F460185

General Info

Members Datasets Scaffolds Average Seq Length
531 251 513 149

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0000035|Ga0496116_0000035_31464_31952
Length 162
Sequence MSQANTGAAAPKGTIKAKHQRLVLLVVALVVLIGAGLLAAWALRNQASYFYVPAEIVAKLPEPGRAVRLGGMVARGSLRTEADGVTIAFAVEDGKARVPVRFRGIVPSLFVEGSGVVAEGHMGADGTFVADNLLAKHDENYVPREMKDMSREQAEQVMRETK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
12 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
13 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
14 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
15 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
161 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
185 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
229 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
234 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
235 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
243 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
244 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
248 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
249 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 0
Isolates 3.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 0
Rhizoplane 6.21
Rhizosphere 71.19
Stem 0
Stem Tuber 0
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1843142 2162886007 Bacteria 25559
2 SwRhRL2b_contig_3651366 2162886007 Bacteria 6229
3 JGI24748J21848_1010770 3300002074 Bacteria 1076
4 JGI24751J29686_10000113 3300002459 Bacteria 42221
5 Ga0065704_10017573 3300005289 Bacteria 1755
6 Ga0065704_10070220 3300005289 Bacteria 67739
7 Ga0065704_10071310 3300005289 Bacteria 11803
8 Ga0065704_10261777 3300005289 Bacteria 963
9 Ga0070658_10000652 3300005327 Bacteria 29975
10 Ga0070658_10029428 3300005327 Bacteria 4412
11 Ga0070658_10038879 3300005327 Bacteria 3837
12 Ga0070658_10298398 3300005327 Bacteria 1374
13 Ga0070683_100042459 3300005329 Bacteria 4187
14 Ga0070683_100665140 3300005329 Bacteria 997
15 Ga0070670_100160735 3300005331 Bacteria 1947
16 Ga0070666_10060034 3300005335 Bacteria 2573
17 Ga0070680_100108284 3300005336 Bacteria 2312
18 Ga0070680_100512379 3300005336 Bacteria 1027
19 Ga0070680_100740024 3300005336 Bacteria 846
20 Ga0070660_100001861 3300005339 Bacteria 14527
21 Ga0070660_100317848 3300005339 Bacteria 1278
22 Ga0070660_100667197 3300005339 Bacteria 871
23 Ga0070660_101131540 3300005339 Bacteria 663
24 Ga0070661_100000985 3300005344 Bacteria 20160
25 Ga0070661_100543403 3300005344 Bacteria 934
26 Ga0070661_101086271 3300005344 Bacteria 666
27 Ga0070668_100011227 3300005347 Bacteria 6670
28 Ga0070668_100012744 3300005347 Bacteria 6257
29 Ga0070668_100124411 3300005347 Bacteria 2065
30 Ga0070668_100362601 3300005347 Bacteria 1229
31 Ga0070668_100638156 3300005347 Bacteria 935
32 Ga0070668_101435293 3300005347 Bacteria 630
33 Ga0070669_100000062 3300005353 Bacteria 107705
34 Ga0070669_100002056 3300005353 Bacteria 14558
35 Ga0070669_100002134 3300005353 Bacteria 14303
36 Ga0070669_100516921 3300005353 Bacteria 992
37 Ga0070671_100000914 3300005355 Bacteria 21551
38 Ga0070671_100007099 3300005355 Bacteria 8961
39 Ga0070671_100020944 3300005355 Bacteria 5335
40 Ga0070671_100064768 3300005355 Bacteria 3044
41 Ga0070688_101082686 3300005365 Bacteria 640
42 Ga0070659_100027882 3300005366 Bacteria 4355
43 Ga0070659_100179264 3300005366 Bacteria 1738
44 Ga0070659_100522164 3300005366 Bacteria 1014
45 Ga0070659_101672310 3300005366 Bacteria 569
46 Ga0070667_100000763 3300005367 Bacteria 30599
47 Ga0070667_100034468 3300005367 Bacteria 4235
48 Ga0070667_100037248 3300005367 Bacteria 4078
49 Ga0070667_100136298 3300005367 Bacteria 2147
50 Ga0070667_100212022 3300005367 Bacteria 1722
51 Ga0070663_100015742 3300005455 Bacteria 4892
52 Ga0070663_100326159 3300005455 Bacteria 1236
53 Ga0070662_100000786 3300005457 Bacteria 19464
54 Ga0070662_100003681 3300005457 Bacteria 9581
55 Ga0070662_100079741 3300005457 Bacteria 2435
56 Ga0070681_10113906 3300005458 Bacteria 2643
57 Ga0070685_10539288 3300005466 Bacteria 831
58 Ga0070679_100257228 3300005530 Bacteria 1701
59 Ga0070679_100279669 3300005530 Bacteria 1622
60 Ga0070679_101065181 3300005530 Bacteria 753
61 Ga0070684_100033155 3300005535 Bacteria 4407
62 Ga0070684_100343228 3300005535 Bacteria 1373
63 Ga0068853_100014582 3300005539 Bacteria 6443
64 Ga0068853_100080709 3300005539 Bacteria 2847
65 Ga0068853_100607415 3300005539 Bacteria 1039
66 Ga0070672_101044620 3300005543 Bacteria 725
67 Ga0070696_101284993 3300005546 Bacteria 621
68 Ga0070665_100001346 3300005548 Bacteria 29176
69 Ga0070665_100010491 3300005548 Bacteria 9375
70 Ga0070665_100102277 3300005548 Bacteria 2868
71 Ga0068855_100012551 3300005563 Bacteria 10226
72 Ga0068855_100070712 3300005563 Bacteria 4059
73 Ga0068855_100152364 3300005563 Bacteria 2628
74 Ga0068855_100603168 3300005563 Bacteria 1184
75 Ga0070664_100009676 3300005564 Bacteria 7821
76 Ga0070664_100315006 3300005564 Bacteria 1416
77 Ga0070664_100577770 3300005564 Bacteria 1041
78 Ga0068857_100063193 3300005577 Bacteria 3291
79 Ga0068857_100069250 3300005577 Bacteria 3142
80 Ga0068854_100000469 3300005578 Bacteria 24902
81 Ga0068854_100003362 3300005578 Bacteria 9964
82 Ga0068854_100008248 3300005578 Bacteria 6689
83 Ga0068854_100292878 3300005578 Bacteria 1314
84 Ga0068856_100012503 3300005614 Bacteria 8217
85 Ga0068856_100310105 3300005614 Bacteria 1595
86 Ga0068852_100017888 3300005616 Bacteria 5572
87 Ga0068852_100194804 3300005616 Bacteria 1914
88 Ga0068852_100258931 3300005616 Bacteria 1670
89 Ga0068852_100353236 3300005616 Bacteria 1436
90 Ga0068852_100427178 3300005616 Bacteria 1308
91 Ga0068852_100690916 3300005616 Bacteria 1030
92 Ga0068852_101749664 3300005616 Bacteria 644
93 Ga0068859_100003919 3300005617 Bacteria 15197
94 Ga0068859_100082152 3300005617 Bacteria 3265
95 Ga0068859_100206719 3300005617 Bacteria 2048
96 Ga0068864_100087440 3300005618 Bacteria 2744
97 Ga0068864_102188029 3300005618 Bacteria 559
98 Ga0068870_10874256 3300005840 Bacteria 633
99 Ga0068863_100007404 3300005841 Bacteria 10742
100 Ga0068863_100041914 3300005841 Bacteria 4351
101 Ga0068863_100079671 3300005841 Bacteria 3102
102 Ga0068863_101298669 3300005841 Bacteria 734
103 Ga0068863_102087401 3300005841 Bacteria 577
104 Ga0068858_100026501 3300005842 Bacteria 5384
105 Ga0068858_100027618 3300005842 Bacteria 5272
106 Ga0068858_100040014 3300005842 Bacteria 4347
107 Ga0068858_100212524 3300005842 Bacteria 1831
108 Ga0068860_100047026 3300005843 Bacteria 4113
109 Ga0068860_100108644 3300005843 Bacteria 2651
110 Ga0068860_100166041 3300005843 Bacteria 2131
111 Ga0068860_100188476 3300005843 Bacteria 1995
112 Ga0068862_100006597 3300005844 Bacteria 9624
113 Ga0068862_100113733 3300005844 Bacteria 2378
114 Ga0075368_10000096 3300006042 Bacteria 22180
115 Ga0075363_100000887 3300006048 Bacteria 10536
116 Ga0075363_100010277 3300006048 Bacteria 4435
117 Ga0075364_10019446 3300006051 Bacteria 4263
118 Ga0075364_10034760 3300006051 Bacteria 3255
119 Ga0075432_10018325 3300006058 Bacteria 2388
120 Ga0075362_10000096 3300006177 Bacteria 24783
121 Ga0075362_10000884 3300006177 Bacteria 9088
122 Ga0075362_10142809 3300006177 Bacteria 1145
123 Ga0075369_10005036 3300006186 Bacteria 4921
124 Ga0075369_10005141 3300006186 Bacteria 4874
125 Ga0075369_10050491 3300006186 Bacteria 1799
126 Ga0075366_10000425 3300006195 Bacteria 19753
127 Ga0075370_10000003 3300006353 Bacteria 133163
128 Ga0075370_10109004 3300006353 Bacteria 1607
129 Ga0075370_10166257 3300006353 Bacteria 1296
130 Ga0097620_100003919 3300006931 Bacteria 15197
131 Ga0097620_100082152 3300006931 Bacteria 3265
132 Ga0097620_100206714 3300006931 Bacteria 2048
133 Ga0105251_10000528 3300009011 Bacteria 36047
134 Ga0105251_10015188 3300009011 Bacteria 4220
135 Ga0105250_10005950 3300009092 Bacteria 5390
136 Ga0105240_10079593 3300009093 Bacteria 4032
137 Ga0111539_10202047 3300009094 Bacteria 2317
138 Ga0105247_10062199 3300009101 Bacteria 2315
139 Ga0105247_10553353 3300009101 Bacteria 846
140 Ga0114129_11284325 3300009147 Bacteria 908
141 Ga0105243_10023056 3300009148 Bacteria 4736
142 Ga0105241_10628220 3300009174 Bacteria 973
143 Ga0105248_10003448 3300009177 Bacteria 17558
144 Ga0105248_10063561 3300009177 Bacteria 4143
145 Ga0105248_10249484 3300009177 Bacteria 1998
146 Ga0105248_10262198 3300009177 Bacteria 1945
147 Ga0105237_11736336 3300009545 Bacteria 631
148 Ga0105238_10096973 3300009551 Bacteria 2934
149 Ga0105249_12707114 3300009553 Bacteria 568
150 Ga0105246_10000103 3300011119 Bacteria 37033
151 Ga0157373_10260191 3300013100 Bacteria 1228
152 Ga0157371_10005523 3300013102 Bacteria 10641
153 Ga0157371_10016044 3300013102 Bacteria 5601
154 Ga0157371_10115713 3300013102 Bacteria 1905
155 Ga0157371_10480381 3300013102 Bacteria 916
156 Ga0157370_10005079 3300013104 Bacteria 14842
157 Ga0157370_11072479 3300013104 Bacteria 728
158 Ga0157369_10033224 3300013105 Bacteria 5671
159 Ga0157374_10795236 3300013296 Bacteria 961
160 Ga0163162_10521915 3300013306 Bacteria 1317
161 Ga0163162_10601955 3300013306 Bacteria 1225
162 Ga0157372_10027621 3300013307 Bacteria 6183
163 Ga0157372_10115862 3300013307 Bacteria 3072
164 Ga0157375_10433102 3300013308 Bacteria 1481
165 Ga0157375_12443195 3300013308 Bacteria 624
166 Ga0157380_11267268 3300014326 Bacteria 783
167 Ga0157379_10347782 3300014968 Bacteria 1357
168 Ga0163161_10025927 3300017792 Bacteria 4150
169 Ga0209050_1000119 3300025298 Bacteria 200661
170 Ga0207713_1002344 3300025735 Bacteria 13899
171 Ga0207713_1010702 3300025735 Bacteria 5053
172 Ga0207710_10017590 3300025900 Bacteria 3032
173 Ga0207710_10025255 3300025900 Bacteria 2563
174 Ga0207710_10383917 3300025900 Bacteria 719
175 Ga0207680_10447887 3300025903 Bacteria 916
176 Ga0207647_10015636 3300025904 Bacteria 5195
177 Ga0207705_10000023 3300025909 Bacteria 301755
178 Ga0207705_10020483 3300025909 Bacteria 4724
179 Ga0207705_10039289 3300025909 Bacteria 3391
180 Ga0207705_10295957 3300025909 Bacteria 1240
181 Ga0207705_10318140 3300025909 Bacteria 1195
182 Ga0207705_10940883 3300025909 Bacteria 669
183 Ga0207707_10100224 3300025912 Bacteria 2531
184 Ga0207695_10026492 3300025913 Bacteria 6471
185 Ga0207660_10147368 3300025917 Bacteria 1805
186 Ga0207657_10000081 3300025919 Bacteria 90714
187 Ga0207657_10018242 3300025919 Bacteria 6710
188 Ga0207657_10313408 3300025919 Bacteria 1241
189 Ga0207657_10425631 3300025919 Bacteria 1043
190 Ga0207649_10189211 3300025920 Bacteria 1446
191 Ga0207649_10442580 3300025920 Bacteria 979
192 Ga0207652_10002119 3300025921 Bacteria 17031
193 Ga0207652_10104402 3300025921 Bacteria 2507
194 Ga0207652_10135524 3300025921 Bacteria 2199
195 Ga0207652_10705625 3300025921 Bacteria 900
196 Ga0207652_10849206 3300025921 Bacteria 809
197 Ga0207681_10000441 3300025923 Bacteria 29051
198 Ga0207681_10000968 3300025923 Bacteria 18725
199 Ga0207681_10002663 3300025923 Bacteria 11318
200 Ga0207694_10107459 3300025924 Bacteria 2217
201 Ga0207650_10382418 3300025925 Bacteria 1162
202 Ga0207650_10665213 3300025925 Bacteria 878
203 Ga0207644_10000003 3300025931 Bacteria 585905
204 Ga0207644_10000963 3300025931 Bacteria 18367
205 Ga0207644_10004863 3300025931 Bacteria 8746
206 Ga0207644_10067139 3300025931 Bacteria 2613
207 Ga0207644_11789281 3300025931 Bacteria 514
208 Ga0207690_10012575 3300025932 Bacteria 5066
209 Ga0207690_10240162 3300025932 Bacteria 1395
210 Ga0207690_10362625 3300025932 Bacteria 1148
211 Ga0207690_11037161 3300025932 Bacteria 683
212 Ga0207706_10000112 3300025933 Bacteria 87100
213 Ga0207706_10030012 3300025933 Bacteria 4852
214 Ga0207706_10041101 3300025933 Bacteria 4100
215 Ga0207711_10003944 3300025941 Bacteria 12763
216 Ga0207711_10208629 3300025941 Bacteria 1784
217 Ga0207711_11082185 3300025941 Bacteria 742
218 Ga0207661_10149298 3300025944 Bacteria 2019
219 Ga0207679_10049535 3300025945 Bacteria 3065
220 Ga0207667_10019917 3300025949 Bacteria 7476
221 Ga0207667_10028160 3300025949 Bacteria 6103
222 Ga0207667_10051456 3300025949 Bacteria 4342
223 Ga0207667_10064908 3300025949 Bacteria 3809
224 Ga0207667_10229194 3300025949 Bacteria 1903
225 Ga0207712_10000109 3300025961 Bacteria 92018
226 Ga0207712_10262132 3300025961 Bacteria 1402
227 Ga0207712_11585569 3300025961 Bacteria 587
228 Ga0207668_10002601 3300025972 Bacteria 10560
229 Ga0207668_10004669 3300025972 Bacteria 8061
230 Ga0207668_10754146 3300025972 Bacteria 859
231 Ga0207668_11448926 3300025972 Bacteria 619
232 Ga0207668_11838115 3300025972 Bacteria 546
233 Ga0207640_10000394 3300025981 Bacteria 27805
234 Ga0207640_10000980 3300025981 Bacteria 15853
235 Ga0207640_10022065 3300025981 Bacteria 3805
236 Ga0207640_10639739 3300025981 Bacteria 905
237 Ga0207658_10000247 3300025986 Bacteria 56367
238 Ga0207658_10001670 3300025986 Bacteria 16897
239 Ga0207658_10007062 3300025986 Bacteria 7646
240 Ga0207658_10106481 3300025986 Bacteria 2208
241 Ga0207703_10018420 3300026035 Bacteria 5453
242 Ga0207703_10027509 3300026035 Bacteria 4479
243 Ga0207703_10087642 3300026035 Bacteria 2610
244 Ga0207639_10012185 3300026041 Bacteria 5983
245 Ga0207639_10070966 3300026041 Bacteria 2723
246 Ga0207639_10238228 3300026041 Bacteria 1581
247 Ga0207678_10008026 3300026067 Bacteria 9304
248 Ga0207678_10077872 3300026067 Bacteria 2840
249 Ga0207678_10375781 3300026067 Bacteria 1228
250 Ga0207702_10019818 3300026078 Bacteria 5570
251 Ga0207702_10876381 3300026078 Bacteria 889
252 Ga0207641_10005987 3300026088 Bacteria 10307
253 Ga0207641_10026854 3300026088 Bacteria 4754
254 Ga0207641_11615105 3300026088 Bacteria 650
255 Ga0207676_10399535 3300026095 Bacteria 1284
256 Ga0207674_10089460 3300026116 Bacteria 3071
257 Ga0207674_10116854 3300026116 Bacteria 2638
258 Ga0207674_10251790 3300026116 Bacteria 1713
259 Ga0207698_10000141 3300026142 Bacteria 45510
260 Ga0207698_10353771 3300026142 Bacteria 1388
261 Ga0207698_10384142 3300026142 Bacteria 1337
262 Ga0207698_10443806 3300026142 Bacteria 1251
263 Ga0207698_10599189 3300026142 Bacteria 1086
264 Ga0207698_10710774 3300026142 Bacteria 1001
265 Ga0207698_10954742 3300026142 Bacteria 866
266 Ga0209999_1025986 3300027543 Bacteria 1082
267 Ga0209983_1017576 3300027665 Bacteria 1481
268 Ga0209813_10000013 3300027866 Bacteria 89768
269 Ga0209974_10002037 3300027876 Bacteria 7383
270 Ga0207428_10075692 3300027907 Bacteria 2637
271 Ga0207428_10230132 3300027907 Bacteria 1387
272 Ga0268266_10000888 3300028379 Bacteria 38725
273 Ga0268266_10036781 3300028379 Bacteria 4170
274 Ga0268266_10568651 3300028379 Bacteria 1087
275 Ga0268265_10000082 3300028380 Bacteria 120835
276 Ga0268265_10004102 3300028380 Bacteria 10240
277 Ga0268265_10036925 3300028380 Bacteria 3582
278 Ga0268265_10058803 3300028380 Bacteria 2937
279 Ga0268264_10007612 3300028381 Bacteria 9030
280 Ga0268264_10018729 3300028381 Bacteria 5662
281 Ga0268264_10020062 3300028381 Bacteria 5462
282 Ga0268264_10132922 3300028381 Bacteria 2209
283 Ga0265326_10044594 3300028558 Bacteria 1258
284 Ga0265334_10129652 3300028573 Bacteria 898
285 Ga0265327_10034268 3300031251 Bacteria 2820
286 Ga0307408_100006324 3300031548 Bacteria 7863
287 Ga0307408_100269467 3300031548 Bacteria 1413
288 Ga0307405_10089334 3300031731 Bacteria 2035
289 Ga0307405_10135792 3300031731 Bacteria 1707
290 Ga0307405_10635229 3300031731 Bacteria 876
291 Ga0307405_11191134 3300031731 Bacteria 658
292 Ga0316577_10152849 3300031733 Bacteria 1301
293 Ga0307413_10062972 3300031824 Bacteria 2298
294 Ga0307413_10304416 3300031824 Bacteria 1210
295 Ga0307413_10368022 3300031824 Bacteria 1115
296 Ga0307413_10681758 3300031824 Bacteria 851
297 Ga0307410_10153229 3300031852 Bacteria 1718
298 Ga0307406_10066802 3300031901 Bacteria 2342
299 Ga0307406_10075557 3300031901 Bacteria 2223
300 Ga0307406_10613457 3300031901 Bacteria 898
301 Ga0307406_10822737 3300031901 Bacteria 785
302 Ga0307407_10025397 3300031903 Bacteria 3121
303 Ga0307412_10062513 3300031911 Bacteria 2507
304 Ga0307412_10131776 3300031911 Bacteria 1817
305 Ga0307412_10346920 3300031911 Bacteria 1190
306 Ga0307412_10806729 3300031911 Bacteria 815
307 Ga0307412_11043374 3300031911 Bacteria 724
308 Ga0307409_100104252 3300031995 Bacteria 2361
309 Ga0307409_100149019 3300031995 Bacteria 2028
310 Ga0307409_100595087 3300031995 Bacteria 1092
311 Ga0307416_100080212 3300032002 Bacteria 2753
312 Ga0307416_100118638 3300032002 Bacteria 2351
313 Ga0307416_100262144 3300032002 Bacteria 1690
314 Ga0307416_100684546 3300032002 Bacteria 1113
315 Ga0307416_101045322 3300032002 Bacteria 920
316 Ga0307416_101599058 3300032002 Bacteria 757
317 Ga0307416_101748795 3300032002 Bacteria 726
318 Ga0307416_102834104 3300032002 Bacteria 580
319 Ga0307414_10037439 3300032004 Bacteria 3248
320 Ga0307414_10181768 3300032004 Bacteria 1692
321 Ga0307414_10475571 3300032004 Bacteria 1101
322 Ga0307414_10542495 3300032004 Bacteria 1035
323 Ga0307414_10910172 3300032004 Bacteria 807
324 Ga0307411_10017044 3300032005 Bacteria 4126
325 Ga0307411_10190824 3300032005 Bacteria 1564
326 Ga0307411_10264341 3300032005 Bacteria 1360
327 Ga0307411_10374553 3300032005 Bacteria 1169
328 Ga0307411_10535215 3300032005 Bacteria 997
329 Ga0307411_11033239 3300032005 Bacteria 737
330 Ga0307415_100090140 3300032126 Bacteria 2217
331 Ga0307415_100108718 3300032126 Bacteria 2052
332 Ga0307415_100138619 3300032126 Bacteria 1854
333 Ga0307415_100256749 3300032126 Bacteria 1423
334 Ga0307415_101095170 3300032126 Bacteria 745
335 Ga0316583_10000951 3300032133 Bacteria 9324
336 Ga0373948_0028629 3300034817 Bacteria 1110
337 Ga0373928_0046337 3300035084 Bacteria 1014
338 Ga0373952_0024201 3300035092 Bacteria 1303
339 Ga0373932_0104166 3300035112 Bacteria 927
340 Ga0373962_0012660 3300035242 Bacteria 2129
341 Ga0373931_0025551 3300035691 Bacteria 3000
342 Ga0316582_0011932 3300036647 Bacteria 4828
343 Ga0316582_0319511 3300036647 Bacteria 1067
344 Ga0316584_0070878 3300036712 Bacteria 2612
345 Ga0316584_0101702 3300036712 Bacteria 2152
346 Ga0316584_0116444 3300036712 Bacteria 1999
347 Ga0439453_0009165 3300041408 Bacteria 1607
348 Ga0451837_0024481 3300041494 Bacteria 607
349 Ga0451837_0999491 3300041494 Bacteria 533
350 Ga0451841_0879509 3300041498 Bacteria 710
351 Ga0451855_0403470 3300041511 Bacteria 1086
352 Ga0451853_2193999 3300041512 Bacteria 665
353 Ga0451853_3878695 3300041512 Bacteria 861
354 Ga0439432_006611 3300042006 Bacteria 4131
355 Ga0450912_004097 3300042116 Bacteria 1068
356 Ga0450912_005521 3300042116 Bacteria 976
357 Ga0453684_0044010 3300044712 Bacteria 5986
358 Ga0495627_000599 3300046453 Bacteria 28763
359 Ga0495650_0000285 3300046471 Bacteria 95260
360 Ga0495639_0523860 3300046475 Bacteria 606
361 Ga0495585_0217250 3300046492 Bacteria 966
362 Ga0495596_0000621 3300046500 Bacteria 22273
363 Ga0495596_0002827 3300046500 Bacteria 9071
364 Ga0495607_0003651 3300046501 Bacteria 11685
365 Ga0495583_0364442 3300046506 Bacteria 569
366 Ga0495606_0047762 3300046507 Bacteria 2821
367 Ga0495610_0000020 3300046512 Bacteria 344007
368 Ga0495610_0000600 3300046512 Bacteria 35676
369 Ga0495620_0011522 3300046515 Bacteria 4611
370 Ga0495620_0031170 3300046515 Bacteria 2446
371 Ga0495632_0000915 3300046519 Bacteria 25910
372 Ga0495632_0081170 3300046519 Bacteria 1546
373 Ga0495643_0000351 3300046522 Bacteria 62687
374 Ga0495643_0003886 3300046522 Bacteria 10729
375 Ga0495643_0084084 3300046522 Bacteria 1651
376 Ga0495663_0262707 3300046525 Bacteria 615
377 Ga0495654_0062156 3300046530 Bacteria 1791
378 Ga0495609_0006701 3300046538 Bacteria 5841
379 Ga0495625_0011502 3300046660 Bacteria 7211
380 Ga0495625_0104400 3300046660 Bacteria 1943
381 Ga0495681_0000052 3300047470 Bacteria 106939
382 Ga0495686_0137229 3300047472 Bacteria 1446
383 Ga0495615_0000078 3300048090 Bacteria 29620
384 Ga0495626_0000450 3300048091 Bacteria 41919
385 Ga0496100_0006093 3300048903 Bacteria 6554
386 Ga0496101_0003045 3300048904 Bacteria 10341
387 Ga0496101_0543437 3300048904 Bacteria 918
388 Ga0496101_0996246 3300048904 Bacteria 659
389 Ga0496102_0000106 3300048905 Bacteria 118841
390 Ga0496102_0014312 3300048905 Bacteria 6894
391 Ga0496102_0169891 3300048905 Bacteria 2053
392 Ga0496102_0528633 3300048905 Bacteria 1102
393 Ga0496103_0000095 3300048906 Bacteria 98260
394 Ga0496103_0003597 3300048906 Bacteria 9457
395 Ga0496103_0171822 3300048906 Bacteria 1392
396 Ga0496104_0000060 3300048907 Bacteria 117966
397 Ga0496104_0037015 3300048907 Bacteria 4563
398 Ga0496104_0092450 3300048907 Bacteria 2892
399 Ga0496105_0000122 3300048908 Bacteria 52475
400 Ga0496105_0000751 3300048908 Bacteria 22003
401 Ga0496105_0194993 3300048908 Bacteria 1655
402 Ga0496106_0000950 3300048909 Bacteria 21126
403 Ga0496106_0247579 3300048909 Bacteria 1425
404 Ga0496107_0002226 3300048910 Bacteria 12479
405 Ga0496107_0025721 3300048910 Bacteria 4168
406 Ga0496108_0505003 3300048911 Bacteria 1056
407 Ga0496110_0027951 3300048913 Bacteria 4839
408 Ga0496110_0250907 3300048913 Bacteria 1610
409 Ga0496111_0102635 3300048914 Bacteria 2103
410 Ga0496112_0027217 3300048915 Bacteria 5514
411 Ga0496112_0525723 3300048915 Bacteria 1117
412 Ga0496112_1131798 3300048915 Bacteria 700
413 Ga0496113_0000260 3300048916 Bacteria 25008
414 Ga0496113_0002130 3300048916 Bacteria 11418
415 Ga0496114_0018945 3300048917 Bacteria 5575
416 Ga0496114_0542025 3300048917 Bacteria 1028
417 Ga0496115_0638152 3300048918 Bacteria 843
418 Ga0496116_0000035 3300048919 Bacteria 402424
419 Ga0496116_0018872 3300048919 Bacteria 5297
420 Ga0496117_0003116 3300048920 Bacteria 19798
421 Ga0496117_0060870 3300048920 Bacteria 2599
422 Ga0496117_0070598 3300048920 Bacteria 2345
423 Ga0496117_0182103 3300048920 Bacteria 1206
424 Ga0496118_0110866 3300048921 Bacteria 1821
425 Ga0496118_0365225 3300048921 Bacteria 763
426 Ga0496119_0000222 3300048922 Bacteria 79824
427 Ga0496119_0097295 3300048922 Bacteria 1659
428 Ga0496119_0107629 3300048922 Bacteria 1554
429 Ga0496120_0001728 3300048923 Bacteria 24842
430 Ga0496121_0000022 3300048924 Bacteria 472849
431 Ga0496121_0000312 3300048924 Bacteria 101230
432 Ga0496121_0001702 3300048924 Bacteria 36100
433 Ga0496121_0002209 3300048924 Bacteria 30388
434 Ga0496121_0009760 3300048924 Bacteria 10977
435 Ga0496121_0452629 3300048924 Bacteria 827
436 Ga0496122_0001902 3300048925 Bacteria 31581
437 Ga0496122_0003824 3300048925 Bacteria 19369
438 Ga0496123_0002409 3300048926 Bacteria 23351
439 Ga0496123_0005132 3300048926 Bacteria 13352
440 Ga0496123_0008987 3300048926 Bacteria 9068
441 Ga0496123_0083693 3300048926 Bacteria 1928
442 Ga0496124_0001019 3300048927 Bacteria 44416
443 Ga0496124_0012893 3300048927 Bacteria 8206
444 Ga0496124_0031206 3300048927 Bacteria 4720
445 Ga0496124_0033968 3300048927 Bacteria 4482
446 Ga0496124_0147150 3300048927 Bacteria 1852
447 Ga0496124_0542826 3300048927 Bacteria 769
448 Ga0496124_0545673 3300048927 Bacteria 766
449 Ga0496125_0018983 3300048928 Bacteria 6506
450 Ga0496125_0032050 3300048928 Bacteria 4674
451 Ga0496125_0092459 3300048928 Bacteria 2262
452 Ga0496125_0120192 3300048928 Bacteria 1876
453 Ga0496125_0221021 3300048928 Bacteria 1220
454 Ga0496125_0762171 3300048928 Bacteria 505
455 Ga0496126_0000084 3300048929 Bacteria 217111
456 Ga0496126_0000294 3300048929 Bacteria 106327
457 Ga0496126_0008503 3300048929 Bacteria 11060
458 Ga0496126_0183765 3300048929 Bacteria 1774
459 Ga0496126_0233643 3300048929 Bacteria 1539
460 Ga0496126_0597431 3300048929 Bacteria 870
461 Ga0501034_0722963 3300049571 Bacteria 893
462 Ga0501036_0926414 3300049572 Bacteria 715
463 Ga0501047_0604064 3300049581 Bacteria 918
464 Ga0501070_0231723 3300049586 Bacteria 1513
465 Ga0501035_0423689 3300049822 Bacteria 1105
466 Ga0501035_1310196 3300049822 Bacteria 558
467 Ga0501044_0357064 3300049823 Bacteria 1380
468 Ga0501044_0402145 3300049823 Bacteria 1282
469 nmdc:mga03683_2413_c1 3300050489 Bacteria 5802
470 nmdc:mga03683_30_c1 3300050489 Bacteria 71765
471 nmdc:mga03n38_781_c1 3300050490 Bacteria 8455
472 nmdc:mga00v17_216408_c1 3300050491 Bacteria 1240
473 nmdc:mga00v17_5585_c1 3300050491 Bacteria 6631
474 nmdc:mga00v17_594811_c1 3300050491 Bacteria 713
475 nmdc:mga0yw44_247593_c1 3300050492 Bacteria 1186
476 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
477 nmdc:mga0k408_44678_c1 3300050493 Bacteria 2555
478 nmdc:mga0k408_634548_c1 3300050493 Unclassified 629
479 nmdc:mga0k408_79996_c1 3300050493 Bacteria 1913
480 nmdc:mga06z11_49_c1 3300050494 Bacteria 50406
481 nmdc:mga04h51_979_c1 3300050495 Bacteria 6603
482 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
483 nmdc:mga07m45_20733_c2 3300050496 Bacteria 3216
484 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
485 nmdc:mga08y16_453805_c1 3300050511 Bacteria 1307
486 nmdc:mga08y16_827820_c1 3300050511 Bacteria 916
487 nmdc:mga0sz30_23939_c2 3300050516 Bacteria 1799
488 nmdc:mga0sz30_4905_c1 3300050516 Bacteria 4874
489 nmdc:mga0sz30_638_c1 3300050516 Bacteria 12975
490 Ga0500643_000001 3300053087 Bacteria 1440111
491 Ga0500647_0112522 3300053091 Bacteria 1293
492 Ga0500651_0576363 3300053093 Bacteria 613
493 Ga0500641_0024063 3300053096 Bacteria 2346
494 Ga0500562_062367 3300053108 Bacteria 1002
495 Ga0500572_213960 3300053111 Bacteria 631
496 Ga0500593_161403 3300053117 Bacteria 856
497 Ga0500607_000442 3300053121 Bacteria 39777
498 Ga0500608_272295 3300053122 Bacteria 646
499 Ga0500614_021586 3300053123 Bacteria 1495
500 Ga0500618_002611 3300053125 Bacteria 6639
501 Ga0500559_0072849 3300053136 Bacteria 1549
502 Ga0500559_0140196 3300053136 Bacteria 1132
503 Ga0500564_000556 3300053138 Bacteria 11222
504 Ga0500573_0022590 3300053140 Bacteria 3609
505 Ga0500577_0077329 3300053142 Bacteria 1319
506 Ga0500588_0179584 3300053146 Bacteria 778
507 Ga0500590_021528 3300053148 Bacteria 3347
508 Ga0500604_0236431 3300053151 Bacteria 631
509 Ga0500616_0218561 3300053153 Bacteria 832
510 Ga0500630_048597 3300053159 Bacteria 2055
511 Ga0500567_000268 3300053723 Bacteria 16135
512 Ga0500625_000041 3300053729 Bacteria 35224
513 Ga0500645_008868 3300053730 Bacteria 3405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10025927 Ga0163161_100259273 129
2 3300005329 Ga0070683_100042459 Ga0070683_1000424592 132
3 3300005336 Ga0070680_100108284 Ga0070680_1001082842 132
4 3300005339 Ga0070660_100001861 Ga0070660_1000018613 132
5 3300005344 Ga0070661_100000985 Ga0070661_10000098516 132
6 3300005457 Ga0070662_100000786 Ga0070662_10000078613 132
7 3300005458 Ga0070681_10113906 Ga0070681_101139062 132
8 3300005535 Ga0070684_100033155 Ga0070684_1000331552 132
9 3300005535 Ga0070684_100343228 Ga0070684_1003432283 132
10 3300005539 Ga0068853_100014582 Ga0068853_1000145824 132
11 3300005546 Ga0070696_101284993 Ga0070696_1012849931 132
12 3300005563 Ga0068855_100012551 Ga0068855_1000125518 132
13 3300005564 Ga0070664_100315006 Ga0070664_1003150061 132
14 3300005578 Ga0068854_100003362 Ga0068854_1000033629 132
15 3300005614 Ga0068856_100310105 Ga0068856_1003101052 132
16 3300009174 Ga0105241_10628220 Ga0105241_106282202 132
17 3300013100 Ga0157373_10260191 Ga0157373_102601912 132
18 3300013102 Ga0157371_10005523 Ga0157371_1000552311 132
19 3300013104 Ga0157370_10005079 Ga0157370_1000507914 132
20 3300013105 Ga0157369_10033224 Ga0157369_100332244 132
21 3300013307 Ga0157372_10027621 Ga0157372_100276214 132
22 3300013308 Ga0157375_10433102 Ga0157375_104331023 132
23 3300025912 Ga0207707_10100224 Ga0207707_101002243 132
24 3300025917 Ga0207660_10147368 Ga0207660_101473683 132
25 3300025919 Ga0207657_10000081 Ga0207657_1000008186 132
26 3300025920 Ga0207649_10189211 Ga0207649_101892112 132
27 3300025932 Ga0207690_10012575 Ga0207690_100125756 132
28 3300025933 Ga0207706_10000112 Ga0207706_1000011234 132
29 3300025949 Ga0207667_10064908 Ga0207667_100649083 132
30 3300025981 Ga0207640_10022065 Ga0207640_100220655 132
31 3300026041 Ga0207639_10012185 Ga0207639_100121853 132
32 3300026078 Ga0207702_10876381 Ga0207702_108763812 132
33 3300048914 Ga0496111_0102635 Ga0496111_0102635_1695_2093 132
34 3300005578 Ga0068854_100292878 Ga0068854_1002928782 133
35 3300025944 Ga0207661_10149298 Ga0207661_101492983 133
36 3300049822 Ga0501035_0423689 Ga0501035_0423689_353_811 133
37 3300005327 Ga0070658_10298398 Ga0070658_102983982 134
38 3300005329 Ga0070683_100665140 Ga0070683_1006651401 134
39 3300005336 Ga0070680_100740024 Ga0070680_1007400242 134
40 3300005339 Ga0070660_100317848 Ga0070660_1003178483 134
41 3300005339 Ga0070660_101131540 Ga0070660_1011315402 134
42 3300005366 Ga0070659_100027882 Ga0070659_1000278823 134
43 3300005455 Ga0070663_100015742 Ga0070663_1000157422 134
44 3300005455 Ga0070663_100326159 Ga0070663_1003261592 134
45 3300005457 Ga0070662_100079741 Ga0070662_1000797412 134
46 3300005539 Ga0068853_100607415 Ga0068853_1006074152 134
47 3300005564 Ga0070664_100009676 Ga0070664_1000096767 134
48 3300013102 Ga0157371_10480381 Ga0157371_104803812 134
49 3300013104 Ga0157370_11072479 Ga0157370_110724792 134
50 3300025909 Ga0207705_10295957 Ga0207705_102959573 134
51 3300025919 Ga0207657_10018242 Ga0207657_100182427 134
52 3300025920 Ga0207649_10442580 Ga0207649_104425802 134
53 3300025921 Ga0207652_10135524 Ga0207652_101355244 134
54 3300025921 Ga0207652_10849206 Ga0207652_108492062 134
55 3300025933 Ga0207706_10030012 Ga0207706_100300124 134
56 3300025945 Ga0207679_10049535 Ga0207679_100495354 134
57 3300025949 Ga0207667_10229194 Ga0207667_102291942 134
58 3300026041 Ga0207639_10238228 Ga0207639_102382282 134
59 3300026067 Ga0207678_10008026 Ga0207678_1000802610 134
60 3300026067 Ga0207678_10077872 Ga0207678_100778722 134
61 3300026067 Ga0207678_10375781 Ga0207678_103757813 134
62 3300005366 Ga0070659_100179264 Ga0070659_1001792642 135
63 3300005457 Ga0070662_100003681 Ga0070662_10000368110 135
64 3300011119 Ga0105246_10000103 Ga0105246_1000010334 135
65 3300013308 Ga0157375_12443195 Ga0157375_124431952 135
66 3300025932 Ga0207690_10362625 Ga0207690_103626252 135
67 3300025933 Ga0207706_10041101 Ga0207706_100411012 135
68 3300028573 Ga0265334_10129652 Ga0265334_101296522 135
69 3300005327 Ga0070658_10038879 Ga0070658_100388792 136
70 3300005577 Ga0068857_100063193 Ga0068857_1000631932 136
71 3300013296 Ga0157374_10795236 Ga0157374_107952362 136
72 3300025909 Ga0207705_10039289 Ga0207705_100392894 136
73 3300025919 Ga0207657_10313408 Ga0207657_103134082 136
74 3300025932 Ga0207690_10240162 Ga0207690_102401622 136
75 3300025949 Ga0207667_10019917 Ga0207667_100199174 136
76 3300026116 Ga0207674_10089460 Ga0207674_100894603 136
77 3300026116 Ga0207674_10116854 Ga0207674_101168542 136
78 3300032133 Ga0316583_10000951 Ga0316583_100009515 136
79 3300036647 Ga0316582_0011932 Ga0316582_0011932_2643_3104 136
80 3300036712 Ga0316584_0116444 Ga0316584_0116444_598_1059 136
81 3300013102 Ga0157371_10115713 Ga0157371_101157133 137
82 3300031911 Ga0307412_10131776 Ga0307412_101317764 137
83 3300042116 Ga0450912_005521 Ga0450912_005521_352_810 137
84 3300053146 Ga0500588_0179584 Ga0500588_0179584_250_711 137
85 3300031251 Ga0265327_10034268 Ga0265327_100342683 138
86 3300049586 Ga0501070_0231723 Ga0501070_0231723_553_1011 138
87 3300002459 JGI24751J29686_10000113 JGI24751J29686_1000011341 139
88 3300041494 Ga0451837_0024481 Ga0451837_0024481_12_431 139
89 3300005347 Ga0070668_101435293 Ga0070668_1014352931 140
90 3300009148 Ga0105243_10023056 Ga0105243_100230567 140
91 3300025972 Ga0207668_10754146 Ga0207668_107541462 140
92 3300048928 Ga0496125_0762171 Ga0496125_0762171_72_494 140
93 3300053121 Ga0500607_000442 Ga0500607_000442_29438_29893 140
94 3300053136 Ga0500559_0140196 Ga0500559_0140196_630_1091 140
95 3300005366 Ga0070659_101672310 Ga0070659_1016723101 141
96 3300005539 Ga0068853_100080709 Ga0068853_1000807094 141
97 3300025932 Ga0207690_11037161 Ga0207690_110371612 141
98 3300026041 Ga0207639_10070966 Ga0207639_100709662 141
99 3300036712 Ga0316584_0101702 Ga0316584_0101702_25_486 143
100 3300053142 Ga0500577_0077329 Ga0500577_0077329_848_1282 143
101 3300025900 Ga0207710_10025255 Ga0207710_100252552 144
102 3300025961 Ga0207712_10000109 Ga0207712_100001098 144
103 3300026088 Ga0207641_10026854 Ga0207641_100268546 144
104 3300028380 Ga0268265_10000082 Ga0268265_1000008261 144
105 3300028381 Ga0268264_10018729 Ga0268264_100187295 144
106 iso_pu_bacteria 2919138771 2919139943 144
107 3300006058 Ga0075432_10018325 Ga0075432_100183252 145
108 3300006353 Ga0075370_10109004 Ga0075370_101090042 145
109 3300027907 Ga0207428_10075692 Ga0207428_100756922 145
110 3300009147 Ga0114129_11284325 Ga0114129_112843252 146
111 3300027543 Ga0209999_1025986 Ga0209999_10259862 146
112 3300027665 Ga0209983_1017576 Ga0209983_10175762 146
113 3300027876 Ga0209974_10002037 Ga0209974_100020372 146
114 3300031731 Ga0307405_10135792 Ga0307405_101357924 146
115 3300031901 Ga0307406_10613457 Ga0307406_106134573 146
116 3300031911 Ga0307412_11043374 Ga0307412_110433742 146
117 3300031995 Ga0307409_100104252 Ga0307409_1001042524 146
118 3300032002 Ga0307416_100118638 Ga0307416_1001186381 146
119 3300032005 Ga0307411_10017044 Ga0307411_100170442 146
120 3300032126 Ga0307415_100256749 Ga0307415_1002567492 146
121 3300041408 Ga0439453_0009165 Ga0439453_0009165_22_468 146
122 3300042006 Ga0439432_006611 Ga0439432_006611_2330_2770 146
123 iso_pu_bacteria 2510917021 2511126145 146
124 iso_pu_bacteria 2738541275 2738712544 146
125 iso_pu_bacteria 2738541301 2738850968 146
126 iso_pu_bacteria 2738541304 2738866698 146
127 iso_pu_bacteria 2738543022 2739299215 146
128 iso_pu_bacteria 2738543033 2739360894 146
129 iso_pu_bacteria 2928100450 2928103852 146
130 iso_pu_bacteria 2928959182 2928961781 146
131 2162886007 SwRhRL2b_contig_3651366 SwRhRL2b_0462.00003040 147
132 3300002074 JGI24748J21848_1010770 JGI24748J21848_10107703 147
133 3300005289 Ga0065704_10071310 Ga0065704_1007131012 147
134 3300005327 Ga0070658_10029428 Ga0070658_100294282 147
135 3300005347 Ga0070668_100011227 Ga0070668_1000112278 147
136 3300005353 Ga0070669_100002056 Ga0070669_1000020565 147
137 3300005353 Ga0070669_100516921 Ga0070669_1005169213 147
138 3300005355 Ga0070671_100064768 Ga0070671_1000647683 147
139 3300005367 Ga0070667_100034468 Ga0070667_1000344686 147
140 3300005548 Ga0070665_100010491 Ga0070665_1000104915 147
141 3300005564 Ga0070664_100577770 Ga0070664_1005777703 147
142 3300005577 Ga0068857_100069250 Ga0068857_1000692503 147
143 3300005578 Ga0068854_100000469 Ga0068854_10000046919 147
144 3300005616 Ga0068852_100690916 Ga0068852_1006909162 147
145 3300005617 Ga0068859_100082152 Ga0068859_1000821522 147
146 3300005841 Ga0068863_101298669 Ga0068863_1012986691 147
147 3300005842 Ga0068858_100040014 Ga0068858_1000400145 147
148 3300005843 Ga0068860_100166041 Ga0068860_1001660414 147
149 3300006931 Ga0097620_100082152 Ga0097620_1000821522 147
150 3300009011 Ga0105251_10015188 Ga0105251_100151882 147
151 3300009092 Ga0105250_10005950 Ga0105250_100059502 147
152 3300013306 Ga0163162_10601955 Ga0163162_106019552 147
153 3300025735 Ga0207713_1010702 Ga0207713_10107029 147
154 3300025909 Ga0207705_10020483 Ga0207705_100204835 147
155 3300025923 Ga0207681_10002663 Ga0207681_100026635 147
156 3300025931 Ga0207644_10000963 Ga0207644_100009633 147
157 3300025931 Ga0207644_11789281 Ga0207644_117892811 147
158 3300025972 Ga0207668_10002601 Ga0207668_100026017 147
159 3300025972 Ga0207668_11838115 Ga0207668_118381151 147
160 3300025981 Ga0207640_10000980 Ga0207640_100009802 147
161 3300025986 Ga0207658_10001670 Ga0207658_100016706 147
162 3300026116 Ga0207674_10251790 Ga0207674_102517903 147
163 3300026142 Ga0207698_10384142 Ga0207698_103841423 147
164 3300026142 Ga0207698_10710774 Ga0207698_107107742 147
165 3300028379 Ga0268266_10036781 Ga0268266_100367811 147
166 3300028380 Ga0268265_10004102 Ga0268265_100041026 147
167 3300028381 Ga0268264_10132922 Ga0268264_101329223 147
168 3300031731 Ga0307405_11191134 Ga0307405_111911341 147
169 3300031824 Ga0307413_10681758 Ga0307413_106817582 147
170 3300031852 Ga0307410_10153229 Ga0307410_101532292 147
171 3300031901 Ga0307406_10066802 Ga0307406_100668024 147
172 3300031903 Ga0307407_10025397 Ga0307407_100253972 147
173 3300031995 Ga0307409_100149019 Ga0307409_1001490191 147
174 3300032002 Ga0307416_101045322 Ga0307416_1010453223 147
175 3300032002 Ga0307416_101748795 Ga0307416_1017487952 147
176 3300032004 Ga0307414_10542495 Ga0307414_105424952 147
177 3300032004 Ga0307414_10910172 Ga0307414_109101722 147
178 3300032005 Ga0307411_11033239 Ga0307411_110332392 147
179 3300032126 Ga0307415_100090140 Ga0307415_1000901402 147
180 3300032126 Ga0307415_100138619 Ga0307415_1001386192 147
181 3300041498 Ga0451841_0879509 Ga0451841_0879509_53_508 147
182 3300048903 Ga0496100_0006093 Ga0496100_0006093_3606_4058 147
183 3300048904 Ga0496101_0003045 Ga0496101_0003045_8123_8575 147
184 3300048905 Ga0496102_0000106 Ga0496102_0000106_39065_39517 147
185 3300048906 Ga0496103_0000095 Ga0496103_0000095_64512_64964 147
186 3300048907 Ga0496104_0000060 Ga0496104_0000060_49419_49871 147
187 3300048908 Ga0496105_0000122 Ga0496105_0000122_1601_2053 147
188 3300048909 Ga0496106_0247579 Ga0496106_0247579_650_1102 147
189 3300048910 Ga0496107_0002226 Ga0496107_0002226_6282_6734 147
190 3300048915 Ga0496112_0027217 Ga0496112_0027217_3781_4233 147
191 3300048916 Ga0496113_0002130 Ga0496113_0002130_5490_5942 147
192 3300048917 Ga0496114_0018945 Ga0496114_0018945_4853_5308 147
193 3300048918 Ga0496115_0638152 Ga0496115_0638152_22_474 147
194 3300048920 Ga0496117_0003116 Ga0496117_0003116_2769_3221 147
195 3300048921 Ga0496118_0365225 Ga0496118_0365225_252_704 147
196 3300048922 Ga0496119_0000222 Ga0496119_0000222_66204_66656 147
197 3300048923 Ga0496120_0001728 Ga0496120_0001728_9703_10155 147
198 3300048924 Ga0496121_0000022 Ga0496121_0000022_188897_189364 147
199 3300048924 Ga0496121_0009760 Ga0496121_0009760_8759_9211 147
200 3300048926 Ga0496123_0008987 Ga0496123_0008987_919_1371 147
201 3300048927 Ga0496124_0001019 Ga0496124_0001019_24378_24830 147
202 3300048929 Ga0496126_0000294 Ga0496126_0000294_27506_27958 147
203 3300048929 Ga0496126_0233643 Ga0496126_0233643_674_1126 147
204 3300053108 Ga0500562_062367 Ga0500562_062367_281_727 147
205 3300053125 Ga0500618_002611 Ga0500618_002611_4562_5011 147
206 3300053151 Ga0500604_0236431 Ga0500604_0236431_146_592 147
207 iso_pu_bacteria 2739367664 2739650398 147
208 iso_pu_bacteria 2739367865 2740028871 147
209 iso_pu_bacteria 2848297114 2848298430 147
210 iso_pu_bacteria 3000865235 3000865475 147
211 3300005336 Ga0070680_100512379 Ga0070680_1005123791 148
212 3300005339 Ga0070660_100667197 Ga0070660_1006671971 148
213 3300005344 Ga0070661_100543403 Ga0070661_1005434031 148
214 3300005344 Ga0070661_101086271 Ga0070661_1010862712 148
215 3300005366 Ga0070659_100522164 Ga0070659_1005221643 148
216 3300005530 Ga0070679_100257228 Ga0070679_1002572283 148
217 3300005530 Ga0070679_100279669 Ga0070679_1002796692 148
218 3300005530 Ga0070679_101065181 Ga0070679_1010651811 148
219 3300005543 Ga0070672_101044620 Ga0070672_1010446202 148
220 3300005616 Ga0068852_101749664 Ga0068852_1017496641 148
221 3300005840 Ga0068870_10874256 Ga0068870_108742562 148
222 3300006042 Ga0075368_10000096 Ga0075368_1000009614 148
223 3300006048 Ga0075363_100010277 Ga0075363_1000102774 148
224 3300006051 Ga0075364_10019446 Ga0075364_100194465 148
225 3300006177 Ga0075362_10000884 Ga0075362_100008846 148
226 3300006186 Ga0075369_10005036 Ga0075369_100050363 148
227 3300006353 Ga0075370_10166257 Ga0075370_101662573 148
228 3300009094 Ga0111539_10202047 Ga0111539_102020472 148
229 3300013102 Ga0157371_10016044 Ga0157371_100160448 148
230 3300013307 Ga0157372_10115862 Ga0157372_101158622 148
231 3300014326 Ga0157380_11267268 Ga0157380_112672682 148
232 3300025909 Ga0207705_10318140 Ga0207705_103181403 148
233 3300025909 Ga0207705_10940883 Ga0207705_109408832 148
234 3300025919 Ga0207657_10425631 Ga0207657_104256312 148
235 3300025921 Ga0207652_10002119 Ga0207652_100021196 148
236 3300025921 Ga0207652_10104402 Ga0207652_101044024 148
237 3300025921 Ga0207652_10705625 Ga0207652_107056253 148
238 3300025961 Ga0207712_10262132 Ga0207712_102621323 148
239 3300027866 Ga0209813_10000013 Ga0209813_1000001342 148
240 3300028558 Ga0265326_10044594 Ga0265326_100445942 148
241 3300031548 Ga0307408_100006324 Ga0307408_1000063248 148
242 3300031548 Ga0307408_100269467 Ga0307408_1002694671 148
243 3300031731 Ga0307405_10089334 Ga0307405_100893343 148
244 3300031731 Ga0307405_10635229 Ga0307405_106352292 148
245 3300031733 Ga0316577_10152849 Ga0316577_101528491 148
246 3300031824 Ga0307413_10062972 Ga0307413_100629723 148
247 3300031824 Ga0307413_10304416 Ga0307413_103044162 148
248 3300031824 Ga0307413_10368022 Ga0307413_103680223 148
249 3300031901 Ga0307406_10075557 Ga0307406_100755572 148
250 3300031901 Ga0307406_10822737 Ga0307406_108227371 148
251 3300031911 Ga0307412_10062513 Ga0307412_100625132 148
252 3300031911 Ga0307412_10806729 Ga0307412_108067293 148
253 3300031995 Ga0307409_100595087 Ga0307409_1005950873 148
254 3300032002 Ga0307416_100080212 Ga0307416_1000802123 148
255 3300032002 Ga0307416_100262144 Ga0307416_1002621442 148
256 3300032002 Ga0307416_100684546 Ga0307416_1006845463 148
257 3300032002 Ga0307416_101599058 Ga0307416_1015990581 148
258 3300032002 Ga0307416_102834104 Ga0307416_1028341041 148
259 3300032004 Ga0307414_10037439 Ga0307414_100374392 148
260 3300032004 Ga0307414_10181768 Ga0307414_101817683 148
261 3300032004 Ga0307414_10475571 Ga0307414_104755712 148
262 3300032005 Ga0307411_10190824 Ga0307411_101908242 148
263 3300032005 Ga0307411_10264341 Ga0307411_102643412 148
264 3300032005 Ga0307411_10374553 Ga0307411_103745531 148
265 3300032005 Ga0307411_10535215 Ga0307411_105352153 148
266 3300032126 Ga0307415_100108718 Ga0307415_1001087182 148
267 3300032126 Ga0307415_101095170 Ga0307415_1010951702 148
268 3300034817 Ga0373948_0028629 Ga0373948_0028629_530_976 148
269 3300035084 Ga0373928_0046337 Ga0373928_0046337_140_586 148
270 3300035092 Ga0373952_0024201 Ga0373952_0024201_242_688 148
271 3300035112 Ga0373932_0104166 Ga0373932_0104166_102_548 148
272 3300035242 Ga0373962_0012660 Ga0373962_0012660_774_1220 148
273 3300035691 Ga0373931_0025551 Ga0373931_0025551_243_689 148
274 3300036647 Ga0316582_0319511 Ga0316582_0319511_38_499 148
275 3300036712 Ga0316584_0070878 Ga0316584_0070878_1140_1601 148
276 3300041494 Ga0451837_0999491 Ga0451837_0999491_23_481 148
277 3300041512 Ga0451853_3878695 Ga0451853_3878695_251_709 148
278 3300042116 Ga0450912_004097 Ga0450912_004097_32_493 148
279 3300046492 Ga0495585_0217250 Ga0495585_0217250_455_907 148
280 3300046500 Ga0495596_0002827 Ga0495596_0002827_6513_6965 148
281 3300046501 Ga0495607_0003651 Ga0495607_0003651_2649_3101 148
282 3300046507 Ga0495606_0047762 Ga0495606_0047762_1783_2235 148
283 3300046512 Ga0495610_0000600 Ga0495610_0000600_29025_29477 148
284 3300046519 Ga0495632_0081170 Ga0495632_0081170_779_1231 148
285 3300046522 Ga0495643_0000351 Ga0495643_0000351_31677_32129 148
286 3300046522 Ga0495643_0003886 Ga0495643_0003886_2410_2862 148
287 3300046522 Ga0495643_0084084 Ga0495643_0084084_820_1272 148
288 3300046538 Ga0495609_0006701 Ga0495609_0006701_2020_2472 148
289 3300046660 Ga0495625_0011502 Ga0495625_0011502_1862_2314 148
290 3300047472 Ga0495686_0137229 Ga0495686_0137229_576_1025 148
291 3300049571 Ga0501034_0722963 Ga0501034_0722963_289_738 148
292 3300049572 Ga0501036_0926414 Ga0501036_0926414_23_472 148
293 3300049581 Ga0501047_0604064 Ga0501047_0604064_122_571 148
294 3300049822 Ga0501035_1310196 Ga0501035_1310196_10_459 148
295 3300049823 Ga0501044_0357064 Ga0501044_0357064_275_736 148
296 3300049823 Ga0501044_0402145 Ga0501044_0402145_351_815 148
297 3300050489 nmdc:mga03683_2413_c1 nmdc:mga03683_2413_c1_126_581 148
298 3300050491 nmdc:mga00v17_5585_c1 nmdc:mga00v17_5585_c1_2540_2995 148
299 3300050492 nmdc:mga0yw44_247593_c1 nmdc:mga0yw44_247593_c1_169_624 148
300 3300050493 nmdc:mga0k408_3_c1 nmdc:mga0k408_3_c1_170432_170878 148
301 3300050493 nmdc:mga0k408_79996_c1 nmdc:mga0k408_79996_c1_312_767 148
302 3300050494 nmdc:mga06z11_49_c1 nmdc:mga06z11_49_c1_13004_13459 148
303 3300050495 nmdc:mga04h51_979_c1 nmdc:mga04h51_979_c1_3577_4032 148
304 3300050496 nmdc:mga07m45_16_c1 nmdc:mga07m45_16_c1_119041_119496 148
305 3300050496 nmdc:mga07m45_20733_c2 nmdc:mga07m45_20733_c2_284_745 148
306 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_75797_76243 148
307 3300050511 nmdc:mga08y16_453805_c1 nmdc:mga08y16_453805_c1_672_1118 148
308 3300050511 nmdc:mga08y16_827820_c1 nmdc:mga08y16_827820_c1_157_615 148
309 3300050516 nmdc:mga0sz30_638_c1 nmdc:mga0sz30_638_c1_10318_10773 148
310 3300053087 Ga0500643_000001 Ga0500643_000001_937197_937652 148
311 3300053093 Ga0500651_0576363 Ga0500651_0576363_41_496 148
312 3300053096 Ga0500641_0024063 Ga0500641_0024063_1167_1628 148
313 3300053117 Ga0500593_161403 Ga0500593_161403_51_509 148
314 3300053153 Ga0500616_0218561 Ga0500616_0218561_254_709 148
315 3300053730 Ga0500645_008868 Ga0500645_008868_2831_3289 148
316 iso_pu_bacteria 2643221588 2643949651 148
317 iso_pu_bacteria 2818991438 2819552709 148
318 iso_pu_bacteria 2896184354 2896184522 148
319 iso_pu_bacteria 2896253425 2896256599 148
320 iso_pu_bacteria 8054302542 8054302931 148
321 3300005289 Ga0065704_10261777 Ga0065704_102617771 149
322 3300005331 Ga0070670_100160735 Ga0070670_1001607352 149
323 3300005347 Ga0070668_100012744 Ga0070668_1000127446 149
324 3300005353 Ga0070669_100002134 Ga0070669_1000021346 149
325 3300005355 Ga0070671_100007099 Ga0070671_1000070994 149
326 3300005367 Ga0070667_100037248 Ga0070667_1000372482 149
327 3300005548 Ga0070665_100001346 Ga0070665_10000134629 149
328 3300005841 Ga0068863_100079671 Ga0068863_1000796712 149
329 3300005842 Ga0068858_100027618 Ga0068858_1000276185 149
330 3300005843 Ga0068860_100108644 Ga0068860_1001086442 149
331 3300005844 Ga0068862_100113733 Ga0068862_1001137332 149
332 3300006177 Ga0075362_10142809 Ga0075362_101428092 149
333 3300006186 Ga0075369_10050491 Ga0075369_100504913 149
334 3300009011 Ga0105251_10000528 Ga0105251_1000052813 149
335 3300009101 Ga0105247_10062199 Ga0105247_100621992 149
336 3300009177 Ga0105248_10003448 Ga0105248_100034489 149
337 3300009553 Ga0105249_12707114 Ga0105249_127071142 149
338 3300025735 Ga0207713_1002344 Ga0207713_10023446 149
339 3300025900 Ga0207710_10017590 Ga0207710_100175903 149
340 3300025923 Ga0207681_10000968 Ga0207681_1000096818 149
341 3300025931 Ga0207644_10004863 Ga0207644_1000486310 149
342 3300025941 Ga0207711_10003944 Ga0207711_100039446 149
343 3300025961 Ga0207712_11585569 Ga0207712_115855692 149
344 3300025972 Ga0207668_10004669 Ga0207668_100046695 149
345 3300025986 Ga0207658_10007062 Ga0207658_1000706211 149
346 3300026035 Ga0207703_10027509 Ga0207703_100275092 149
347 3300028379 Ga0268266_10000888 Ga0268266_1000088821 149
348 3300028380 Ga0268265_10036925 Ga0268265_100369254 149
349 3300028381 Ga0268264_10020062 Ga0268264_100200623 149
350 3300046475 Ga0495639_0523860 Ga0495639_0523860_73_540 149
351 3300046530 Ga0495654_0062156 Ga0495654_0062156_617_1084 149
352 3300048904 Ga0496101_0996246 Ga0496101_0996246_117_575 149
353 3300048905 Ga0496102_0528633 Ga0496102_0528633_253_711 149
354 3300048906 Ga0496103_0003597 Ga0496103_0003597_8598_9056 149
355 3300048919 Ga0496116_0018872 Ga0496116_0018872_3301_3759 149
356 3300048920 Ga0496117_0060870 Ga0496117_0060870_1035_1493 149
357 3300048920 Ga0496117_0182103 Ga0496117_0182103_688_1146 149
358 3300048921 Ga0496118_0110866 Ga0496118_0110866_1036_1494 149
359 3300048922 Ga0496119_0107629 Ga0496119_0107629_738_1196 149
360 3300048924 Ga0496121_0001702 Ga0496121_0001702_382_840 149
361 3300048926 Ga0496123_0083693 Ga0496123_0083693_707_1165 149
362 3300048927 Ga0496124_0147150 Ga0496124_0147150_799_1257 149
363 3300048928 Ga0496125_0018983 Ga0496125_0018983_5456_5914 149
364 3300048928 Ga0496125_0120192 Ga0496125_0120192_751_1209 149
365 3300048928 Ga0496125_0221021 Ga0496125_0221021_751_1209 149
366 3300048929 Ga0496126_0183765 Ga0496126_0183765_1158_1616 149
367 3300050493 nmdc:mga0k408_44678_c1 nmdc:mga0k408_44678_c1_2034_2498 149
368 3300050493 nmdc:mga0k408_634548_c1 nmdc:mga0k408_634548_c1_137_607 149
369 3300050516 nmdc:mga0sz30_23939_c2 nmdc:mga0sz30_23939_c2_963_1430 149
370 3300053091 Ga0500647_0112522 Ga0500647_0112522_780_1247 149
371 3300053123 Ga0500614_021586 Ga0500614_021586_97_564 149
372 3300053136 Ga0500559_0072849 Ga0500559_0072849_73_540 149
373 3300053138 Ga0500564_000556 Ga0500564_000556_5182_5649 149
374 3300053140 Ga0500573_0022590 Ga0500573_0022590_1511_1978 149
375 3300053159 Ga0500630_048597 Ga0500630_048597_1230_1697 149
376 3300053723 Ga0500567_000268 Ga0500567_000268_3363_3830 149
377 3300053729 Ga0500625_000041 Ga0500625_000041_16214_16681 149
378 2162886007 SwRhRL2b_contig_1843142 SwRhRL2b_0515.00004860 150
379 3300005289 Ga0065704_10017573 Ga0065704_100175733 150
380 3300005289 Ga0065704_10070220 Ga0065704_1007022046 150
381 3300005327 Ga0070658_10000652 Ga0070658_1000065224 150
382 3300005335 Ga0070666_10060034 Ga0070666_100600342 150
383 3300005347 Ga0070668_100124411 Ga0070668_1001244112 150
384 3300005347 Ga0070668_100362601 Ga0070668_1003626013 150
385 3300005347 Ga0070668_100638156 Ga0070668_1006381562 150
386 3300005353 Ga0070669_100000062 Ga0070669_10000006215 150
387 3300005355 Ga0070671_100000914 Ga0070671_10000091410 150
388 3300005355 Ga0070671_100020944 Ga0070671_1000209446 150
389 3300005365 Ga0070688_101082686 Ga0070688_1010826861 150
390 3300005367 Ga0070667_100000763 Ga0070667_10000076315 150
391 3300005367 Ga0070667_100136298 Ga0070667_1001362982 150
392 3300005367 Ga0070667_100212022 Ga0070667_1002120223 150
393 3300005466 Ga0070685_10539288 Ga0070685_105392881 150
394 3300005548 Ga0070665_100102277 Ga0070665_1001022772 150
395 3300005563 Ga0068855_100070712 Ga0068855_1000707124 150
396 3300005563 Ga0068855_100152364 Ga0068855_1001523642 150
397 3300005563 Ga0068855_100603168 Ga0068855_1006031681 150
398 3300005578 Ga0068854_100008248 Ga0068854_1000082488 150
399 3300005614 Ga0068856_100012503 Ga0068856_1000125038 150
400 3300005616 Ga0068852_100017888 Ga0068852_1000178888 150
401 3300005616 Ga0068852_100194804 Ga0068852_1001948042 150
402 3300005616 Ga0068852_100258931 Ga0068852_1002589312 150
403 3300005616 Ga0068852_100353236 Ga0068852_1003532363 150
404 3300005616 Ga0068852_100427178 Ga0068852_1004271783 150
405 3300005617 Ga0068859_100003919 Ga0068859_1000039198 150
406 3300005617 Ga0068859_100206719 Ga0068859_1002067192 150
407 3300005618 Ga0068864_100087440 Ga0068864_1000874406 150
408 3300005618 Ga0068864_102188029 Ga0068864_1021880291 150
409 3300005841 Ga0068863_100007404 Ga0068863_1000074043 150
410 3300005841 Ga0068863_100041914 Ga0068863_1000419148 150
411 3300005841 Ga0068863_102087401 Ga0068863_1020874011 150
412 3300005842 Ga0068858_100026501 Ga0068858_1000265016 150
413 3300005842 Ga0068858_100212524 Ga0068858_1002125242 150
414 3300005843 Ga0068860_100047026 Ga0068860_1000470267 150
415 3300005843 Ga0068860_100188476 Ga0068860_1001884762 150
416 3300005844 Ga0068862_100006597 Ga0068862_1000065976 150
417 3300006048 Ga0075363_100000887 Ga0075363_1000008874 150
418 3300006051 Ga0075364_10034760 Ga0075364_100347604 150
419 3300006177 Ga0075362_10000096 Ga0075362_1000009620 150
420 3300006186 Ga0075369_10005141 Ga0075369_100051413 150
421 3300006195 Ga0075366_10000425 Ga0075366_1000042522 150
422 3300006353 Ga0075370_10000003 Ga0075370_1000000361 150
423 3300006931 Ga0097620_100003919 Ga0097620_10000391912 150
424 3300006931 Ga0097620_100206714 Ga0097620_1002067141 150
425 3300009093 Ga0105240_10079593 Ga0105240_100795932 150
426 3300009101 Ga0105247_10553353 Ga0105247_105533532 150
427 3300009177 Ga0105248_10063561 Ga0105248_100635616 150
428 3300009177 Ga0105248_10249484 Ga0105248_102494841 150
429 3300009177 Ga0105248_10262198 Ga0105248_102621982 150
430 3300009545 Ga0105237_11736336 Ga0105237_117363362 150
431 3300009551 Ga0105238_10096973 Ga0105238_100969732 150
432 3300013306 Ga0163162_10521915 Ga0163162_105219152 150
433 3300014968 Ga0157379_10347782 Ga0157379_103477823 150
434 3300025298 Ga0209050_1000119 Ga0209050_1000119126 150
435 3300025900 Ga0207710_10383917 Ga0207710_103839172 150
436 3300025903 Ga0207680_10447887 Ga0207680_104478872 150
437 3300025904 Ga0207647_10015636 Ga0207647_100156362 150
438 3300025909 Ga0207705_10000023 Ga0207705_10000023219 150
439 3300025913 Ga0207695_10026492 Ga0207695_100264926 150
440 3300025923 Ga0207681_10000441 Ga0207681_1000044128 150
441 3300025924 Ga0207694_10107459 Ga0207694_101074593 150
442 3300025925 Ga0207650_10382418 Ga0207650_103824182 150
443 3300025925 Ga0207650_10665213 Ga0207650_106652133 150
444 3300025931 Ga0207644_10000003 Ga0207644_10000003357 150
445 3300025931 Ga0207644_10067139 Ga0207644_100671393 150
446 3300025941 Ga0207711_10208629 Ga0207711_102086292 150
447 3300025941 Ga0207711_11082185 Ga0207711_110821852 150
448 3300025949 Ga0207667_10028160 Ga0207667_100281606 150
449 3300025949 Ga0207667_10051456 Ga0207667_100514567 150
450 3300025972 Ga0207668_11448926 Ga0207668_114489261 150
451 3300025981 Ga0207640_10000394 Ga0207640_100003949 150
452 3300025981 Ga0207640_10639739 Ga0207640_106397392 150
453 3300025986 Ga0207658_10000247 Ga0207658_1000024739 150
454 3300025986 Ga0207658_10106481 Ga0207658_101064814 150
455 3300026035 Ga0207703_10018420 Ga0207703_100184203 150
456 3300026035 Ga0207703_10087642 Ga0207703_100876422 150
457 3300026078 Ga0207702_10019818 Ga0207702_100198186 150
458 3300026088 Ga0207641_10005987 Ga0207641_100059873 150
459 3300026088 Ga0207641_11615105 Ga0207641_116151052 150
460 3300026095 Ga0207676_10399535 Ga0207676_103995352 150
461 3300026142 Ga0207698_10000141 Ga0207698_1000014121 150
462 3300026142 Ga0207698_10353771 Ga0207698_103537713 150
463 3300026142 Ga0207698_10443806 Ga0207698_104438063 150
464 3300026142 Ga0207698_10599189 Ga0207698_105991892 150
465 3300026142 Ga0207698_10954742 Ga0207698_109547423 150
466 3300027907 Ga0207428_10230132 Ga0207428_102301322 150
467 3300028379 Ga0268266_10568651 Ga0268266_105686512 150
468 3300028380 Ga0268265_10058803 Ga0268265_100588031 150
469 3300028381 Ga0268264_10007612 Ga0268264_100076126 150
470 3300031911 Ga0307412_10346920 Ga0307412_103469202 150
471 3300041511 Ga0451855_0403470 Ga0451855_0403470_571_1029 150
472 3300041512 Ga0451853_2193999 Ga0451853_2193999_169_627 150
473 3300044712 Ga0453684_0044010 Ga0453684_0044010_313_771 150
474 3300046453 Ga0495627_000599 Ga0495627_000599_16005_16475 150
475 3300046471 Ga0495650_0000285 Ga0495650_0000285_85846_86316 150
476 3300046500 Ga0495596_0000621 Ga0495596_0000621_13938_14417 150
477 3300046506 Ga0495583_0364442 Ga0495583_0364442_11_481 150
478 3300046512 Ga0495610_0000020 Ga0495610_0000020_89761_90231 150
479 3300046515 Ga0495620_0011522 Ga0495620_0011522_1213_1683 150
480 3300046515 Ga0495620_0031170 Ga0495620_0031170_1790_2248 150
481 3300046519 Ga0495632_0000915 Ga0495632_0000915_12542_13012 150
482 3300046525 Ga0495663_0262707 Ga0495663_0262707_130_600 150
483 3300046660 Ga0495625_0104400 Ga0495625_0104400_90_560 150
484 3300047470 Ga0495681_0000052 Ga0495681_0000052_31631_32101 150
485 3300048090 Ga0495615_0000078 Ga0495615_0000078_22859_23329 150
486 3300048091 Ga0495626_0000450 Ga0495626_0000450_35796_36275 150
487 3300048904 Ga0496101_0543437 Ga0496101_0543437_253_708 150
488 3300048905 Ga0496102_0014312 Ga0496102_0014312_6361_6816 150
489 3300048905 Ga0496102_0169891 Ga0496102_0169891_1207_1662 150
490 3300048906 Ga0496103_0171822 Ga0496103_0171822_769_1224 150
491 3300048907 Ga0496104_0037015 Ga0496104_0037015_821_1285 150
492 3300048907 Ga0496104_0092450 Ga0496104_0092450_2344_2799 150
493 3300048908 Ga0496105_0000751 Ga0496105_0000751_13232_13696 150
494 3300048908 Ga0496105_0194993 Ga0496105_0194993_532_987 150
495 3300048909 Ga0496106_0000950 Ga0496106_0000950_476_931 150
496 3300048910 Ga0496107_0025721 Ga0496107_0025721_2485_2940 150
497 3300048911 Ga0496108_0505003 Ga0496108_0505003_43_498 150
498 3300048913 Ga0496110_0027951 Ga0496110_0027951_948_1403 150
499 3300048913 Ga0496110_0250907 Ga0496110_0250907_813_1268 150
500 3300048915 Ga0496112_0525723 Ga0496112_0525723_474_929 150
501 3300048915 Ga0496112_1131798 Ga0496112_1131798_70_525 150
502 3300048916 Ga0496113_0000260 Ga0496113_0000260_21783_22238 150
503 3300048917 Ga0496114_0542025 Ga0496114_0542025_218_673 150
504 3300048919 Ga0496116_0000035 Ga0496116_0000035_31464_31952 150
505 3300048920 Ga0496117_0070598 Ga0496117_0070598_225_713 150
506 3300048922 Ga0496119_0097295 Ga0496119_0097295_589_1053 150
507 3300048924 Ga0496121_0000312 Ga0496121_0000312_64201_64668 150
508 3300048924 Ga0496121_0002209 Ga0496121_0002209_13354_13824 150
509 3300048924 Ga0496121_0452629 Ga0496121_0452629_250_705 150
510 3300048925 Ga0496122_0001902 Ga0496122_0001902_17112_17600 150
511 3300048925 Ga0496122_0003824 Ga0496122_0003824_6262_6732 150
512 3300048926 Ga0496123_0002409 Ga0496123_0002409_6960_7430 150
513 3300048926 Ga0496123_0005132 Ga0496123_0005132_5970_6458 150
514 3300048927 Ga0496124_0012893 Ga0496124_0012893_3945_4415 150
515 3300048927 Ga0496124_0031206 Ga0496124_0031206_1555_2025 150
516 3300048927 Ga0496124_0033968 Ga0496124_0033968_3837_4325 150
517 3300048927 Ga0496124_0542826 Ga0496124_0542826_294_749 150
518 3300048927 Ga0496124_0545673 Ga0496124_0545673_121_609 150
519 3300048928 Ga0496125_0032050 Ga0496125_0032050_4011_4499 150
520 3300048928 Ga0496125_0092459 Ga0496125_0092459_218_673 150
521 3300048929 Ga0496126_0000084 Ga0496126_0000084_202052_202540 150
522 3300048929 Ga0496126_0008503 Ga0496126_0008503_9594_10049 150
523 3300048929 Ga0496126_0597431 Ga0496126_0597431_163_633 150
524 3300050489 nmdc:mga03683_30_c1 nmdc:mga03683_30_c1_61240_61713 150
525 3300050490 nmdc:mga03n38_781_c1 nmdc:mga03n38_781_c1_5403_5876 150
526 3300050491 nmdc:mga00v17_216408_c1 nmdc:mga00v17_216408_c1_740_1213 150
527 3300050491 nmdc:mga00v17_594811_c1 nmdc:mga00v17_594811_c1_191_658 150
528 3300050516 nmdc:mga0sz30_4905_c1 nmdc:mga0sz30_4905_c1_3169_3642 150
529 3300053111 Ga0500572_213960 Ga0500572_213960_11_481 150
530 3300053122 Ga0500608_272295 Ga0500608_272295_97_555 150
531 3300053148 Ga0500590_021528 Ga0500590_021528_2401_2859 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

17

144

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8808 36 125
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8257 47 124
1z9f-assembly1.cif.gz_A crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution 0.806 54 125
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.7918 36 125
8c5y-assembly1.cif.gz_B rpa tetrameric supercomplex from pyrococcus abyssi 0.7885 54 125
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8808 36 125 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8257 47 124 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8224 54 122 2.40.50.140
1z9fA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.806 54 125 2.40.50.140
af_I1KPU2_29_132_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7941 51 124 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5W4VQ91-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9252 32 123 GO:0005886
GO:0017004
GO:0020037
AF-A0A2E9XLC0-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9188 3 134 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A3A4TUR0-F1-model_v4 Cytochrome c maturation protein CcmE 0.9126 4 129 GO:0005886
GO:0017004
GO:0020037
AF-A0A0F8Z3P8-F1-model_v4 Cytochrome c-type biogenesis protein CcmE 0.9112 34 122 GO:0005886
GO:0017004
GO:0020037
AF-A0A2E1TKX0-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9023 3 133 GO:0005886
GO:0017004
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.92 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map