920
37 Ga0070670_101566290 3300005331 Bacteria 605
38 Ga0070677_10165551 3300005333 Bacteria 1041
39 Ga0070677_10743275 3300005333 Unclassified 556
40 Ga0068869_100869678 3300005334 Bacteria 778
41 Ga0070666_10245496 3300005335 Bacteria 1267
42 Ga0070666_11068635 3300005335 Bacteria 599
43 Ga0070680_100453488 3300005336 Bacteria 1095
44 Ga0070680_100521248 3300005336 Bacteria 1017
45 Ga0070680_100585101 3300005336 Bacteria 958
46 Ga0070680_100640159 3300005336 Bacteria 913
47 Ga0070680_100932102 3300005336 Bacteria 749
48 Ga0070680_101168868 3300005336 Unclassified 665
49 Ga0070682_100015848 3300005337 Bacteria 4374
50 Ga0070682_100102902 3300005337 Bacteria 1888
51 Ga0070682_101636359 3300005337 Bacteria 558
52 Ga0068868_100217194 3300005338 Bacteria 1599
53 Ga0068868_100254181 3300005338 Bacteria 1480
54 Ga0068868_102278222 3300005338 Bacteria 516
55 Ga0070660_100053540 3300005339 Bacteria 3113
56 Ga0070660_100115642 3300005339 Bacteria 2138
57 Ga0070660_100192916 3300005339 Bacteria 1650
58 Ga0070660_100212845 3300005339 Bacteria 1569
59 Ga0070660_100222217 3300005339 Bacteria 1535
60 Ga0070660_100274511 3300005339 Bacteria 1378
61 Ga0070660_100402861 3300005339 Bacteria 1131
62 Ga0070660_100423472 3300005339 Unclassified 1102
63 Ga0070660_100743314 3300005339 Bacteria 823
64 Ga0070660_100779479 3300005339 Bacteria 804
65 Ga0070660_101221180 3300005339 Bacteria 637
66 Ga0070691_10576481 3300005341 Bacteria 661
67 Ga0070691_10709570 3300005341 Bacteria 605
68 Ga0070687_100414574 3300005343 Bacteria 887
69 Ga0070661_100022422 3300005344 Bacteria 4521
70 Ga0070661_100164318 3300005344 Bacteria 1683
71 Ga0070661_100180974 3300005344 Bacteria 1604
72 Ga0070661_100245982 3300005344 Bacteria 1379
73 Ga0070661_100250482 3300005344 Bacteria 1367
74 Ga0070661_100281370 3300005344 Bacteria 1290
75 Ga0070661_100301478 3300005344 Bacteria 1247
76 Ga0070692_10130495 3300005345 Bacteria 1412
77 Ga0070692_10433143 3300005345 Bacteria 838
78 Ga0070668_100257062 3300005347 Bacteria 1451
79 Ga0070668_100532476 3300005347 Bacteria 1020
80 Ga0070669_100073091 3300005353 Bacteria 2540
81 Ga0070669_100542787 3300005353 Bacteria 968
82 Ga0070669_100800949 3300005353 Bacteria 801
83 Ga0070675_101935883 3300005354 Bacteria 544
84 Ga0070671_100292433 3300005355 Bacteria 1386
85 Ga0070671_100293187 3300005355 Bacteria 1384
86 Ga0070671_100387672 3300005355 Bacteria 1194
87 Ga0070674_100036971 3300005356 Bacteria 3281
88 Ga0070674_100048009 3300005356 Bacteria 2928
89 Ga0070674_101295249 3300005356 Unclassified 650
90 Ga0070673_100110144 3300005364 Bacteria 2282
91 Ga0070673_100123488 3300005364 Bacteria 2164
92 Ga0070673_100246106 3300005364 Bacteria 1556
93 Ga0070673_100297756 3300005364 Bacteria 1419
94 Ga0070673_100876104 3300005364 Bacteria 832
95 Ga0070659_100072653 3300005366 Bacteria 2737
96 Ga0070659_100094839 3300005366 Bacteria 2396
97 Ga0070659_100151756 3300005366 Bacteria 1890
98 Ga0070659_100172090 3300005366 Bacteria 1774
99 Ga0070659_100333800 3300005366 Bacteria 1269
100 Ga0070659_100969007 3300005366 Bacteria 745
101 Ga0070659_101023124 3300005366 Bacteria 726
102 Ga0070659_101090489 3300005366 Bacteria 703
103 Ga0070659_102085671 3300005366 Bacteria 509
104 Ga0070667_100177882 3300005367 Bacteria 1880
105 Ga0070667_100421013 3300005367 Bacteria 1217
106 Ga0070667_100853494 3300005367 Bacteria 846
107 Ga0070709_10114050 3300005434 Bacteria 1821
108 Ga0070714_100225194 3300005435 Bacteria 1725
109 Ga0070714_100613309 3300005435 Bacteria 1045
110 Ga0070705_101295171 3300005440 Bacteria 604
111 Ga0070663_100119340 3300005455 Bacteria 1990
112 Ga0070663_100242003 3300005455 Bacteria 1424
113 Ga0070663_100300083 3300005455 Bacteria 1285
114 Ga0070663_100733115 3300005455 Bacteria 842
115 Ga0070663_100749801 3300005455 Bacteria 833
116 Ga0070663_100773097 3300005455 Bacteria 822
117 Ga0070678_100573251 3300005456 Bacteria 1004
118 Ga0070678_100779592 3300005456 Unclassified 867
119 Ga0070662_100198499 3300005457 Bacteria 1591
120 Ga0070662_100198784 3300005457 Bacteria 1589
121 Ga0070662_100239595 3300005457 Bacteria 1454
122 Ga0070662_100270219 3300005457 Bacteria 1372
123 Ga0070662_100412903 3300005457 Bacteria 1115
124 Ga0070662_100870375 3300005457 Bacteria 768
125 Ga0070662_101425630 3300005457 Bacteria 597
126 Ga0070662_101632434 3300005457 Bacteria 556
127 Ga0070681_10044638 3300005458 Bacteria 4437
128 Ga0070681_10159596 3300005458 Bacteria 2178
129 Ga0070681_11354929 3300005458 Bacteria 635
130 Ga0068867_100157218 3300005459 Bacteria 1790
131 Ga0068867_100332307 3300005459 Unclassified 1263
132 Ga0070706_101089284 3300005467 Bacteria 735
133 Ga0070679_100167485 3300005530 Bacteria 2170
134 Ga0070679_100554839 3300005530 Bacteria 1093
135 Ga0070679_101528957 3300005530 Bacteria 614
136 Ga0070684_100036737 3300005535 Bacteria 4197
137 Ga0070684_100240912 3300005535 Bacteria 1652
138 Ga0070684_100691480 3300005535 Bacteria 951
139 Ga0070684_101192703 3300005535 Bacteria 716
140 Ga0070684_101743221 3300005535 Bacteria 588
141 Ga0068853_100023826 3300005539 Bacteria 5129
142 Ga0068853_100440988 3300005539 Bacteria 1224
143 Ga0068853_100623857 3300005539 Unclassified 1025
144 Ga0068853_100812904 3300005539 Bacteria 895
145 Ga0068853_101067450 3300005539 Bacteria 778
146 Ga0068853_101174917 3300005539 Bacteria 741
147 Ga0068853_101546423 3300005539 Bacteria 642
148 Ga0070672_100388650 3300005543 Bacteria 1194
149 Ga0070672_102136975 3300005543 Unclassified 505
150 Ga0070695_100502888 3300005545 Bacteria 938
151 Ga0070696_100247646 3300005546 Bacteria 1346
152 Ga0070696_101454178 3300005546 Bacteria 586
153 Ga0070693_100056882 3300005547 Bacteria 2259
154 Ga0070693_100114076 3300005547 Bacteria 1667
155 Ga0070665_100596394 3300005548 Bacteria 1118
156 Ga0070704_100411700 3300005549 Bacteria 1156
157 Ga0068855_100017128 3300005563 Bacteria 8717
158 Ga0068855_100951823 3300005563 Bacteria 904
159 Ga0068855_101085287 3300005563 Bacteria 837
160 Ga0068855_101318361 3300005563 Bacteria 747
161 Ga0068855_101641659 3300005563 Bacteria 657
162 Ga0068855_102098834 3300005563 Unclassified 569
163 Ga0070664_100103837 3300005564 Bacteria 2474
164 Ga0070664_100974593 3300005564 Bacteria 796
165 Ga0070664_101002224 3300005564 Bacteria 785
166 Ga0070664_101414634 3300005564 Bacteria 657
167 Ga0070664_101813286 3300005564 Bacteria 579
168 Ga0070664_101876313 3300005564 Bacteria 568
169 Ga0068857_100100166 3300005577 Bacteria 2599
170 Ga0068857_100168591 3300005577 Bacteria 1989
171 Ga0068857_100233449 3300005577 Bacteria 1683
172 Ga0068857_100313844 3300005577 Bacteria 1447
173 Ga0068857_100412185 3300005577 Bacteria 1258
174 Ga0068857_100568437 3300005577 Bacteria 1069
175 Ga0068857_100728440 3300005577 Bacteria 943
176 Ga0068857_101008160 3300005577 Bacteria 802
177 Ga0068857_101275640 3300005577 Bacteria 712
178 Ga0068854_100066941 3300005578 Bacteria 2615
179 Ga0068854_100225601 3300005578 Bacteria 1484
180 Ga0068854_100337121 3300005578 Bacteria 1230
181 Ga0068854_100726482 3300005578 Bacteria 859
182 Ga0068854_100815200 3300005578 Bacteria 814
183 Ga0068856_100125152 3300005614 Bacteria 2573
184 Ga0068856_101190063 3300005614 Bacteria 779
185 Ga0068856_102163153 3300005614 Bacteria 566
186 Ga0070702_101838839 3300005615 Bacteria 507
187 Ga0068852_100013430 3300005616 Bacteria 6268
188 Ga0068852_100053777 3300005616 Bacteria 3467
189 Ga0068852_100113694 3300005616 Bacteria 2465
190 Ga0068852_100163998 3300005616 Bacteria 2077
191 Ga0068852_100190180 3300005616 Bacteria 1936
192 Ga0068852_101458832 3300005616 Bacteria 706
193 Ga0068852_102565580 3300005616 Bacteria 529
194 Ga0068859_100208004 3300005617 Bacteria 2043
195 Ga0068859_100403044 3300005617 Unclassified 1464
196 Ga0068864_100346531 3300005618 Bacteria 1400
197 Ga0068864_101333062 3300005618 Bacteria 718
198 Ga0068866_10338035 3300005718 Bacteria 953
199 Ga0068866_10536439 3300005718 Unclassified 780
200 Ga0068851_10087883 3300005834 Bacteria 1633
201 Ga0068851_10286396 3300005834 Bacteria 944
202 Ga0068851_10355921 3300005834 Bacteria 853
203 Ga0068870_10176533 3300005840 Unclassified 1279
204 Ga0068863_100073857 3300005841 Bacteria 3226
205 Ga0068863_101312075 3300005841 Bacteria 731
206 Ga0068863_101910080 3300005841 Bacteria 604
207 Ga0068858_100529469 3300005842 Bacteria 1140
208 Ga0068860_100137905 3300005843 Bacteria 2343
209 Ga0068862_100334777 3300005844 Bacteria 1401
210 Ga0068862_101479473 3300005844 Bacteria 684
211 Ga0070717_11331255 3300006028 Bacteria 653
212 Ga0075364_10900929 3300006051 Bacteria 602
213 Ga0075366_10235968 3300006195 Bacteria 1115
214 Ga0097621_100126131 3300006237 Bacteria 2174
215 Ga0097621_100818591 3300006237 Bacteria 864
216 Ga0068871_100196634 3300006358 Bacteria 1739
217 Ga0068871_101272927 3300006358 Bacteria 691
218 Ga0068865_100001427 3300006881 Bacteria 13948
219 Ga0068865_101091152 3300006881 Bacteria 703
220 Ga0097620_100207987 3300006931 Bacteria 2043
221 Ga0097620_100403086 3300006931 Unclassified 1464
222 Ga0105244_10114513 3300009036 Bacteria 1310
223 Ga0105240_10033989 3300009093 Bacteria 6583
224 Ga0111539_11093423 3300009094 Bacteria 926
225 Ga0105245_11162983 3300009098 Bacteria 819
226 Ga0105243_10769932 3300009148 Bacteria 945
227 Ga0105243_11645074 3300009148 Bacteria 670
228 Ga0105241_10406901 3300009174 Bacteria 1195
229 Ga0105241_11788238 3300009174 Bacteria 599
230 Ga0105241_12297709 3300009174 Bacteria 537
231 Ga0105248_10463654 3300009177 Bacteria 1428
232 Ga0105248_10787862 3300009177 Bacteria 1073
233 Ga0105248_11036077 3300009177 Bacteria 927
234 Ga0105237_10071867 3300009545 Bacteria 3454
235 Ga0105238_10017563 3300009551 Bacteria 7275
236 Ga0105238_11614403 3300009551 Bacteria 679
237 Ga0105249_11046977 3300009553 Unclassified 885
238 Ga0105239_10180589 3300010375 Bacteria 2361
239 Ga0105239_12326536 3300010375 Bacteria 624
240 Ga0105239_13266982 3300010375 Bacteria 528
241 Ga0105246_10298388 3300011119 Bacteria 1300
242 Ga0105246_10387988 3300011119 Bacteria 1156
243 Ga0157319_1052795 3300012497 Bacteria 509
244 Ga0157373_10232263 3300013100 Bacteria 1303
245 Ga0157373_10465276 3300013100 Unclassified 911
246 Ga0157373_10693668 3300013100 Bacteria 746
247 Ga0157373_10830918 3300013100 Bacteria 682
248 Ga0157373_10907376 3300013100 Bacteria 654
249 Ga0157373_11174951 3300013100 Bacteria 578
250 Ga0157371_10136924 3300013102 Bacteria 1744
251 Ga0157371_10138026 3300013102 Bacteria 1737
252 Ga0157371_10237769 3300013102 Bacteria 1310
253 Ga0157371_10412699 3300013102 Bacteria 989
254 Ga0157371_10476861 3300013102 Bacteria 919
255 Ga0157371_10610118 3300013102 Bacteria 812
256 Ga0157370_10056869 3300013104 Bacteria 3722
257 Ga0157370_10682398 3300013104 Bacteria 938
258 Ga0157370_11119173 3300013104 Bacteria 711
259 Ga0157370_11211743 3300013104 Bacteria 681
260 Ga0157369_10053763 3300013105 Bacteria 4350
261 Ga0157369_10082963 3300013105 Bacteria 3429
262 Ga0157369_10318856 3300013105 Bacteria 1616
263 Ga0157369_10441113 3300013105 Bacteria 1349
264 Ga0157369_10671955 3300013105 Bacteria 1067
265 Ga0157369_11574392 3300013105 Bacteria 668
266 Ga0157374_12841837 3300013296 Bacteria 512
267 Ga0157378_10076007 3300013297 Bacteria 3025
268 Ga0163162_11049126 3300013306 Bacteria 922
269 Ga0157372_10056953 3300013307 Bacteria 4368
270 Ga0157372_10431592 3300013307 Bacteria 1536
271 Ga0157372_11150679 3300013307 Bacteria 897
272 Ga0157372_12461162 3300013307 Bacteria 598
273 Ga0157372_13199748 3300013307 Unclassified 522
274 Ga0157375_10890245 3300013308 Unclassified 1035
275 Ga0157375_11847152 3300013308 Bacteria 717
276 Ga0163163_10856526 3300014325 Bacteria 972
277 Ga0163163_12236370 3300014325 Bacteria 606
278 Ga0157380_10606811 3300014326 Bacteria 1084
279 Ga0157377_10126746 3300014745 Bacteria 1554
280 Ga0157377_10478719 3300014745 Bacteria 865
281 Ga0157376_11652450 3300014969 Bacteria 675
282 Ga0206354_10583725 3300020081 Bacteria 1097
283 Ga0206353_10486004 3300020082 Bacteria 1081
284 Ga0206353_11031539 3300020082 Bacteria 968
285 Ga0207697_10058881 3300025315 Bacteria 1596
286 Ga0207682_10040991 3300025893 Bacteria 1889
287 Ga0207688_10006153 3300025901 Bacteria 6532
288 Ga0207688_10901475 3300025901 Unclassified 560
289 Ga0207680_10348235 3300025903 Bacteria 1040
290 Ga0207680_10353097 3300025903 Bacteria 1033
291 Ga0207680_10360712 3300025903 Bacteria 1022
292 Ga0207680_10924727 3300025903 Unclassified 625
293 Ga0207647_10032036 3300025904 Bacteria 3381
294 Ga0207647_10038292 3300025904 Bacteria 3033
295 Ga0207647_10097512 3300025904 Bacteria 1748
296 Ga0207647_10133917 3300025904 Bacteria 1455
297 Ga0207647_10148841 3300025904 Bacteria 1369
298 Ga0207647_10650370 3300025904 Bacteria 578
299 Ga0207699_10308318 3300025906 Bacteria 1107
300 Ga0207645_10036884 3300025907 Bacteria 3140
301 Ga0207645_10113776 3300025907 Bacteria 1753
302 Ga0207643_10740411 3300025908 Unclassified 636
303 Ga0207705_10005962 3300025909 Bacteria 9066
304 Ga0207705_10016425 3300025909 Bacteria 5306
305 Ga0207705_10144077 3300025909 Bacteria 1781
306 Ga0207705_10207106 3300025909 Bacteria 1487
307 Ga0207705_10283102 3300025909 Bacteria 1269
308 Ga0207705_10751709 3300025909 Bacteria 757
309 Ga0207705_10776021 3300025909 Bacteria 744
310 Ga0207684_10978473 3300025910 Bacteria 709
311 Ga0207654_10464564 3300025911 Bacteria 889
312 Ga0207654_10552232 3300025911 Bacteria 818
313 Ga0207707_10223970 3300025912 Bacteria 1637
314 Ga0207707_10733765 3300025912 Bacteria 827
315 Ga0207671_10087791 3300025914 Bacteria 2339
316 Ga0207660_10173002 3300025917 Bacteria 1672
317 Ga0207660_10287635 3300025917 Bacteria 1306
318 Ga0207660_10483157 3300025917 Bacteria 1004
319 Ga0207660_11384319 3300025917 Bacteria 570
320 Ga0207657_10017841 3300025919 Bacteria 6793
321 Ga0207657_10030143 3300025919 Bacteria 4929
322 Ga0207657_10049328 3300025919 Bacteria 3669
323 Ga0207657_10080639 3300025919 Bacteria 2735
324 Ga0207657_10084451 3300025919 Bacteria 2661
325 Ga0207657_10153245 3300025919 Bacteria 1876
326 Ga0207657_10166152 3300025919 Bacteria 1790
327 Ga0207657_10189180 3300025919 Bacteria 1662
328 Ga0207657_10215092 3300025919 Bacteria 1541
329 Ga0207657_10252336 3300025919 Bacteria 1406
330 Ga0207649_10147314 3300025920 Bacteria 1617
331 Ga0207649_10218592 3300025920 Bacteria 1356
332 Ga0207649_10872394 3300025920 Bacteria 705
333 Ga0207649_10913890 3300025920 Bacteria 688
334 Ga0207649_11055591 3300025920 Bacteria 640
335 Ga0207649_11695596 3300025920 Bacteria 500
336 Ga0207652_10239302 3300025921 Bacteria 1636
337 Ga0207652_10289741 3300025921 Bacteria 1477
338 Ga0207681_10016327 3300025923 Bacteria 4643
339 Ga0207681_10075511 3300025923 Bacteria 2364
340 Ga0207694_10004725 3300025924 Bacteria 10596
341 Ga0207650_10014542 3300025925 Bacteria 5468
342 Ga0207650_10228920 3300025925 Bacteria 1499
343 Ga0207650_11058762 3300025925 Bacteria 690
344 Ga0207659_10444066 3300025926 Bacteria 1091
345 Ga0207659_11414880 3300025926 Bacteria 596
346 Ga0207687_10981314 3300025927 Bacteria 724
347 Ga0207700_11291601 3300025928 Bacteria 650
348 Ga0207664_10441800 3300025929 Bacteria 1160
349 Ga0207664_10756139 3300025929 Bacteria 874
350 Ga0207664_11853193 3300025929 Bacteria 526
351 Ga0207644_11004793 3300025931 Bacteria 700
352 Ga0207644_11578112 3300025931 Bacteria 551
353 Ga0207644_11663378 3300025931 Bacteria 535
354 Ga0207690_10007235 3300025932 Bacteria 6590
355 Ga0207690_10071091 3300025932 Bacteria 2399
356 Ga0207690_10276559 3300025932 Bacteria 1306
357 Ga0207690_10453534 3300025932 Bacteria 1031
358 Ga0207690_10473141 3300025932 Bacteria 1010
359 Ga0207690_10743429 3300025932 Bacteria 808
360 Ga0207690_10803861 3300025932 Bacteria 777
361 Ga0207690_10839836 3300025932 Bacteria 760
362 Ga0207690_10915597 3300025932 Bacteria 728
363 Ga0207706_10037359 3300025933 Bacteria 4313
364 Ga0207706_10050508 3300025933 Bacteria 3675
365 Ga0207706_10173882 3300025933 Bacteria 1892
366 Ga0207706_10234190 3300025933 Bacteria 1606
367 Ga0207706_10433897 3300025933 Bacteria 1138
368 Ga0207706_11689246 3300025933 Bacteria 510
369 Ga0207669_10521562 3300025937 Bacteria 954
370 Ga0207669_11017963 3300025937 Unclassified 697
371 Ga0207704_11232572 3300025938 Bacteria 638
372 Ga0207665_10291364 3300025939 Bacteria 1217
373 Ga0207691_10203321 3300025940 Bacteria 1723
374 Ga0207691_10392804 3300025940 Unclassified 1183
375 Ga0207711_10331848 3300025941 Bacteria 1407
376 Ga0207711_10383813 3300025941 Bacteria 1304
377 Ga0207711_10465308 3300025941 Bacteria 1177
378 Ga0207689_10013991 3300025942 Bacteria 6832
379 Ga0207689_10585959 3300025942 Unclassified 938
380 Ga0207661_10003906 3300025944 Bacteria 10402
381 Ga0207661_10069055 3300025944 Bacteria 2880
382 Ga0207661_10153844 3300025944 Bacteria 1990
383 Ga0207661_10155066 3300025944 Bacteria 1983
384 Ga0207661_11077481 3300025944 Bacteria 740
385 Ga0207661_11307231 3300025944 Bacteria 666
386 Ga0207679_11513819 3300025945 Bacteria 615
387 Ga0207679_11709218 3300025945 Bacteria 576
388 Ga0207679_11955893 3300025945 Unclassified 534
389 Ga0207667_10209013 3300025949 Bacteria 2001
390 Ga0207667_10222805 3300025949 Bacteria 1932
391 Ga0207667_10299207 3300025949 Bacteria 1644
392 Ga0207667_10773320 3300025949 Bacteria 958
393 Ga0207667_11023083 3300025949 Bacteria 812
394 Ga0207667_11067397 3300025949 Bacteria 792
395 Ga0207651_10049300 3300025960 Bacteria 2852
396 Ga0207651_10372457 3300025960 Bacteria 1208
397 Ga0207651_10457092 3300025960 Bacteria 1096
398 Ga0207651_10746643 3300025960 Bacteria 865
399 Ga0207668_10332472 3300025972 Bacteria 1264
400 Ga0207668_10416329 3300025972 Bacteria 1140
401 Ga0207640_10195158 3300025981 Bacteria 1529
402 Ga0207640_10200642 3300025981 Bacteria 1511
403 Ga0207640_10400697 3300025981 Bacteria 1117
404 Ga0207640_10744886 3300025981 Bacteria 844
405 Ga0207640_11214601 3300025981 Bacteria 671
406 Ga0207640_11218303 3300025981 Bacteria 670
407 Ga0207640_11295412 3300025981 Bacteria 650
408 Ga0207640_12033265 3300025981 Bacteria 521
409 Ga0207658_10126335 3300025986 Bacteria 2047
410 Ga0207658_11325467 3300025986 Bacteria 658
411 Ga0207658_11328394 3300025986 Bacteria 657
412 Ga0207677_10186605 3300026023 Bacteria 1636
413 Ga0207677_11093947 3300026023 Unclassified 726
414 Ga0207703_10859546 3300026035 Bacteria 868
415 Ga0207639_10020217 3300026041 Bacteria 4763
416 Ga0207639_10023537 3300026041 Bacteria 4448
417 Ga0207639_10626989 3300026041 Bacteria 993
418 Ga0207639_10683306 3300026041 Bacteria 951
419 Ga0207639_10777888 3300026041 Bacteria 891
420 Ga0207639_10919012 3300026041 Bacteria 818
421 Ga0207639_11845242 3300026041 Bacteria 565
422 Ga0207678_10033940 3300026067 Bacteria 4445
423 Ga0207678_10073544 3300026067 Bacteria 2929
424 Ga0207678_10092223 3300026067 Bacteria 2589
425 Ga0207678_10223938 3300026067 Bacteria 1610
426 Ga0207678_10514119 3300026067 Bacteria 1045
427 Ga0207678_10514889 3300026067 Bacteria 1044
428 Ga0207678_11038164 3300026067 Bacteria 726
429 Ga0207702_10031077 3300026078 Bacteria 4451
430 Ga0207702_10901221 3300026078 Bacteria 876
431 Ga0207702_11104215 3300026078 Bacteria 787
432 Ga0207702_11689260 3300026078 Bacteria 626
433 Ga0207641_10017108 3300026088 Bacteria 5932
434 Ga0207641_10716941 3300026088 Bacteria 986
435 Ga0207648_10293014 3300026089 Bacteria 1457
436 Ga0207648_10560185 3300026089 Bacteria 1050
437 Ga0207648_10599533 3300026089 Bacteria 1015
438 Ga0207676_10056857 3300026095 Bacteria 3078
439 Ga0207676_10405420 3300026095 Bacteria 1275
440 Ga0207674_10000491 3300026116 Bacteria 52076
441 Ga0207674_10053057 3300026116 Bacteria 4133
442 Ga0207674_10183445 3300026116 Bacteria 2043
443 Ga0207674_10201687 3300026116 Bacteria 1939
444 Ga0207674_10220277 3300026116 Bacteria 1846
445 Ga0207674_10284501 3300026116 Bacteria 1602
446 Ga0207674_10349865 3300026116 Bacteria 1429
447 Ga0207674_10383067 3300026116 Bacteria 1360
448 Ga0207674_11065271 3300026116 Bacteria 778
449 Ga0207683_10215607 3300026121 Bacteria 1748
450 Ga0207698_10004891 3300026142 Bacteria 8216
451 Ga0207698_10008923 3300026142 Bacteria 6358
452 Ga0207698_10217767 3300026142 Bacteria 1723
453 Ga0207698_10238233 3300026142 Bacteria 1656
454 Ga0207698_10447740 3300026142 Bacteria 1246
455 Ga0207698_10815954 3300026142 Bacteria 936
456 Ga0207698_11289181 3300026142 Bacteria 745
457 Ga0268266_10563323 3300028379 Bacteria 1092
458 Ga0268265_10106976 3300028380 Bacteria 2273
459 Ga0268265_12411770 3300028380 Bacteria 532
460 Ga0268264_10365692 3300028381 Bacteria 1377
461 Ga0307416_101950549 3300032002 Bacteria 690
462 Ga0307416_103006715 3300032002 Unclassified 564
463 Ga0307414_10305245 3300032004 Bacteria 1348
464 Ga0373935_1089325 3300035692 Bacteria 594
465 Ga0395899_0035103 3300037312 Bacteria 3765
466 Ga0395899_0129187 3300037312 Bacteria 1805
467 Ga0395899_0895868 3300037312 Bacteria 541
468 Ga0395900_0111116 3300037418 Bacteria 2815
469 Ga0395900_0294187 3300037418 Bacteria 1612
470 Ga0395900_0340865 3300037418 Bacteria 1474
471 Ga0395900_0519744 3300037418 Bacteria 1138
472 Ga0395900_0693565 3300037418 Bacteria 952
473 Ga0395900_0709530 3300037418 Bacteria 939
474 Ga0395900_0762916 3300037418 Bacteria 897
475 Ga0395900_1885292 3300037418 Bacteria 508
476 Ga0395898_0503569 3300037466 Bacteria 1152
477 Ga0395898_0581371 3300037466 Bacteria 1062
478 Ga0395898_0633052 3300037466 Bacteria 1012
479 Ga0395898_0692332 3300037466 Bacteria 961
480 Ga0395905_0130091 3300037471 Bacteria 2367
481 Ga0395905_0160007 3300037471 Bacteria 2116
482 Ga0395905_0308617 3300037471 Bacteria 1470
483 Ga0395905_0413393 3300037471 Bacteria 1244
484 Ga0395905_0767695 3300037471 Bacteria 867
485 Ga0395905_1018289 3300037471 Bacteria 731
486 Ga0395905_1029592 3300037471 Bacteria 726
487 Ga0395901_0032157 3300038443 Bacteria 5414
488 Ga0395901_0452728 3300038443 Bacteria 1312
489 Ga0395901_0970654 3300038443 Bacteria 827
490 Ga0395901_0994251 3300038443 Bacteria 815
491 Ga0395901_2044785 3300038443 Bacteria 518
492 Ga0450914_054092 3300042118 Bacteria 534
493 Ga0450903_065922 3300042138 Unclassified 524
494 Ga0450905_018383 3300042142 Bacteria 1018
495 Ga0450889_010285 3300042144 Bacteria 964
496 Ga0466961_0244990 3300044693 Bacteria 1101
497 Ga0466963_0199391 3300044694 Bacteria 1400
498 Ga0466964_0175068 3300044706 Bacteria 1013
499 Ga0466971_0072272 3300044719 Bacteria 1567
500 Ga0466968_0279858 3300044735 Bacteria 798
501 Ga0466970_0163181 3300044765 Bacteria 1233
502 Ga0466957_0097485 3300044842 Bacteria 1849
503 Ga0466958_0089116 3300045836 Bacteria 1907
504 Ga0466967_0000915 3300045976 Bacteria 15845
505 Ga0466967_0082982 3300045976 Bacteria 2897
506 Ga0466967_0183195 3300045976 Bacteria 1976
507 Ga0466967_0207207 3300045976 Bacteria 1859
508 Ga0466967_1000876 3300045976 Bacteria 832
509 Ga0466967_1569725 3300045976 Bacteria 655
510 Ga0466967_1904028 3300045976 Unclassified 591
511 Ga0495621_0187217 3300046539 Bacteria 828
512 Ga0495669_0264530 3300046684 Bacteria 826
513 Ga0496102_1089341 3300048905 Bacteria 719
514 Ga0496106_0639269 3300048909 Bacteria 851
515 Ga0496106_1221006 3300048909 Bacteria 586
516 Ga0496107_0434037 3300048910 Bacteria 976
517 Ga0496107_0552702 3300048910 Bacteria 853
518 Ga0496107_0646779 3300048910 Bacteria 780
519 Ga0496108_0242293 3300048911 Bacteria 1568
520 Ga0496109_0064952 3300048912 Bacteria 3340
521 Ga0496109_0625789 3300048912 Bacteria 1013
522 Ga0496112_0464858 3300048915 Bacteria 1202
523 Ga0496112_0927237 3300048915 Bacteria 792
524 Ga0496113_0657914 3300048916 Bacteria 838
525 Ga0496113_0782687 3300048916 Bacteria 758
526 Ga0501069_0229347 3300049585 Bacteria 1081
527 Ga0501070_1533821 3300049586 Bacteria 503
528 nmdc:mga03683_656838_c1 3300050489 Bacteria 516
529 nmdc:mga00v17_305521_c1 3300050491 Bacteria 1033
530 nmdc:mga0k408_595094_c1 3300050493 Bacteria 652
531 nmdc:mga08y16_694093_c1 3300050511 Bacteria 1018
532 Ga0466962_0102095 3300061719 Bacteria 1377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10416329 Ga0207668_104163293 57
2 3300048910 Ga0496107_0646779 Ga0496107_0646779_40_228 61
3 3300005364 Ga0070673_100297756 Ga0070673_1002977563 64
4 3300013308 Ga0157375_11847152 Ga0157375_118471522 64
5 3300026089 Ga0207648_10560185 Ga0207648_105601853 64
6 3300037418 Ga0395900_0340865 Ga0395900_0340865_448_666 65
7 3300037466 Ga0395898_0503569 Ga0395898_0503569_98_316 65
8 3300002067 JGI24735J21928_10027277 JGI24735J21928_100272772 66
9 3300002067 JGI24735J21928_10028502 JGI24735J21928_100285025 66
10 3300005327 Ga0070658_10587689 Ga0070658_105876893 66
11 3300005336 Ga0070680_100585101 Ga0070680_1005851013 66
12 3300005339 Ga0070660_100053540 Ga0070660_1000535404 66
13 3300005341 Ga0070691_10709570 Ga0070691_107095702 66
14 3300005344 Ga0070661_100022422 Ga0070661_1000224225 66
15 3300005366 Ga0070659_100094839 Ga0070659_1000948393 66
16 3300005366 Ga0070659_101090489 Ga0070659_1010904891 66
17 3300005458 Ga0070681_10159596 Ga0070681_101595963 66
18 3300005539 Ga0068853_100023826 Ga0068853_1000238265 66
19 3300005549 Ga0070704_100411700 Ga0070704_1004117002 66
20 3300005563 Ga0068855_100017128 Ga0068855_1000171285 66
21 3300005577 Ga0068857_100728440 Ga0068857_1007284401 66
22 3300005578 Ga0068854_100066941 Ga0068854_1000669415 66
23 3300005616 Ga0068852_100113694 Ga0068852_1001136943 66
24 3300005834 Ga0068851_10286396 Ga0068851_102863962 66
25 3300025904 Ga0207647_10038292 Ga0207647_100382925 66
26 3300025911 Ga0207654_10552232 Ga0207654_105522323 66
27 3300025912 Ga0207707_10223970 Ga0207707_102239705 66
28 3300025914 Ga0207671_10087791 Ga0207671_100877912 66
29 3300025919 Ga0207657_10049328 Ga0207657_100493285 66
30 3300025924 Ga0207694_10004725 Ga0207694_100047252 66
31 3300025932 Ga0207690_10071091 Ga0207690_100710913 66
32 3300026041 Ga0207639_10020217 Ga0207639_100202175 66
33 3300026116 Ga0207674_10220277 Ga0207674_102202775 66
34 3300026142 Ga0207698_10238233 Ga0207698_102382335 66
35 3300001990 JGI24737J22298_10257598 JGI24737J22298_102575981 67
36 3300005329 Ga0070683_100220989 Ga0070683_1002209894 67
37 3300005331 Ga0070670_100685694 Ga0070670_1006856943 67
38 3300005335 Ga0070666_11068635 Ga0070666_110686351 67
39 3300005337 Ga0070682_100102902 Ga0070682_1001029023 67
40 3300005339 Ga0070660_100222217 Ga0070660_1002222174 67
41 3300005344 Ga0070661_100301478 Ga0070661_1003014782 67
42 3300005355 Ga0070671_100293187 Ga0070671_1002931872 67
43 3300005364 Ga0070673_100110144 Ga0070673_1001101444 67
44 3300005366 Ga0070659_100072653 Ga0070659_1000726534 67
45 3300005457 Ga0070662_100198784 Ga0070662_1001987842 67
46 3300005539 Ga0068853_101067450 Ga0068853_1010674502 67
47 3300005548 Ga0070665_100596394 Ga0070665_1005963944 67
48 3300005564 Ga0070664_100103837 Ga0070664_1001038372 67
49 3300005577 Ga0068857_100568437 Ga0068857_1005684372 67
50 3300025903 Ga0207680_10348235 Ga0207680_103482354 67
51 3300025919 Ga0207657_10215092 Ga0207657_102150924 67
52 3300025925 Ga0207650_11058762 Ga0207650_110587622 67
53 3300025931 Ga0207644_11663378 Ga0207644_116633782 67
54 3300025932 Ga0207690_10473141 Ga0207690_104731412 67
55 3300025933 Ga0207706_10433897 Ga0207706_104338972 67
56 3300025944 Ga0207661_10153844 Ga0207661_101538443 67
57 3300025945 Ga0207679_11513819 Ga0207679_115138192 67
58 3300025949 Ga0207667_10773320 Ga0207667_107733202 67
59 3300025986 Ga0207658_11328394 Ga0207658_113283942 67
60 3300026041 Ga0207639_10626989 Ga0207639_106269891 67
61 3300026067 Ga0207678_10092223 Ga0207678_100922234 67
62 3300028379 Ga0268266_10563323 Ga0268266_105633234 67
63 3300005564 Ga0070664_101002224 Ga0070664_1010022243 70
64 3300037312 Ga0395899_0895868 Ga0395899_0895868_88_306 70
65 3300037418 Ga0395900_0294187 Ga0395900_0294187_228_446 70
66 3300037466 Ga0395898_0633052 Ga0395898_0633052_362_580 70
67 3300037471 Ga0395905_0413393 Ga0395905_0413393_545_763 70
68 3300038443 Ga0395901_2044785 Ga0395901_2044785_263_481 70
69 3300001915 JGI24741J21665_1019907 JGI24741J21665_10199072 71
70 3300001979 JGI24740J21852_10034403 JGI24740J21852_100344034 71
71 3300001979 JGI24740J21852_10120275 JGI24740J21852_101202752 71
72 3300001989 JGI24739J22299_10014998 JGI24739J22299_100149985 71
73 3300001989 JGI24739J22299_10067257 JGI24739J22299_100672573 71
74 3300001989 JGI24739J22299_10179874 JGI24739J22299_101798742 71
75 3300001990 JGI24737J22298_10008400 JGI24737J22298_100084004 71
76 3300001990 JGI24737J22298_10046299 JGI24737J22298_100462994 71
77 3300002067 JGI24735J21928_10003989 JGI24735J21928_100039896 71
78 3300002067 JGI24735J21928_10019600 JGI24735J21928_100196003 71
79 3300002067 JGI24735J21928_10107510 JGI24735J21928_101075102 71
80 3300002075 JGI24738J21930_10015874 JGI24738J21930_100158743 71
81 3300002077 JGI24744J21845_10006036 JGI24744J21845_100060364 71
82 3300005290 Ga0065712_10710289 Ga0065712_107102892 71
83 3300005327 Ga0070658_10214329 Ga0070658_102143293 71
84 3300005327 Ga0070658_10222894 Ga0070658_102228942 71
85 3300005327 Ga0070658_10265867 Ga0070658_102658673 71
86 3300005327 Ga0070658_10349965 Ga0070658_103499653 71
87 3300005327 Ga0070658_10447712 Ga0070658_104477122 71
88 3300005327 Ga0070658_11078481 Ga0070658_110784813 71
89 3300005327 Ga0070658_11281720 Ga0070658_112817202 71
90 3300005327 Ga0070658_11505209 Ga0070658_115052092 71
91 3300005327 Ga0070658_11715757 Ga0070658_117157572 71
92 3300005327 Ga0070658_11751870 Ga0070658_117518702 71
93 3300005328 Ga0070676_10040852 Ga0070676_100408524 71
94 3300005328 Ga0070676_10609062 Ga0070676_106090623 71
95 3300005329 Ga0070683_100239009 Ga0070683_1002390093 71
96 3300005329 Ga0070683_100254949 Ga0070683_1002549493 71
97 3300005329 Ga0070683_101437837 Ga0070683_1014378372 71
98 3300005331 Ga0070670_100284392 Ga0070670_1002843923 71
99 3300005331 Ga0070670_101566290 Ga0070670_1015662902 71
100 3300005333 Ga0070677_10165551 Ga0070677_101655511 71
101 3300005333 Ga0070677_10743275 Ga0070677_107432751 71
102 3300005334 Ga0068869_100869678 Ga0068869_1008696783 71
103 3300005335 Ga0070666_10245496 Ga0070666_102454963 71
104 3300005336 Ga0070680_100453488 Ga0070680_1004534883 71
105 3300005336 Ga0070680_100521248 Ga0070680_1005212483 71
106 3300005336 Ga0070680_100640159 Ga0070680_1006401593 71
107 3300005336 Ga0070680_100932102 Ga0070680_1009321022 71
108 3300005336 Ga0070680_101168868 Ga0070680_1011688681 71
109 3300005337 Ga0070682_100015848 Ga0070682_1000158484 71
110 3300005337 Ga0070682_101636359 Ga0070682_1016363592 71
111 3300005338 Ga0068868_100217194 Ga0068868_1002171944 71
112 3300005338 Ga0068868_100254181 Ga0068868_1002541813 71
113 3300005338 Ga0068868_102278222 Ga0068868_1022782222 71
114 3300005339 Ga0070660_100115642 Ga0070660_1001156423 71
115 3300005339 Ga0070660_100192916 Ga0070660_1001929163 71
116 3300005339 Ga0070660_100212845 Ga0070660_1002128454 71
117 3300005339 Ga0070660_100274511 Ga0070660_1002745112 71
118 3300005339 Ga0070660_100402861 Ga0070660_1004028612 71
119 3300005339 Ga0070660_100423472 Ga0070660_1004234721 71
120 3300005339 Ga0070660_100743314 Ga0070660_1007433142 71
121 3300005339 Ga0070660_100779479 Ga0070660_1007794792 71
122 3300005339 Ga0070660_101221180 Ga0070660_1012211802 71
123 3300005341 Ga0070691_10576481 Ga0070691_105764812 71
124 3300005343 Ga0070687_100414574 Ga0070687_1004145742 71
125 3300005344 Ga0070661_100164318 Ga0070661_1001643181 71
126 3300005344 Ga0070661_100180974 Ga0070661_1001809744 71
127 3300005344 Ga0070661_100245982 Ga0070661_1002459824 71
128 3300005344 Ga0070661_100250482 Ga0070661_1002504822 71
129 3300005344 Ga0070661_100281370 Ga0070661_1002813702 71
130 3300005345 Ga0070692_10130495 Ga0070692_101304953 71
131 3300005345 Ga0070692_10433143 Ga0070692_104331433 71
132 3300005347 Ga0070668_100257062 Ga0070668_1002570622 71
133 3300005347 Ga0070668_100532476 Ga0070668_1005324763 71
134 3300005353 Ga0070669_100073091 Ga0070669_1000730914 71
135 3300005353 Ga0070669_100542787 Ga0070669_1005427872 71
136 3300005353 Ga0070669_100800949 Ga0070669_1008009493 71
137 3300005354 Ga0070675_101935883 Ga0070675_1019358832 71
138 3300005355 Ga0070671_100292433 Ga0070671_1002924332 71
139 3300005355 Ga0070671_100387672 Ga0070671_1003876724 71
140 3300005356 Ga0070674_100036971 Ga0070674_1000369713 71
141 3300005356 Ga0070674_100048009 Ga0070674_1000480094 71
142 3300005356 Ga0070674_101295249 Ga0070674_1012952491 71
143 3300005364 Ga0070673_100123488 Ga0070673_1001234884 71
144 3300005364 Ga0070673_100246106 Ga0070673_1002461062 71
145 3300005364 Ga0070673_100876104 Ga0070673_1008761042 71
146 3300005366 Ga0070659_100151756 Ga0070659_1001517564 71
147 3300005366 Ga0070659_100172090 Ga0070659_1001720902 71
148 3300005366 Ga0070659_100333800 Ga0070659_1003338002 71
149 3300005366 Ga0070659_100969007 Ga0070659_1009690072 71
150 3300005366 Ga0070659_101023124 Ga0070659_1010231243 71
151 3300005366 Ga0070659_102085671 Ga0070659_1020856712 71
152 3300005367 Ga0070667_100177882 Ga0070667_1001778823 71
153 3300005367 Ga0070667_100421013 Ga0070667_1004210133 71
154 3300005367 Ga0070667_100853494 Ga0070667_1008534944 71
155 3300005434 Ga0070709_10114050 Ga0070709_101140503 71
156 3300005435 Ga0070714_100225194 Ga0070714_1002251943 71
157 3300005435 Ga0070714_100613309 Ga0070714_1006133093 71
158 3300005440 Ga0070705_101295171 Ga0070705_1012951712 71
159 3300005455 Ga0070663_100119340 Ga0070663_1001193403 71
160 3300005455 Ga0070663_100242003 Ga0070663_1002420033 71
161 3300005455 Ga0070663_100300083 Ga0070663_1003000833 71
162 3300005455 Ga0070663_100733115 Ga0070663_1007331152 71
163 3300005455 Ga0070663_100749801 Ga0070663_1007498013 71
164 3300005455 Ga0070663_100773097 Ga0070663_1007730973 71
165 3300005456 Ga0070678_100573251 Ga0070678_1005732513 71
166 3300005456 Ga0070678_100779592 Ga0070678_1007795923 71
167 3300005457 Ga0070662_100198499 Ga0070662_1001984992 71
168 3300005457 Ga0070662_100239595 Ga0070662_1002395954 71
169 3300005457 Ga0070662_100270219 Ga0070662_1002702193 71
170 3300005457 Ga0070662_100412903 Ga0070662_1004129033 71
171 3300005457 Ga0070662_100870375 Ga0070662_1008703752 71
172 3300005457 Ga0070662_101425630 Ga0070662_1014256302 71
173 3300005457 Ga0070662_101632434 Ga0070662_1016324342 71
174 3300005458 Ga0070681_10044638 Ga0070681_100446386 71
175 3300005458 Ga0070681_11354929 Ga0070681_113549291 71
176 3300005459 Ga0068867_100157218 Ga0068867_1001572183 71
177 3300005459 Ga0068867_100332307 Ga0068867_1003323073 71
178 3300005467 Ga0070706_101089284 Ga0070706_1010892841 71
179 3300005530 Ga0070679_100167485 Ga0070679_1001674853 71
180 3300005530 Ga0070679_100554839 Ga0070679_1005548393 71
181 3300005530 Ga0070679_101528957 Ga0070679_1015289572 71
182 3300005535 Ga0070684_100036737 Ga0070684_1000367372 71
183 3300005535 Ga0070684_100240912 Ga0070684_1002409124 71
184 3300005535 Ga0070684_100691480 Ga0070684_1006914803 71
185 3300005535 Ga0070684_101192703 Ga0070684_1011927033 71
186 3300005535 Ga0070684_101743221 Ga0070684_1017432212 71
187 3300005539 Ga0068853_100440988 Ga0068853_1004409882 71
188 3300005539 Ga0068853_100623857 Ga0068853_1006238573 71
189 3300005539 Ga0068853_100812904 Ga0068853_1008129043 71
190 3300005539 Ga0068853_101174917 Ga0068853_1011749171 71
191 3300005539 Ga0068853_101546423 Ga0068853_1015464232 71
192 3300005543 Ga0070672_100388650 Ga0070672_1003886504 71
193 3300005543 Ga0070672_102136975 Ga0070672_1021369752 71
194 3300005545 Ga0070695_100502888 Ga0070695_1005028883 71
195 3300005546 Ga0070696_100247646 Ga0070696_1002476463 71
196 3300005546 Ga0070696_101454178 Ga0070696_1014541782 71
197 3300005547 Ga0070693_100056882 Ga0070693_1000568823 71
198 3300005547 Ga0070693_100114076 Ga0070693_1001140763 71
199 3300005563 Ga0068855_100951823 Ga0068855_1009518233 71
200 3300005563 Ga0068855_101085287 Ga0068855_1010852873 71
201 3300005563 Ga0068855_101318361 Ga0068855_1013183613 71
202 3300005563 Ga0068855_101641659 Ga0068855_1016416592 71
203 3300005563 Ga0068855_102098834 Ga0068855_1020988343 71
204 3300005564 Ga0070664_100974593 Ga0070664_1009745933 71
205 3300005564 Ga0070664_101414634 Ga0070664_1014146342 71
206 3300005564 Ga0070664_101813286 Ga0070664_1018132862 71
207 3300005564 Ga0070664_101876313 Ga0070664_1018763132 71
208 3300005577 Ga0068857_100100166 Ga0068857_1001001662 71
209 3300005577 Ga0068857_100168591 Ga0068857_1001685914 71
210 3300005577 Ga0068857_100233449 Ga0068857_1002334493 71
211 3300005577 Ga0068857_100313844 Ga0068857_1003138443 71
212 3300005577 Ga0068857_100412185 Ga0068857_1004121853 71
213 3300005577 Ga0068857_101008160 Ga0068857_1010081602 71
214 3300005577 Ga0068857_101275640 Ga0068857_1012756403 71
215 3300005578 Ga0068854_100225601 Ga0068854_1002256012 71
216 3300005578 Ga0068854_100337121 Ga0068854_1003371212 71
217 3300005578 Ga0068854_100726482 Ga0068854_1007264823 71
218 3300005578 Ga0068854_100815200 Ga0068854_1008152003 71
219 3300005614 Ga0068856_100125152 Ga0068856_1001251525 71
220 3300005614 Ga0068856_101190063 Ga0068856_1011900631 71
221 3300005614 Ga0068856_102163153 Ga0068856_1021631532 71
222 3300005615 Ga0070702_101838839 Ga0070702_1018388391 71
223 3300005616 Ga0068852_100013430 Ga0068852_1000134305 71
224 3300005616 Ga0068852_100053777 Ga0068852_1000537775 71
225 3300005616 Ga0068852_100163998 Ga0068852_1001639985 71
226 3300005616 Ga0068852_100190180 Ga0068852_1001901804 71
227 3300005616 Ga0068852_101458832 Ga0068852_1014588323 71
228 3300005616 Ga0068852_102565580 Ga0068852_1025655802 71
229 3300005617 Ga0068859_100208004 Ga0068859_1002080044 71
230 3300005617 Ga0068859_100403044 Ga0068859_1004030444 71
231 3300005618 Ga0068864_100346531 Ga0068864_1003465314 71
232 3300005618 Ga0068864_101333062 Ga0068864_1013330621 71
233 3300005718 Ga0068866_10338035 Ga0068866_103380352 71
234 3300005718 Ga0068866_10536439 Ga0068866_105364392 71
235 3300005834 Ga0068851_10087883 Ga0068851_100878833 71
236 3300005834 Ga0068851_10355921 Ga0068851_103559213 71
237 3300005840 Ga0068870_10176533 Ga0068870_101765333 71
238 3300005841 Ga0068863_100073857 Ga0068863_1000738576 71
239 3300005841 Ga0068863_101312075 Ga0068863_1013120752 71
240 3300005841 Ga0068863_101910080 Ga0068863_1019100802 71
241 3300005842 Ga0068858_100529469 Ga0068858_1005294692 71
242 3300005843 Ga0068860_100137905 Ga0068860_1001379052 71
243 3300005844 Ga0068862_100334777 Ga0068862_1003347774 71
244 3300005844 Ga0068862_101479473 Ga0068862_1014794732 71
245 3300006028 Ga0070717_11331255 Ga0070717_113312552 71
246 3300006051 Ga0075364_10900929 Ga0075364_109009292 71
247 3300006195 Ga0075366_10235968 Ga0075366_102359684 71
248 3300006237 Ga0097621_100126131 Ga0097621_1001261313 71
249 3300006237 Ga0097621_100818591 Ga0097621_1008185912 71
250 3300006358 Ga0068871_100196634 Ga0068871_1001966343 71
251 3300006358 Ga0068871_101272927 Ga0068871_1012729273 71
252 3300006881 Ga0068865_100001427 Ga0068865_1000014272 71
253 3300006881 Ga0068865_101091152 Ga0068865_1010911522 71
254 3300006931 Ga0097620_100207987 Ga0097620_1002079874 71
255 3300006931 Ga0097620_100403086 Ga0097620_1004030864 71
256 3300009036 Ga0105244_10114513 Ga0105244_101145133 71
257 3300009093 Ga0105240_10033989 Ga0105240_100339895 71
258 3300009094 Ga0111539_11093423 Ga0111539_110934234 71
259 3300009098 Ga0105245_11162983 Ga0105245_111629832 71
260 3300009148 Ga0105243_10769932 Ga0105243_107699323 71
261 3300009148 Ga0105243_11645074 Ga0105243_116450742 71
262 3300009174 Ga0105241_10406901 Ga0105241_104069013 71
263 3300009174 Ga0105241_11788238 Ga0105241_117882382 71
264 3300009174 Ga0105241_12297709 Ga0105241_122977091 71
265 3300009177 Ga0105248_10463654 Ga0105248_104636543 71
266 3300009177 Ga0105248_10787862 Ga0105248_107878624 71
267 3300009177 Ga0105248_11036077 Ga0105248_110360772 71
268 3300009545 Ga0105237_10071867 Ga0105237_100718675 71
269 3300009551 Ga0105238_10017563 Ga0105238_100175637 71
270 3300009551 Ga0105238_11614403 Ga0105238_116144032 71
271 3300009553 Ga0105249_11046977 Ga0105249_110469772 71
272 3300010375 Ga0105239_10180589 Ga0105239_101805893 71
273 3300010375 Ga0105239_12326536 Ga0105239_123265362 71
274 3300010375 Ga0105239_13266982 Ga0105239_132669822 71
275 3300011119 Ga0105246_10298388 Ga0105246_102983883 71
276 3300011119 Ga0105246_10387988 Ga0105246_103879883 71
277 3300012497 Ga0157319_1052795 Ga0157319_10527952 71
278 3300013100 Ga0157373_10232263 Ga0157373_102322633 71
279 3300013100 Ga0157373_10465276 Ga0157373_104652761 71
280 3300013100 Ga0157373_10693668 Ga0157373_106936681 71
281 3300013100 Ga0157373_10830918 Ga0157373_108309183 71
282 3300013100 Ga0157373_10907376 Ga0157373_109073762 71
283 3300013100 Ga0157373_11174951 Ga0157373_111749512 71
284 3300013102 Ga0157371_10136924 Ga0157371_101369243 71
285 3300013102 Ga0157371_10138026 Ga0157371_101380263 71
286 3300013102 Ga0157371_10237769 Ga0157371_102377693 71
287 3300013102 Ga0157371_10412699 Ga0157371_104126991 71
288 3300013102 Ga0157371_10476861 Ga0157371_104768613 71
289 3300013102 Ga0157371_10610118 Ga0157371_106101183 71
290 3300013104 Ga0157370_10056869 Ga0157370_100568693 71
291 3300013104 Ga0157370_10682398 Ga0157370_106823983 71
292 3300013104 Ga0157370_11119173 Ga0157370_111191732 71
293 3300013104 Ga0157370_11211743 Ga0157370_112117433 71
294 3300013105 Ga0157369_10053763 Ga0157369_100537633 71
295 3300013105 Ga0157369_10082963 Ga0157369_100829633 71
296 3300013105 Ga0157369_10318856 Ga0157369_103188562 71
297 3300013105 Ga0157369_10441113 Ga0157369_104411133 71
298 3300013105 Ga0157369_10671955 Ga0157369_106719552 71
299 3300013105 Ga0157369_11574392 Ga0157369_115743922 71
300 3300013296 Ga0157374_12841837 Ga0157374_128418372 71
301 3300013297 Ga0157378_10076007 Ga0157378_100760072 71
302 3300013306 Ga0163162_11049126 Ga0163162_110491262 71
303 3300013307 Ga0157372_10056953 Ga0157372_100569535 71
304 3300013307 Ga0157372_10431592 Ga0157372_104315923 71
305 3300013307 Ga0157372_11150679 Ga0157372_111506793 71
306 3300013307 Ga0157372_12461162 Ga0157372_124611622 71
307 3300013307 Ga0157372_13199748 Ga0157372_131997481 71
308 3300013308 Ga0157375_10890245 Ga0157375_108902452 71
309 3300014325 Ga0163163_10856526 Ga0163163_108565261 71
310 3300014325 Ga0163163_12236370 Ga0163163_122363701 71
311 3300014326 Ga0157380_10606811 Ga0157380_106068113 71
312 3300014745 Ga0157377_10126746 Ga0157377_101267463 71
313 3300014745 Ga0157377_10478719 Ga0157377_104787193 71
314 3300014969 Ga0157376_11652450 Ga0157376_116524503 71
315 3300020081 Ga0206354_10583725 Ga0206354_105837253 71
316 3300020082 Ga0206353_10486004 Ga0206353_104860042 71
317 3300020082 Ga0206353_11031539 Ga0206353_110315392 71
318 3300025315 Ga0207697_10058881 Ga0207697_100588813 71
319 3300025893 Ga0207682_10040991 Ga0207682_100409912 71
320 3300025901 Ga0207688_10006153 Ga0207688_100061534 71
321 3300025901 Ga0207688_10901475 Ga0207688_109014752 71
322 3300025903 Ga0207680_10353097 Ga0207680_103530972 71
323 3300025903 Ga0207680_10360712 Ga0207680_103607123 71
324 3300025903 Ga0207680_10924727 Ga0207680_109247272 71
325 3300025904 Ga0207647_10032036 Ga0207647_100320364 71
326 3300025904 Ga0207647_10097512 Ga0207647_100975124 71
327 3300025904 Ga0207647_10133917 Ga0207647_101339173 71
328 3300025904 Ga0207647_10148841 Ga0207647_101488414 71
329 3300025904 Ga0207647_10650370 Ga0207647_106503702 71
330 3300025906 Ga0207699_10308318 Ga0207699_103083183 71
331 3300025907 Ga0207645_10036884 Ga0207645_100368844 71
332 3300025907 Ga0207645_10113776 Ga0207645_101137764 71
333 3300025908 Ga0207643_10740411 Ga0207643_107404112 71
334 3300025909 Ga0207705_10005962 Ga0207705_100059623 71
335 3300025909 Ga0207705_10016425 Ga0207705_100164253 71
336 3300025909 Ga0207705_10144077 Ga0207705_101440773 71
337 3300025909 Ga0207705_10207106 Ga0207705_102071062 71
338 3300025909 Ga0207705_10283102 Ga0207705_102831023 71
339 3300025909 Ga0207705_10751709 Ga0207705_107517093 71
340 3300025909 Ga0207705_10776021 Ga0207705_107760213 71
341 3300025910 Ga0207684_10978473 Ga0207684_109784732 71
342 3300025911 Ga0207654_10464564 Ga0207654_104645643 71
343 3300025912 Ga0207707_10733765 Ga0207707_107337652 71
344 3300025917 Ga0207660_10173002 Ga0207660_101730023 71
345 3300025917 Ga0207660_10287635 Ga0207660_102876353 71
346 3300025917 Ga0207660_10483157 Ga0207660_104831573 71
347 3300025917 Ga0207660_11384319 Ga0207660_113843191 71
348 3300025919 Ga0207657_10017841 Ga0207657_100178414 71
349 3300025919 Ga0207657_10030143 Ga0207657_100301432 71
350 3300025919 Ga0207657_10080639 Ga0207657_100806393 71
351 3300025919 Ga0207657_10084451 Ga0207657_100844513 71
352 3300025919 Ga0207657_10153245 Ga0207657_101532455 71
353 3300025919 Ga0207657_10166152 Ga0207657_101661524 71
354 3300025919 Ga0207657_10189180 Ga0207657_101891802 71
355 3300025919 Ga0207657_10252336 Ga0207657_102523364 71
356 3300025920 Ga0207649_10147314 Ga0207649_101473142 71
357 3300025920 Ga0207649_10218592 Ga0207649_102185922 71
358 3300025920 Ga0207649_10872394 Ga0207649_108723943 71
359 3300025920 Ga0207649_10913890 Ga0207649_109138902 71
360 3300025920 Ga0207649_11055591 Ga0207649_110555912 71
361 3300025920 Ga0207649_11695596 Ga0207649_116955961 71
362 3300025921 Ga0207652_10239302 Ga0207652_102393021 71
363 3300025921 Ga0207652_10289741 Ga0207652_102897412 71
364 3300025923 Ga0207681_10016327 Ga0207681_100163274 71
365 3300025923 Ga0207681_10075511 Ga0207681_100755112 71
366 3300025925 Ga0207650_10014542 Ga0207650_100145424 71
367 3300025925 Ga0207650_10228920 Ga0207650_102289203 71
368 3300025926 Ga0207659_10444066 Ga0207659_104440663 71
369 3300025926 Ga0207659_11414880 Ga0207659_114148802 71
370 3300025927 Ga0207687_10981314 Ga0207687_109813142 71
371 3300025928 Ga0207700_11291601 Ga0207700_112916012 71
372 3300025929 Ga0207664_10441800 Ga0207664_104418003 71
373 3300025929 Ga0207664_10756139 Ga0207664_107561392 71
374 3300025929 Ga0207664_11853193 Ga0207664_118531932 71
375 3300025931 Ga0207644_11004793 Ga0207644_110047932 71
376 3300025931 Ga0207644_11578112 Ga0207644_115781122 71
377 3300025932 Ga0207690_10007235 Ga0207690_100072354 71
378 3300025932 Ga0207690_10276559 Ga0207690_102765592 71
379 3300025932 Ga0207690_10453534 Ga0207690_104535344 71
380 3300025932 Ga0207690_10743429 Ga0207690_107434292 71
381 3300025932 Ga0207690_10803861 Ga0207690_108038612 71
382 3300025932 Ga0207690_10839836 Ga0207690_108398362 71
383 3300025932 Ga0207690_10915597 Ga0207690_109155973 71
384 3300025933 Ga0207706_10037359 Ga0207706_100373596 71
385 3300025933 Ga0207706_10050508 Ga0207706_100505084 71
386 3300025933 Ga0207706_10173882 Ga0207706_101738822 71
387 3300025933 Ga0207706_10234190 Ga0207706_102341904 71
388 3300025933 Ga0207706_11689246 Ga0207706_116892462 71
389 3300025937 Ga0207669_10521562 Ga0207669_105215623 71
390 3300025937 Ga0207669_11017963 Ga0207669_110179632 71
391 3300025938 Ga0207704_11232572 Ga0207704_112325722 71
392 3300025939 Ga0207665_10291364 Ga0207665_102913643 71
393 3300025940 Ga0207691_10203321 Ga0207691_102033214 71
394 3300025940 Ga0207691_10392804 Ga0207691_103928042 71
395 3300025941 Ga0207711_10331848 Ga0207711_103318483 71
396 3300025941 Ga0207711_10383813 Ga0207711_103838133 71
397 3300025941 Ga0207711_10465308 Ga0207711_104653082 71
398 3300025942 Ga0207689_10013991 Ga0207689_100139918 71
399 3300025942 Ga0207689_10585959 Ga0207689_105859592 71
400 3300025944 Ga0207661_10003906 Ga0207661_100039063 71
401 3300025944 Ga0207661_10069055 Ga0207661_100690554 71
402 3300025944 Ga0207661_10155066 Ga0207661_101550664 71
403 3300025944 Ga0207661_11077481 Ga0207661_110774812 71
404 3300025944 Ga0207661_11307231 Ga0207661_113072312 71
405 3300025945 Ga0207679_11709218 Ga0207679_117092181 71
406 3300025945 Ga0207679_11955893 Ga0207679_119558932 71
407 3300025949 Ga0207667_10209013 Ga0207667_102090134 71
408 3300025949 Ga0207667_10222805 Ga0207667_102228053 71
409 3300025949 Ga0207667_10299207 Ga0207667_102992073 71
410 3300025949 Ga0207667_11023083 Ga0207667_110230832 71
411 3300025949 Ga0207667_11067397 Ga0207667_110673972 71
412 3300025960 Ga0207651_10049300 Ga0207651_100493002 71
413 3300025960 Ga0207651_10372457 Ga0207651_103724574 71
414 3300025960 Ga0207651_10457092 Ga0207651_104570921 71
415 3300025960 Ga0207651_10746643 Ga0207651_107466432 71
416 3300025972 Ga0207668_10332472 Ga0207668_103324722 71
417 3300025981 Ga0207640_10195158 Ga0207640_101951583 71
418 3300025981 Ga0207640_10200642 Ga0207640_102006421 71
419 3300025981 Ga0207640_10400697 Ga0207640_104006972 71
420 3300025981 Ga0207640_10744886 Ga0207640_107448862 71
421 3300025981 Ga0207640_11214601 Ga0207640_112146012 71
422 3300025981 Ga0207640_11218303 Ga0207640_112183033 71
423 3300025981 Ga0207640_11295412 Ga0207640_112954122 71
424 3300025981 Ga0207640_12033265 Ga0207640_120332652 71
425 3300025986 Ga0207658_10126335 Ga0207658_101263355 71
426 3300025986 Ga0207658_11325467 Ga0207658_113254673 71
427 3300026023 Ga0207677_10186605 Ga0207677_101866054 71
428 3300026023 Ga0207677_11093947 Ga0207677_110939472 71
429 3300026035 Ga0207703_10859546 Ga0207703_108595463 71
430 3300026041 Ga0207639_10023537 Ga0207639_100235371 71
431 3300026041 Ga0207639_10683306 Ga0207639_106833063 71
432 3300026041 Ga0207639_10777888 Ga0207639_107778883 71
433 3300026041 Ga0207639_10919012 Ga0207639_109190122 71
434 3300026041 Ga0207639_11845242 Ga0207639_118452421 71
435 3300026067 Ga0207678_10033940 Ga0207678_100339405 71
436 3300026067 Ga0207678_10073544 Ga0207678_100735444 71
437 3300026067 Ga0207678_10223938 Ga0207678_102239383 71
438 3300026067 Ga0207678_10514119 Ga0207678_105141194 71
439 3300026067 Ga0207678_10514889 Ga0207678_105148892 71
440 3300026067 Ga0207678_11038164 Ga0207678_110381642 71
441 3300026078 Ga0207702_10031077 Ga0207702_100310773 71
442 3300026078 Ga0207702_10901221 Ga0207702_109012212 71
443 3300026078 Ga0207702_11104215 Ga0207702_111042153 71
444 3300026078 Ga0207702_11689260 Ga0207702_116892602 71
445 3300026088 Ga0207641_10017108 Ga0207641_100171084 71
446 3300026088 Ga0207641_10716941 Ga0207641_107169413 71
447 3300026089 Ga0207648_10293014 Ga0207648_102930143 71
448 3300026089 Ga0207648_10599533 Ga0207648_105995333 71
449 3300026095 Ga0207676_10056857 Ga0207676_100568573 71
450 3300026095 Ga0207676_10405420 Ga0207676_104054203 71
451 3300026116 Ga0207674_10000491 Ga0207674_100004914 71
452 3300026116 Ga0207674_10053057 Ga0207674_100530573 71
453 3300026116 Ga0207674_10183445 Ga0207674_101834453 71
454 3300026116 Ga0207674_10201687 Ga0207674_102016874 71
455 3300026116 Ga0207674_10284501 Ga0207674_102845014 71
456 3300026116 Ga0207674_10349865 Ga0207674_103498653 71
457 3300026116 Ga0207674_10383067 Ga0207674_103830672 71
458 3300026116 Ga0207674_11065271 Ga0207674_110652713 71
459 3300026121 Ga0207683_10215607 Ga0207683_102156073 71
460 3300026142 Ga0207698_10004891 Ga0207698_100048912 71
461 3300026142 Ga0207698_10008923 Ga0207698_100089238 71
462 3300026142 Ga0207698_10217767 Ga0207698_102177671 71
463 3300026142 Ga0207698_10447740 Ga0207698_104477404 71
464 3300026142 Ga0207698_10815954 Ga0207698_108159543 71
465 3300026142 Ga0207698_11289181 Ga0207698_112891812 71
466 3300028380 Ga0268265_10106976 Ga0268265_101069763 71
467 3300028380 Ga0268265_12411770 Ga0268265_124117702 71
468 3300028381 Ga0268264_10365692 Ga0268264_103656923 71
469 3300032002 Ga0307416_101950549 Ga0307416_1019505492 71
470 3300032002 Ga0307416_103006715 Ga0307416_1030067151 71
471 3300032004 Ga0307414_10305245 Ga0307414_103052452 71
472 3300035692 Ga0373935_1089325 Ga0373935_1089325_91_306 71
473 3300037312 Ga0395899_0035103 Ga0395899_0035103_738_956 71
474 3300037312 Ga0395899_0129187 Ga0395899_0129187_433_654 71
475 3300037418 Ga0395900_0111116 Ga0395900_0111116_1988_2203 71
476 3300037418 Ga0395900_0519744 Ga0395900_0519744_179_400 71
477 3300037418 Ga0395900_0693565 Ga0395900_0693565_683_898 71
478 3300037418 Ga0395900_0709530 Ga0395900_0709530_39_257 71
479 3300037418 Ga0395900_0762916 Ga0395900_0762916_455_676 71
480 3300037418 Ga0395900_1885292 Ga0395900_1885292_51_266 71
481 3300037466 Ga0395898_0581371 Ga0395898_0581371_545_766 71
482 3300037466 Ga0395898_0692332 Ga0395898_0692332_314_529 71
483 3300037471 Ga0395905_0130091 Ga0395905_0130091_1336_1551 71
484 3300037471 Ga0395905_0160007 Ga0395905_0160007_1132_1350 71
485 3300037471 Ga0395905_0308617 Ga0395905_0308617_13_228 71
486 3300037471 Ga0395905_0767695 Ga0395905_0767695_253_468 71
487 3300037471 Ga0395905_1018289 Ga0395905_1018289_24_239 71
488 3300037471 Ga0395905_1029592 Ga0395905_1029592_403_624 71
489 3300038443 Ga0395901_0032157 Ga0395901_0032157_4453_4671 71
490 3300038443 Ga0395901_0452728 Ga0395901_0452728_501_722 71
491 3300038443 Ga0395901_0970654 Ga0395901_0970654_58_273 71
492 3300038443 Ga0395901_0994251 Ga0395901_0994251_426_647 71
493 3300042118 Ga0450914_054092 Ga0450914_054092_33_248 71
494 3300042138 Ga0450903_065922 Ga0450903_065922_103_318 71
495 3300042142 Ga0450905_018383 Ga0450905_018383_589_804 71
496 3300042144 Ga0450889_010285 Ga0450889_010285_268_483 71
497 3300044693 Ga0466961_0244990 Ga0466961_0244990_628_843 71
498 3300044694 Ga0466963_0199391 Ga0466963_0199391_1029_1244 71
499 3300044706 Ga0466964_0175068 Ga0466964_0175068_563_784 71
500 3300044719 Ga0466971_0072272 Ga0466971_0072272_66_281 71
501 3300044735 Ga0466968_0279858 Ga0466968_0279858_571_786 71
502 3300044765 Ga0466970_0163181 Ga0466970_0163181_737_952 71
503 3300044842 Ga0466957_0097485 Ga0466957_0097485_724_939 71
504 3300045836 Ga0466958_0089116 Ga0466958_0089116_866_1081 71
505 3300045976 Ga0466967_0000915 Ga0466967_0000915_391_612 71
506 3300045976 Ga0466967_0082982 Ga0466967_0082982_840_1058 71
507 3300045976 Ga0466967_0183195 Ga0466967_0183195_1203_1424 71
508 3300045976 Ga0466967_0207207 Ga0466967_0207207_66_287 71
509 3300045976 Ga0466967_1000876 Ga0466967_1000876_554_775 71
510 3300045976 Ga0466967_1569725 Ga0466967_1569725_130_348 71
511 3300045976 Ga0466967_1904028 Ga0466967_1904028_270_488 71
512 3300046539 Ga0495621_0187217 Ga0495621_0187217_587_805 71
513 3300046684 Ga0495669_0264530 Ga0495669_0264530_135_353 71
514 3300048905 Ga0496102_1089341 Ga0496102_1089341_349_564 71
515 3300048909 Ga0496106_0639269 Ga0496106_0639269_573_788 71
516 3300048909 Ga0496106_1221006 Ga0496106_1221006_330_548 71
517 3300048910 Ga0496107_0434037 Ga0496107_0434037_744_962 71
518 3300048910 Ga0496107_0552702 Ga0496107_0552702_196_411 71
519 3300048911 Ga0496108_0242293 Ga0496108_0242293_479_697 71
520 3300048912 Ga0496109_0064952 Ga0496109_0064952_2551_2769 71
521 3300048912 Ga0496109_0625789 Ga0496109_0625789_49_264 71
522 3300048915 Ga0496112_0464858 Ga0496112_0464858_15_233 71
523 3300048915 Ga0496112_0927237 Ga0496112_0927237_10_225 71
524 3300048916 Ga0496113_0657914 Ga0496113_0657914_98_313 71
525 3300048916 Ga0496113_0782687 Ga0496113_0782687_277_495 71
526 3300049585 Ga0501069_0229347 Ga0501069_0229347_269_484 71
527 3300049586 Ga0501070_1533821 Ga0501070_1533821_35_250 71
528 3300050489 nmdc:mga03683_656838_c1 nmdc:mga03683_656838_c1_142_360 71
529 3300050491 nmdc:mga00v17_305521_c1 nmdc:mga00v17_305521_c1_693_908 71
530 3300050493 nmdc:mga0k408_595094_c1 nmdc:mga0k408_595094_c1_301_516 71
531 3300050511 nmdc:mga08y16_694093_c1 nmdc:mga08y16_694093_c1_250_465 71
532 3300061719 Ga0466962_0102095 Ga0466962_0102095_399_614 71

Feature Viewer

pLDDT pTM Quality
75.26 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map