F460176

General Info

Members Datasets Scaffolds Average Seq Length
531 299 1062 123

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0276740|Ga0495667_0276740_198_692
Length 150
Sequence MGRGCHARPSRRTTGVDANQRGGLRADRYAVEDFPYHFDARGRTAEVDYDGHIRDLIEQVLFTSPGERVNRPDFGSGLLRLVFAPNSSELAATTQYLVQGSLQQYLGDLIQVDAVDVTSEDSTLRVSVRYLVRQTQTLQTAEFTKGVPTA

Samples

Sample ID Description Type Environment
1 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
198 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
261 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
262 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
263 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
264 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
265 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
266 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
267 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
268 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
269 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
270 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
271 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
272 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
273 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
277 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
295 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
296 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
297 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
298 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0
Rhizoplane 5.46
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 22.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495667_0276740 3300046559 Unclassified 1066
2 JGI24034J14986_100666 3300001432 Bacteria 2020
3 JGI24746J21847_1034850 3300001977 Unclassified 695
4 JGI24748J21848_1000002 3300002074 Bacteria 426946
5 JGI24034J26672_10000004 3300002239 Bacteria 426946
6 JGI25406J46586_10037876 3300003203 Bacteria 1734
7 rootH2_10256832 3300003320 Unclassified 1932
8 rootL2_10257985 3300003322 Unclassified 2208
9 Ga0065712_10003716 3300005290 Bacteria 4962
10 Ga0065715_10013740 3300005293 Unclassified 3339
11 Ga0065715_11125805 3300005293 Bacteria 514
12 Ga0070676_10001365 3300005328 Bacteria 12295
13 Ga0070676_11037161 3300005328 Bacteria 617
14 Ga0070683_100316280 3300005329 Bacteria 1485
15 Ga0070690_100001967 3300005330 Bacteria 10937
16 Ga0070690_100823741 3300005330 Bacteria 721
17 Ga0070670_100006479 3300005331 Bacteria 9906
18 Ga0070670_100316144 3300005331 Bacteria 1367
19 Ga0070677_10007163 3300005333 Bacteria 3719
20 Ga0068869_100279860 3300005334 Bacteria 1341
21 Ga0070680_100033253 3300005336 Bacteria 4155
22 Ga0068868_100183959 3300005338 Bacteria 1735
23 Ga0068868_100992340 3300005338 Unclassified 768
24 Ga0068868_101530638 3300005338 Bacteria 625
25 Ga0068868_102260975 3300005338 Unclassified 518
26 Ga0070660_100124956 3300005339 Bacteria 2055
27 Ga0070689_100016478 3300005340 Bacteria 5408
28 Ga0070689_100852580 3300005340 Unclassified 804
29 Ga0070689_101922173 3300005340 Bacteria 540
30 Ga0070689_102200758 3300005340 Unclassified 505
31 Ga0070691_10030696 3300005341 Bacteria 2518
32 Ga0070687_100001554 3300005343 Bacteria 8146
33 Ga0070687_100128892 3300005343 Bacteria 1458
34 Ga0070687_100251155 3300005343 Bacteria 1099
35 Ga0070687_100567447 3300005343 Bacteria 775
36 Ga0070692_10127752 3300005345 Bacteria 1425
37 Ga0070668_100085699 3300005347 Unclassified 2476
38 Ga0070669_100013242 3300005353 Bacteria 5862
39 Ga0070669_100020637 3300005353 Bacteria 4705
40 Ga0070669_100035699 3300005353 Bacteria 3602
41 Ga0070669_100114782 3300005353 Unclassified 2048
42 Ga0070675_100001838 3300005354 Bacteria 15687
43 Ga0070675_100004173 3300005354 Bacteria 10972
44 Ga0070675_100026234 3300005354 Bacteria 4675
45 Ga0070675_100100022 3300005354 Bacteria 2442
46 Ga0070671_100015497 3300005355 Bacteria 6159
47 Ga0070671_100082296 3300005355 Bacteria 2691
48 Ga0070674_100020446 3300005356 Bacteria 4230
49 Ga0070674_100214152 3300005356 Bacteria 1495
50 Ga0070673_100073674 3300005364 Bacteria 2749
51 Ga0070673_100677866 3300005364 Unclassified 945
52 Ga0070673_101002897 3300005364 Bacteria 777
53 Ga0070688_100008040 3300005365 Bacteria 5709
54 Ga0070688_100086866 3300005365 Bacteria 2036
55 Ga0070688_100179262 3300005365 Bacteria 1468
56 Ga0070659_100063339 3300005366 Bacteria 2925
57 Ga0070667_100011622 3300005367 Bacteria 7279
58 Ga0070667_100017551 3300005367 Bacteria 5932
59 Ga0070667_100117872 3300005367 Bacteria 2307
60 Ga0070703_10000028 3300005406 Bacteria 70844
61 Ga0070703_10142371 3300005406 Unclassified 892
62 Ga0070714_100034209 3300005435 Unclassified 4254
63 Ga0070713_100009503 3300005436 Bacteria 6966
64 Ga0070713_100016390 3300005436 Bacteria 5571
65 Ga0070710_10028354 3300005437 Bacteria 2994
66 Ga0070701_10575934 3300005438 Bacteria 742
67 Ga0070711_100059933 3300005439 Unclassified 2644
68 Ga0070711_100805808 3300005439 Bacteria 797
69 Ga0070705_100767600 3300005440 Unclassified 764
70 Ga0070700_100006039 3300005441 Bacteria 6448
71 Ga0070700_100150489 3300005441 Bacteria 1591
72 Ga0070694_100073264 3300005444 Bacteria 2365
73 Ga0070694_100101608 3300005444 Bacteria 2035
74 Ga0070694_100623497 3300005444 Bacteria 870
75 Ga0070708_100084280 3300005445 Bacteria 2883
76 Ga0070663_100059127 3300005455 Bacteria 2755
77 Ga0070663_100487212 3300005455 Bacteria 1022
78 Ga0070678_100195213 3300005456 Bacteria 1667
79 Ga0070678_100256899 3300005456 Bacteria 1467
80 Ga0070662_100395686 3300005457 Bacteria 1139
81 Ga0070681_10021075 3300005458 Bacteria 6530
82 Ga0070681_10325744 3300005458 Bacteria 1446
83 Ga0070685_10020774 3300005466 Bacteria 3558
84 Ga0070706_100010342 3300005467 Bacteria 8668
85 Ga0070706_100386337 3300005467 Bacteria 1303
86 Ga0070706_100527300 3300005467 Bacteria 1099
87 Ga0070706_100707609 3300005467 Unclassified 934
88 Ga0070707_100000677 3300005468 Bacteria 33786
89 Ga0070698_100247589 3300005471 Bacteria 1715
90 Ga0070698_100252628 3300005471 Unclassified 1695
91 Ga0070698_101344631 3300005471 Bacteria 665
92 Ga0070699_100005249 3300005518 Bacteria 11376
93 Ga0070699_100084071 3300005518 Viruses 2777
94 Ga0070699_100096482 3300005518 Viruses 2589
95 Ga0070699_100901264 3300005518 Bacteria 810
96 Ga0070679_100034533 3300005530 Bacteria 5013
97 Ga0070679_100517025 3300005530 Bacteria 1138
98 Ga0070684_100320759 3300005535 Bacteria 1423
99 Ga0070697_100000542 3300005536 Bacteria 28399
100 Ga0070697_100209542 3300005536 Bacteria 1659
101 Ga0068853_100778756 3300005539 Bacteria 915
102 Ga0070672_100041276 3300005543 Bacteria 3546
103 Ga0070672_100070292 3300005543 Bacteria 2781
104 Ga0070686_100103885 3300005544 Bacteria 1924
105 Ga0070695_100036695 3300005545 Bacteria 3085
106 Ga0070695_100128826 3300005545 Bacteria 1742
107 Ga0070695_100335822 3300005545 Unclassified 1128
108 Ga0070695_100494532 3300005545 Unclassified 945
109 Ga0070695_101509184 3300005545 Unclassified 559
110 Ga0070696_100038160 3300005546 Bacteria 3314
111 Ga0070696_100713004 3300005546 Viruses 819
112 Ga0070696_101046366 3300005546 Bacteria 684
113 Ga0070696_101099534 3300005546 Unclassified 668
114 Ga0070693_100012949 3300005547 Bacteria 4236
115 Ga0070693_101072797 3300005547 Unclassified 613
116 Ga0070665_100276841 3300005548 Unclassified 1680
117 Ga0070704_100194128 3300005549 Bacteria 1634
118 Ga0070704_100243365 3300005549 Unclassified 1473
119 Ga0070704_100434567 3300005549 Bacteria 1127
120 Ga0068855_100096198 3300005563 Bacteria 3412
121 Ga0068855_100585072 3300005563 Bacteria 1205
122 Ga0070664_100013944 3300005564 Bacteria 6553
123 Ga0070664_100021201 3300005564 Bacteria 5353
124 Ga0070664_100034015 3300005564 Bacteria 4274
125 Ga0068857_100057187 3300005577 Bacteria 3462
126 Ga0068854_100010313 3300005578 Bacteria 6056
127 Ga0068854_100124664 3300005578 Bacteria 1960
128 Ga0068854_100654585 3300005578 Unclassified 902
129 Ga0068856_100078468 3300005614 Bacteria 3274
130 Ga0070702_100413557 3300005615 Unclassified 968
131 Ga0068859_100003211 3300005617 Bacteria 16645
132 Ga0068859_100013203 3300005617 Bacteria 8291
133 Ga0068859_100040385 3300005617 Bacteria 4683
134 Ga0068859_100391782 3300005617 Bacteria 1485
135 Ga0068859_100701645 3300005617 Bacteria 1103
136 Ga0068866_10056606 3300005718 Bacteria 2017
137 Ga0068861_101487504 3300005719 Bacteria 664
138 Ga0068863_100065955 3300005841 Bacteria 3425
139 Ga0068863_100408514 3300005841 Bacteria 1329
140 Ga0068863_101029225 3300005841 Bacteria 827
141 Ga0068858_101162995 3300005842 Bacteria 758
142 Ga0068860_100065339 3300005843 Bacteria 3455
143 Ga0068860_100613528 3300005843 Bacteria 1094
144 Ga0068860_101897346 3300005843 Bacteria 617
145 Ga0068862_100008674 3300005844 Bacteria 8408
146 Ga0068862_100220408 3300005844 Bacteria 1717
147 Ga0081455_10000418 3300005937 Bacteria 55929
148 Ga0081455_10331710 3300005937 Bacteria 1080
149 Ga0081539_10000346 3300005985 Bacteria 101962
150 Ga0081539_10003337 3300005985 Bacteria 19955
151 Ga0070717_10011421 3300006028 Bacteria 6744
152 Ga0070717_10192232 3300006028 Bacteria 1783
153 Ga0070716_100018531 3300006173 Bacteria 3629
154 Ga0070716_100235579 3300006173 Unclassified 1238
155 Ga0070716_101463951 3300006173 Unclassified 557
156 Ga0070712_100006993 3300006175 Bacteria 7033
157 Ga0070712_100083329 3300006175 Bacteria 2322
158 Ga0070712_100085384 3300006175 Bacteria 2298
159 Ga0075370_10004194 3300006353 Bacteria 6958
160 Ga0068871_100884720 3300006358 Bacteria 827
161 Ga0075430_100025943 3300006846 Viruses 4987
162 Ga0075431_100004811 3300006847 Bacteria 13295
163 Ga0075431_100105862 3300006847 Unclassified 2902
164 Ga0075434_100022420 3300006871 Bacteria 6151
165 Ga0075434_100259198 3300006871 Unclassified 1758
166 Ga0075429_101103038 3300006880 Bacteria 693
167 Ga0068865_100284671 3300006881 Bacteria 1317
168 Ga0068865_100455234 3300006881 Bacteria 1059
169 Ga0075436_100034783 3300006914 Bacteria 3475
170 Ga0075436_100377736 3300006914 Unclassified 1024
171 Ga0075436_101107564 3300006914 Bacteria 596
172 Ga0097620_100003211 3300006931 Bacteria 16645
173 Ga0097620_100013203 3300006931 Bacteria 8291
174 Ga0097620_100040388 3300006931 Bacteria 4683
175 Ga0097620_100391765 3300006931 Bacteria 1485
176 Ga0097620_100701673 3300006931 Bacteria 1103
177 Ga0075435_100043004 3300007076 Bacteria 3616
178 Ga0075435_100310939 3300007076 Unclassified 1348
179 Ga0075435_100318447 3300007076 Bacteria 1331
180 Ga0075435_100394520 3300007076 Bacteria 1190
181 Ga0105240_10163923 3300009093 Bacteria 2638
182 Ga0111539_10060572 3300009094 Bacteria 4485
183 Ga0105245_10502328 3300009098 Unclassified 1229
184 Ga0105245_10895590 3300009098 Unclassified 929
185 Ga0105247_10064908 3300009101 Unclassified 2270
186 Ga0105247_10435517 3300009101 Bacteria 942
187 Ga0114129_10000925 3300009147 Bacteria 38300
188 Ga0114129_10560851 3300009147 Bacteria 1484
189 Ga0114129_10828683 3300009147 Unclassified 1178
190 Ga0114129_10837032 3300009147 Bacteria 1171
191 Ga0114129_11471129 3300009147 Bacteria 838
192 Ga0114129_13302790 3300009147 Unclassified 522
193 Ga0105243_10000996 3300009148 Bacteria 26244
194 Ga0105243_10047982 3300009148 Bacteria 3365
195 Ga0105241_10141772 3300009174 Bacteria 1958
196 Ga0105242_10322426 3300009176 Bacteria 1417
197 Ga0105242_10435053 3300009176 Unclassified 1233
198 Ga0105242_10766905 3300009176 Bacteria 951
199 Ga0105242_11449483 3300009176 Unclassified 716
200 Ga0105248_10003342 3300009177 Bacteria 17833
201 Ga0105248_11121967 3300009177 Unclassified 889
202 Ga0105238_10000453 3300009551 Bacteria 43016
203 Ga0105238_10015271 3300009551 Bacteria 7777
204 Ga0105238_10883052 3300009551 Bacteria 912
205 Ga0105249_10100889 3300009553 Bacteria 2714
206 Ga0105249_10214317 3300009553 Bacteria 1892
207 Ga0105249_10257651 3300009553 Bacteria 1732
208 Ga0105239_10005799 3300010375 Bacteria 14408
209 Ga0105239_12130245 3300010375 Unclassified 652
210 Ga0105246_10020900 3300011119 Bacteria 4204
211 Ga0105246_10104300 3300011119 Unclassified 2070
212 Ga0105246_11937632 3300011119 Bacteria 567
213 Ga0157371_10095319 3300013102 Bacteria 2109
214 Ga0157369_10914132 3300013105 Unclassified 900
215 Ga0157374_10015332 3300013296 Bacteria 6722
216 Ga0157374_10809308 3300013296 Unclassified 953
217 Ga0157378_10000015 3300013297 Bacteria 143601
218 Ga0157378_10066555 3300013297 Unclassified 3227
219 Ga0157378_10192643 3300013297 Unclassified 1924
220 Ga0157378_11283965 3300013297 Bacteria 773
221 Ga0157378_11303248 3300013297 Bacteria 767
222 Ga0157378_11757263 3300013297 Unclassified 668
223 Ga0157378_12375159 3300013297 Unclassified 582
224 Ga0163162_10050774 3300013306 Bacteria 4159
225 Ga0163162_11953080 3300013306 Unclassified 672
226 Ga0157372_10032933 3300013307 Bacteria 5688
227 Ga0157372_10053296 3300013307 Bacteria 4508
228 Ga0157372_11858954 3300013307 Bacteria 692
229 Ga0157375_10191789 3300013308 Bacteria 2198
230 Ga0157375_10377520 3300013308 Bacteria 1584
231 Ga0157375_11014638 3300013308 Bacteria 969
232 Ga0157375_12487289 3300013308 Bacteria 618
233 Ga0157375_12580182 3300013308 Unclassified 607
234 Ga0163163_10096287 3300014325 Unclassified 2980
235 Ga0163163_10115414 3300014325 Bacteria 2717
236 Ga0163163_10331350 3300014325 Bacteria 1577
237 Ga0163163_11423705 3300014325 Bacteria 755
238 Ga0163163_12610992 3300014325 Bacteria 563
239 Ga0163163_13070614 3300014325 Bacteria 521
240 Ga0157380_11754419 3300014326 Bacteria 679
241 Ga0182008_10118981 3300014497 Bacteria 1312
242 Ga0157377_10116578 3300014745 Bacteria 1613
243 Ga0157377_10629509 3300014745 Bacteria 769
244 Ga0157377_10928767 3300014745 Bacteria 653
245 Ga0157376_10008932 3300014969 Bacteria 7256
246 Ga0157376_10116132 3300014969 Bacteria 2364
247 Ga0157376_11229459 3300014969 Unclassified 778
248 Ga0207666_1030537 3300025271 Unclassified 824
249 Ga0207697_10001859 3300025315 Bacteria 11285
250 Ga0207697_10001865 3300025315 Bacteria 11253
251 Ga0207653_10000047 3300025885 Bacteria 91340
252 Ga0207682_10056831 3300025893 Bacteria 1630
253 Ga0207692_10075734 3300025898 Unclassified 1786
254 Ga0207692_10633053 3300025898 Bacteria 690
255 Ga0207642_10045965 3300025899 Bacteria 1942
256 Ga0207710_10000004 3300025900 Bacteria 846540
257 Ga0207710_10127913 3300025900 Unclassified 1218
258 Ga0207688_10034491 3300025901 Bacteria 2803
259 Ga0207688_10569816 3300025901 Unclassified 712
260 Ga0207680_10167098 3300025903 Bacteria 1479
261 Ga0207645_10003342 3300025907 Bacteria 12230
262 Ga0207645_10004181 3300025907 Bacteria 10718
263 Ga0207645_10061525 3300025907 Bacteria 2398
264 Ga0207643_10001177 3300025908 Bacteria 15527
265 Ga0207684_10011572 3300025910 Bacteria 7711
266 Ga0207684_10329809 3300025910 Bacteria 1315
267 Ga0207684_10555190 3300025910 Bacteria 982
268 Ga0207684_10774054 3300025910 Bacteria 812
269 Ga0207684_11411507 3300025910 Unclassified 570
270 Ga0207707_10555850 3300025912 Unclassified 975
271 Ga0207707_10863292 3300025912 Bacteria 750
272 Ga0207695_10401455 3300025913 Unclassified 1255
273 Ga0207695_10413148 3300025913 Unclassified 1234
274 Ga0207693_10010700 3300025915 Bacteria 7447
275 Ga0207693_10222704 3300025915 Bacteria 1482
276 Ga0207663_10041856 3300025916 Unclassified 2795
277 Ga0207663_10436040 3300025916 Bacteria 1008
278 Ga0207662_10019692 3300025918 Unclassified 3844
279 Ga0207662_10048376 3300025918 Bacteria 2519
280 Ga0207662_10817734 3300025918 Unclassified 657
281 Ga0207657_10006391 3300025919 Bacteria 12237
282 Ga0207649_10086454 3300025920 Bacteria 2043
283 Ga0207652_10284592 3300025921 Bacteria 1491
284 Ga0207646_10000550 3300025922 Bacteria 49383
285 Ga0207681_10025343 3300025923 Unclassified 3814
286 Ga0207681_10030921 3300025923 Bacteria 3494
287 Ga0207681_10076001 3300025923 Bacteria 2357
288 Ga0207681_10211174 3300025923 Bacteria 1496
289 Ga0207694_10003055 3300025924 Bacteria 13419
290 Ga0207694_10170679 3300025924 Bacteria 1761
291 Ga0207650_10038064 3300025925 Bacteria 3509
292 Ga0207650_10237763 3300025925 Unclassified 1471
293 Ga0207659_10059210 3300025926 Unclassified 2752
294 Ga0207659_10092391 3300025926 Bacteria 2262
295 Ga0207659_10283266 3300025926 Bacteria 1356
296 Ga0207659_10518755 3300025926 Unclassified 1010
297 Ga0207687_10176672 3300025927 Bacteria 1651
298 Ga0207664_10197518 3300025929 Unclassified 1735
299 Ga0207644_10002425 3300025931 Bacteria 12009
300 Ga0207644_10148250 3300025931 Bacteria 1813
301 Ga0207644_10473992 3300025931 Bacteria 1030
302 Ga0207690_10201492 3300025932 Unclassified 1512
303 Ga0207706_10000999 3300025933 Bacteria 28802
304 Ga0207706_10028863 3300025933 Bacteria 4952
305 Ga0207706_10068096 3300025933 Bacteria 3133
306 Ga0207706_10501378 3300025933 Bacteria 1048
307 Ga0207686_10279619 3300025934 Unclassified 1231
308 Ga0207686_10630113 3300025934 Unclassified 847
309 Ga0207709_10001187 3300025935 Bacteria 18824
310 Ga0207709_10596040 3300025935 Bacteria 874
311 Ga0207669_10299931 3300025937 Bacteria 1221
312 Ga0207704_10624163 3300025938 Bacteria 885
313 Ga0207665_10002211 3300025939 Bacteria 13127
314 Ga0207691_10008673 3300025940 Bacteria 9755
315 Ga0207691_10026915 3300025940 Bacteria 5395
316 Ga0207711_10006529 3300025941 Bacteria 9818
317 Ga0207711_10467061 3300025941 Bacteria 1175
318 Ga0207689_10001417 3300025942 Bacteria 22904
319 Ga0207679_10024837 3300025945 Bacteria 4113
320 Ga0207679_10787887 3300025945 Unclassified 866
321 Ga0207667_10502672 3300025949 Bacteria 1229
322 Ga0207712_10195838 3300025961 Bacteria 1598
323 Ga0207668_10014858 3300025972 Bacteria 4826
324 Ga0207658_10047257 3300025986 Unclassified 3149
325 Ga0207658_10290299 3300025986 Bacteria 1405
326 Ga0207658_10347951 3300025986 Bacteria 1290
327 Ga0207658_10436553 3300025986 Bacteria 1157
328 Ga0207677_10250654 3300026023 Bacteria 1438
329 Ga0207677_10465063 3300026023 Unclassified 1087
330 Ga0207703_10165442 3300026035 Bacteria 1940
331 Ga0207639_10674148 3300026041 Bacteria 958
332 Ga0207678_10093271 3300026067 Bacteria 2573
333 Ga0207708_10025555 3300026075 Bacteria 4469
334 Ga0207708_10064775 3300026075 Bacteria 2793
335 Ga0207708_10216782 3300026075 Bacteria 1532
336 Ga0207641_10329707 3300026088 Bacteria 1449
337 Ga0207641_10503382 3300026088 Bacteria 1177
338 Ga0207648_10393763 3300026089 Bacteria 1254
339 Ga0207674_10044024 3300026116 Bacteria 4600
340 Ga0207675_100014281 3300026118 Bacteria 7402
341 Ga0207683_10001033 3300026121 Bacteria 25396
342 Ga0207683_10300578 3300026121 Bacteria 1468
343 Ga0207698_10527881 3300026142 Bacteria 1153
344 Ga0268266_10359571 3300028379 Unclassified 1370
345 Ga0268265_10060463 3300028380 Bacteria 2903
346 Ga0268265_10284054 3300028380 Unclassified 1482
347 Ga0268264_11047838 3300028381 Bacteria 823
348 Ga0268264_11163453 3300028381 Bacteria 780
349 Ga0307515_10000008 3300028794 Bacteria 663660
350 Ga0265338_10525447 3300028800 Unclassified 831
351 Ga0265765_1013133 3300030879 Unclassified 945
352 Ga0307513_10200799 3300031456 Bacteria 1835
353 Ga0307408_100924697 3300031548 Unclassified 800
354 Ga0316579_10318330 3300031691 Unclassified 752
355 Ga0307405_10023447 3300031731 Bacteria 3507
356 Ga0307405_10311624 3300031731 Bacteria 1198
357 Ga0307410_10009883 3300031852 Bacteria 5377
358 Ga0307410_10811011 3300031852 Unclassified 797
359 Ga0307410_11763947 3300031852 Bacteria 549
360 Ga0307406_10022338 3300031901 Bacteria 3752
361 Ga0307412_10058787 3300031911 Bacteria 2573
362 Ga0307416_100016556 3300032002 Bacteria 5129
363 Ga0307414_10006929 3300032004 Bacteria 6349
364 Ga0307414_10690872 3300032004 Unclassified 923
365 Ga0307411_10359936 3300032005 Bacteria 1189
366 Ga0307411_10601877 3300032005 Unclassified 945
367 Ga0307411_12358362 3300032005 Unclassified 500
368 Ga0307415_100005575 3300032126 Bacteria 6699
369 Ga0373945_0304019 3300035116 Bacteria 684
370 Ga0373953_0053370 3300035117 Bacteria 1638
371 Ga0373954_0137601 3300035118 Bacteria 1191
372 Ga0373956_0430237 3300035119 Unclassified 630
373 Ga0373943_0072420 3300035170 Bacteria 1748
374 Ga0373924_0009892 3300035410 Bacteria 3507
375 Ga0373935_0522089 3300035692 Bacteria 864
376 Ga0373933_0011694 3300035724 Bacteria 4843
377 Ga0373947_0252479 3300035725 Bacteria 1167
378 Ga0373937_0002398 3300036401 Bacteria 15589
379 Ga0373937_0222746 3300036401 Bacteria 1776
380 Ga0373937_1018668 3300036401 Unclassified 777
381 Ga0400490_38445 3300038726 Bacteria 13294
382 Ga0400491_27425 3300038727 Bacteria 1319
383 Ga0436360_0507637 3300039438 Bacteria 689
384 Ga0436360_1307698 3300039438 Bacteria 767
385 Ga0436362_1097775 3300039453 Bacteria 972
386 Ga0451853_1505179 3300041512 Bacteria 531
387 Ga0439458_0188334 3300042157 Unclassified 562
388 Ga0439458_0206638 3300042157 Unclassified 538
389 Ga0439435_0054705 3300042436 Bacteria 1150
390 Ga0439459_0160735 3300042438 Bacteria 593
391 Ga0451576_0751411 3300045051 Unclassified 1024
392 Ga0495592_0137169 3300046454 Unclassified 1705
393 Ga0495629_0280222 3300046459 Bacteria 1144
394 Ga0495638_0638222 3300046460 Bacteria 519
395 Ga0495653_0689580 3300046463 Bacteria 621
396 Ga0495580_0147639 3300046472 Bacteria 1629
397 Ga0495664_0226376 3300046477 Unclassified 1132
398 Ga0495608_0279860 3300046511 Unclassified 1036
399 Ga0495608_0395505 3300046511 Bacteria 846
400 Ga0495628_0009589 3300046516 Bacteria 8265
401 Ga0495630_0342556 3300046517 Bacteria 1144
402 Ga0495630_0859365 3300046517 Bacteria 692
403 Ga0495630_1128335 3300046517 Viruses 594
404 Ga0495632_0147356 3300046519 Bacteria 1089
405 Ga0495637_0009569 3300046520 Bacteria 4724
406 Ga0495663_0051848 3300046525 Bacteria 1272
407 Ga0495663_0150724 3300046525 Bacteria 793
408 Ga0495652_0140516 3300046529 Bacteria 1899
409 Ga0495652_0198552 3300046529 Bacteria 1524
410 Ga0495587_0004194 3300046536 Bacteria 9544
411 Ga0495587_0223241 3300046536 Unclassified 1062
412 Ga0495645_0000820 3300046543 Bacteria 21250
413 Ga0495645_0002759 3300046543 Bacteria 11939
414 Ga0495667_0002410 3300046559 Bacteria 12483
415 Ga0495625_0076225 3300046660 Bacteria 2345
416 Ga0495635_0945050 3300046663 Unclassified 550
417 Ga0495657_0108884 3300046675 Bacteria 1758
418 Ga0495599_0012245 3300046678 Bacteria 5282
419 Ga0495599_0021219 3300046678 Bacteria 4051
420 Ga0495623_0001030 3300046679 Bacteria 18825
421 Ga0495623_0113428 3300046679 Bacteria 1640
422 Ga0495646_0601879 3300046680 Viruses 558
423 Ga0495669_0049698 3300046684 Bacteria 1879
424 Ga0495669_0307797 3300046684 Bacteria 764
425 Ga0495600_0145983 3300046809 Unclassified 1533
426 Ga0495604_0375459 3300047317 Unclassified 940
427 Ga0495636_0152378 3300047318 Bacteria 1038
428 Ga0495674_0162166 3300047319 Bacteria 1870
429 Ga0495680_0108504 3300047322 Unclassified 2060
430 Ga0495675_0001362 3300047444 Bacteria 14798
431 Ga0495675_0033676 3300047444 Bacteria 3270
432 Ga0495677_0036485 3300047445 Bacteria 1796
433 Ga0495673_0291426 3300047469 Bacteria 587
434 Ga0495684_0011322 3300047471 Bacteria 6887
435 Ga0495684_0776527 3300047471 Unclassified 628
436 Ga0495602_0066884 3300048088 Bacteria 3094
437 Ga0495602_0961981 3300048088 Viruses 565
438 Ga0495615_0073356 3300048090 Bacteria 926
439 Ga0495626_0011025 3300048091 Bacteria 4795
440 Ga0496100_0476942 3300048903 Bacteria 959
441 Ga0496100_0652442 3300048903 Unclassified 819
442 Ga0496101_0070442 3300048904 Unclassified 2561
443 Ga0496101_0476625 3300048904 Unclassified 985
444 Ga0496102_0027171 3300048905 Bacteria 5111
445 Ga0496102_0030887 3300048905 Bacteria 4799
446 Ga0496102_0747299 3300048905 Unclassified 901
447 Ga0496103_0074171 3300048906 Bacteria 2132
448 Ga0496103_0112306 3300048906 Bacteria 1732
449 Ga0496105_0336006 3300048908 Bacteria 1209
450 Ga0496105_0515090 3300048908 Bacteria 937
451 Ga0496106_0124012 3300048909 Bacteria 2021
452 Ga0496106_0391023 3300048909 Bacteria 1117
453 Ga0496107_0207714 3300048910 Bacteria 1456
454 Ga0496109_0006588 3300048912 Bacteria 9779
455 Ga0496109_0433862 3300048912 Bacteria 1241
456 Ga0496110_0011619 3300048913 Bacteria 7219
457 Ga0496110_0827444 3300048913 Bacteria 831
458 Ga0496111_0076220 3300048914 Unclassified 2444
459 Ga0496112_0128667 3300048915 Unclassified 2503
460 Ga0496112_0329301 3300048915 Unclassified 1471
461 Ga0496112_0488824 3300048915 Unclassified 1167
462 Ga0496113_0105891 3300048916 Bacteria 2184
463 Ga0496113_0111964 3300048916 Bacteria 2126
464 Ga0496114_0461409 3300048917 Bacteria 1124
465 Ga0496114_0579917 3300048917 Bacteria 990
466 Ga0496114_1060480 3300048917 Unclassified 695
467 Ga0496114_1536164 3300048917 Bacteria 554
468 Ga0496115_0012130 3300048918 Bacteria 6481
469 Ga0496119_0069680 3300048922 Bacteria 2066
470 Ga0496121_0016937 3300048924 Bacteria 7487
471 Ga0496121_0096602 3300048924 Bacteria 2292
472 Ga0496125_0024057 3300048928 Bacteria 5610
473 Ga0496126_0065674 3300048929 Bacteria 3246
474 Ga0496126_0977527 3300048929 Bacteria 637
475 Ga0501292_136908 3300049515 Unclassified 510
476 Ga0501076_0734613 3300049592 Bacteria 815
477 Ga0501201_016083 3300049651 Bacteria 764
478 Ga0501202_000507 3300049652 Bacteria 5592
479 Ga0501216_013641 3300049660 Bacteria 1350
480 Ga0501217_002038 3300049661 Bacteria 3908
481 Ga0501223_014092 3300049663 Bacteria 1587
482 Ga0501230_011931 3300049667 Bacteria 1383
483 Ga0501233_005464 3300049668 Bacteria 2359
484 Ga0501239_052103 3300049672 Bacteria 595
485 Ga0501246_026658 3300049676 Bacteria 629
486 Ga0501259_123981 3300049688 Bacteria 617
487 Ga0501221_077878 3300049704 Bacteria 793
488 Ga0501225_0004615 3300049705 Bacteria 4098
489 Ga0501229_008713 3300049706 Bacteria 1270
490 Ga0501245_069052 3300049708 Bacteria 662
491 Ga0501079_0588647 3300049741 Bacteria 875
492 Ga0501080_1796014 3300049742 Bacteria 515
493 Ga0501273_005459 3300049770 Bacteria 1436
494 Ga0501280_082445 3300049776 Bacteria 593
495 Ga0501045_0595925 3300049824 Bacteria 818
496 Ga0501204_011255 3300049850 Bacteria 1060
497 nmdc:mga07m45_5826_c1 3300050496 Bacteria 1663
498 nmdc:mga05p37_1194447_c1 3300050507 Bacteria 786
499 nmdc:mga05p37_1360481_c1 3300050507 Unclassified 718
500 nmdc:mga05p37_1651984_c1 3300050507 Bacteria 628
501 nmdc:mga05p37_2141600_c1 3300050507 Unclassified 522
502 nmdc:mga05p37_63_c1 3300050507 Bacteria 93704
503 nmdc:mga05p37_983004_c1 3300050507 Bacteria 899
504 nmdc:mga0qj67_112305_c1 3300050509 Unclassified 2200
505 nmdc:mga06r32_62953_c1 3300050510 Bacteria 3574
506 nmdc:mga06r32_687853_c1 3300050510 Unclassified 989
507 nmdc:mga08y16_308323_c1 3300050511 Bacteria 1630
508 nmdc:mga0n895_19806_c1 3300050512 Bacteria 6260
509 nmdc:mga0n895_432885_c1 3300050512 Bacteria 1329
510 nmdc:mga0n895_55054_c1 3300050512 Bacteria 3914
511 nmdc:mga0n895_90213_c1 3300050512 Bacteria 3066
512 nmdc:mga0rr50_1135260_c1 3300050513 Bacteria 664
513 nmdc:mga0rr50_265172_c1 3300050513 Unclassified 1430
514 nmdc:mga0rr50_74521_c1 3300050513 Bacteria 2598
515 nmdc:mga08x19_127090_c1 3300050514 Bacteria 1712
516 nmdc:mga08x19_669498_c1 3300050514 Bacteria 736
517 nmdc:mga0a205_1388114_c1 3300050515 Bacteria 550
518 Ga0495601_0177842 3300053077 Unclassified 1391
519 Ga0495612_0024164 3300053078 Bacteria 2440
520 Ga0495595_0231291 3300053084 Bacteria 924
521 Ga0495619_0106607 3300053085 Unclassified 1911
522 Ga0495619_0110832 3300053085 Bacteria 1875
523 Ga0495619_0748908 3300053085 Unclassified 663
524 Ga0500566_0460549 3300053094 Unclassified 555
525 Ga0500555_160123 3300053103 Bacteria 549
526 Ga0500562_003085 3300053108 Bacteria 4162
527 Ga0500655_012776 3300053133 Bacteria 1528
528 Ga0500627_0283775 3300053158 Bacteria 726
529 Ga0500634_0276622 3300053161 Bacteria 680
530 Ga0530510_0309470 3300061734 Bacteria 1183
531 Ga0530510_0309928 3300061734 Bacteria 1182
532 Ga0495667_0276740
533 JGI24034J14986_100666
534 JGI24746J21847_1034850
535 JGI24748J21848_1000002
536 JGI24034J26672_10000004
537 JGI25406J46586_10037876
538 rootH2_10256832
539 rootL2_10257985
540 Ga0065712_10003716
541 Ga0065715_10013740
542 Ga0065715_11125805
543 Ga0070676_10001365
544 Ga0070676_11037161
545 Ga0070683_100316280
546 Ga0070690_100001967
547 Ga0070690_100823741
548 Ga0070670_100006479
549 Ga0070670_100316144
550 Ga0070677_10007163
551 Ga0068869_100279860
552 Ga0070680_100033253
553 Ga0068868_100183959
554 Ga0068868_100992340
555 Ga0068868_101530638
556 Ga0068868_102260975
557 Ga0070660_100124956
558 Ga0070689_100016478
559 Ga0070689_100852580
560 Ga0070689_101922173
561 Ga0070689_102200758
562 Ga0070691_10030696
563 Ga0070687_100001554
564 Ga0070687_100128892
565 Ga0070687_100251155
566 Ga0070687_100567447
567 Ga0070692_10127752
568 Ga0070668_100085699
569 Ga0070669_100013242
570 Ga0070669_100020637
571 Ga0070669_100035699
572 Ga0070669_100114782
573 Ga0070675_100001838
574 Ga0070675_100004173
575 Ga0070675_100026234
576 Ga0070675_100100022
577 Ga0070671_100015497
578 Ga0070671_100082296
579 Ga0070674_100020446
580 Ga0070674_100214152
581 Ga0070673_100073674
582 Ga0070673_100677866
583 Ga0070673_101002897
584 Ga0070688_100008040
585 Ga0070688_100086866
586 Ga0070688_100179262
587 Ga0070659_100063339
588 Ga0070667_100011622
589 Ga0070667_100017551
590 Ga0070667_100117872
591 Ga0070703_10000028
592 Ga0070703_10142371
593 Ga0070714_100034209
594 Ga0070713_100009503
595 Ga0070713_100016390
596 Ga0070710_10028354
597 Ga0070701_10575934
598 Ga0070711_100059933
599 Ga0070711_100805808
600 Ga0070705_100767600
601 Ga0070700_100006039
602 Ga0070700_100150489
603 Ga0070694_100073264
604 Ga0070694_100101608
605 Ga0070694_100623497
606 Ga0070708_100084280
607 Ga0070663_100059127
608 Ga0070663_100487212
609 Ga0070678_100195213
610 Ga0070678_100256899
611 Ga0070662_100395686
612 Ga0070681_10021075
613 Ga0070681_10325744
614 Ga0070685_10020774
615 Ga0070706_100010342
616 Ga0070706_100386337
617 Ga0070706_100527300
618 Ga0070706_100707609
619 Ga0070707_100000677
620 Ga0070698_100247589
621 Ga0070698_100252628
622 Ga0070698_101344631
623 Ga0070699_100005249
624 Ga0070699_100084071
625 Ga0070699_100096482
626 Ga0070699_100901264
627 Ga0070679_100034533
628 Ga0070679_100517025
629 Ga0070684_100320759
630 Ga0070697_100000542
631 Ga0070697_100209542
632 Ga0068853_100778756
633 Ga0070672_100041276
634 Ga0070672_100070292
635 Ga0070686_100103885
636 Ga0070695_100036695
637 Ga0070695_100128826
638 Ga0070695_100335822
639 Ga0070695_100494532
640 Ga0070695_101509184
641 Ga0070696_100038160
642 Ga0070696_100713004
643 Ga0070696_101046366
644 Ga0070696_101099534
645 Ga0070693_100012949
646 Ga0070693_101072797
647 Ga0070665_100276841
648 Ga0070704_100194128
649 Ga0070704_100243365
650 Ga0070704_100434567
651 Ga0068855_100096198
652 Ga0068855_100585072
653 Ga0070664_100013944
654 Ga0070664_100021201
655 Ga0070664_100034015
656 Ga0068857_100057187
657 Ga0068854_100010313
658 Ga0068854_100124664
659 Ga0068854_100654585
660 Ga0068856_100078468
661 Ga0070702_100413557
662 Ga0068859_100003211
663 Ga0068859_100013203
664 Ga0068859_100040385
665 Ga0068859_100391782
666 Ga0068859_100701645
667 Ga0068866_10056606
668 Ga0068861_101487504
669 Ga0068863_100065955
670 Ga0068863_100408514
671 Ga0068863_101029225
672 Ga0068858_101162995
673 Ga0068860_100065339
674 Ga0068860_100613528
675 Ga0068860_101897346
676 Ga0068862_100008674
677 Ga0068862_100220408
678 Ga0081455_10000418
679 Ga0081455_10331710
680 Ga0081539_10000346
681 Ga0081539_10003337
682 Ga0070717_10011421
683 Ga0070717_10192232
684 Ga0070716_100018531
685 Ga0070716_100235579
686 Ga0070716_101463951
687 Ga0070712_100006993
688 Ga0070712_100083329
689 Ga0070712_100085384
690 Ga0075370_10004194
691 Ga0068871_100884720
692 Ga0075430_100025943
693 Ga0075431_100004811
694 Ga0075431_100105862
695 Ga0075434_100022420
696 Ga0075434_100259198
697 Ga0075429_101103038
698 Ga0068865_100284671
699 Ga0068865_100455234
700 Ga0075436_100034783
701 Ga0075436_100377736
702 Ga0075436_101107564
703 Ga0097620_100003211
704 Ga0097620_100013203
705 Ga0097620_100040388
706 Ga0097620_100391765
707 Ga0097620_100701673
708 Ga0075435_100043004
709 Ga0075435_100310939
710 Ga0075435_100318447
711 Ga0075435_100394520
712 Ga0105240_10163923
713 Ga0111539_10060572
714 Ga0105245_10502328
715 Ga0105245_10895590
716 Ga0105247_10064908
717 Ga0105247_10435517
718 Ga0114129_10000925
719 Ga0114129_10560851
720 Ga0114129_10828683
721 Ga0114129_10837032
722 Ga0114129_11471129
723 Ga0114129_13302790
724 Ga0105243_10000996
725 Ga0105243_10047982
726 Ga0105241_10141772
727 Ga0105242_10322426
728 Ga0105242_10435053
729 Ga0105242_10766905
730 Ga0105242_11449483
731 Ga0105248_10003342
732 Ga0105248_11121967
733 Ga0105238_10000453
734 Ga0105238_10015271
735 Ga0105238_10883052
736 Ga0105249_10100889
737 Ga0105249_10214317
738 Ga0105249_10257651
739 Ga0105239_10005799
740 Ga0105239_12130245
741 Ga0105246_10020900
742 Ga0105246_10104300
743 Ga0105246_11937632
744 Ga0157371_10095319
745 Ga0157369_10914132
746 Ga0157374_10015332
747 Ga0157374_10809308
748 Ga0157378_10000015
749 Ga0157378_10066555
750 Ga0157378_10192643
751 Ga0157378_11283965
752 Ga0157378_11303248
753 Ga0157378_11757263
754 Ga0157378_12375159
755 Ga0163162_10050774
756 Ga0163162_11953080
757 Ga0157372_10032933
758 Ga0157372_10053296
759 Ga0157372_11858954
760 Ga0157375_10191789
761 Ga0157375_10377520
762 Ga0157375_11014638
763 Ga0157375_12487289
764 Ga0157375_12580182
765 Ga0163163_10096287
766 Ga0163163_10115414
767 Ga0163163_10331350
768 Ga0163163_11423705
769 Ga0163163_12610992
770 Ga0163163_13070614
771 Ga0157380_11754419
772 Ga0182008_10118981
773 Ga0157377_10116578
774 Ga0157377_10629509
775 Ga0157377_10928767
776 Ga0157376_10008932
777 Ga0157376_10116132
778 Ga0157376_11229459
779 Ga0207666_1030537
780 Ga0207697_10001859
781 Ga0207697_10001865
782 Ga0207653_10000047
783 Ga0207682_10056831
784 Ga0207692_10075734
785 Ga0207692_10633053
786 Ga0207642_10045965
787 Ga0207710_10000004
788 Ga0207710_10127913
789 Ga0207688_10034491
790 Ga0207688_10569816
791 Ga0207680_10167098
792 Ga0207645_10003342
793 Ga0207645_10004181
794 Ga0207645_10061525
795 Ga0207643_10001177
796 Ga0207684_10011572
797 Ga0207684_10329809
798 Ga0207684_10555190
799 Ga0207684_10774054
800 Ga0207684_11411507
801 Ga0207707_10555850
802 Ga0207707_10863292
803 Ga0207695_10401455
804 Ga0207695_10413148
805 Ga0207693_10010700
806 Ga0207693_10222704
807 Ga0207663_10041856
808 Ga0207663_10436040
809 Ga0207662_10019692
810 Ga0207662_10048376
811 Ga0207662_10817734
812 Ga0207657_10006391
813 Ga0207649_10086454
814 Ga0207652_10284592
815 Ga0207646_10000550
816 Ga0207681_10025343
817 Ga0207681_10030921
818 Ga0207681_10076001
819 Ga0207681_10211174
820 Ga0207694_10003055
821 Ga0207694_10170679
822 Ga0207650_10038064
823 Ga0207650_10237763
824 Ga0207659_10059210
825 Ga0207659_10092391
826 Ga0207659_10283266
827 Ga0207659_10518755
828 Ga0207687_10176672
829 Ga0207664_10197518
830 Ga0207644_10002425
831 Ga0207644_10148250
832 Ga0207644_10473992
833 Ga0207690_10201492
834 Ga0207706_10000999
835 Ga0207706_10028863
836 Ga0207706_10068096
837 Ga0207706_10501378
838 Ga0207686_10279619
839 Ga0207686_10630113
840 Ga0207709_10001187
841 Ga0207709_10596040
842 Ga0207669_10299931
843 Ga0207704_10624163
844 Ga0207665_10002211
845 Ga0207691_10008673
846 Ga0207691_10026915
847 Ga0207711_10006529
848 Ga0207711_10467061
849 Ga0207689_10001417
850 Ga0207679_10024837
851 Ga0207679_10787887
852 Ga0207667_10502672
853 Ga0207712_10195838
854 Ga0207668_10014858
855 Ga0207658_10047257
856 Ga0207658_10290299
857 Ga0207658_10347951
858 Ga0207658_10436553
859 Ga0207677_10250654
860 Ga0207677_10465063
861 Ga0207703_10165442
862 Ga0207639_10674148
863 Ga0207678_10093271
864 Ga0207708_10025555
865 Ga0207708_10064775
866 Ga0207708_10216782
867 Ga0207641_10329707
868 Ga0207641_10503382
869 Ga0207648_10393763
870 Ga0207674_10044024
871 Ga0207675_100014281
872 Ga0207683_10001033
873 Ga0207683_10300578
874 Ga0207698_10527881
875 Ga0268266_10359571
876 Ga0268265_10060463
877 Ga0268265_10284054
878 Ga0268264_11047838
879 Ga0268264_11163453
880 Ga0307515_10000008
881 Ga0265338_10525447
882 Ga0265765_1013133
883 Ga0307513_10200799
884 Ga0307408_100924697
885 Ga0316579_10318330
886 Ga0307405_10023447
887 Ga0307405_10311624
888 Ga0307410_10009883
889 Ga0307410_10811011
890 Ga0307410_11763947
891 Ga0307406_10022338
892 Ga0307412_10058787
893 Ga0307416_100016556
894 Ga0307414_10006929
895 Ga0307414_10690872
896 Ga0307411_10359936
897 Ga0307411_10601877
898 Ga0307411_12358362
899 Ga0307415_100005575
900 Ga0373945_0304019
901 Ga0373953_0053370
902 Ga0373954_0137601
903 Ga0373956_0430237
904 Ga0373943_0072420
905 Ga0373924_0009892
906 Ga0373935_0522089
907 Ga0373933_0011694
908 Ga0373947_0252479
909 Ga0373937_0002398
910 Ga0373937_0222746
911 Ga0373937_1018668
912 Ga0400490_38445
913 Ga0400491_27425
914 Ga0436360_0507637
915 Ga0436360_1307698
916 Ga0436362_1097775
917 Ga0451853_1505179
918 Ga0439458_0188334
919 Ga0439458_0206638
920 Ga0439435_0054705
921 Ga0439459_0160735
922 Ga0451576_0751411
923 Ga0495592_0137169
924 Ga0495629_0280222
925 Ga0495638_0638222
926 Ga0495653_0689580
927 Ga0495580_0147639
928 Ga0495664_0226376
929 Ga0495608_0279860
930 Ga0495608_0395505
931 Ga0495628_0009589
932 Ga0495630_0342556
933 Ga0495630_0859365
934 Ga0495630_1128335
935 Ga0495632_0147356
936 Ga0495637_0009569
937 Ga0495663_0051848
938 Ga0495663_0150724
939 Ga0495652_0140516
940 Ga0495652_0198552
941 Ga0495587_0004194
942 Ga0495587_0223241
943 Ga0495645_0000820
944 Ga0495645_0002759
945 Ga0495667_0002410
946 Ga0495625_0076225
947 Ga0495635_0945050
948 Ga0495657_0108884
949 Ga0495599_0012245
950 Ga0495599_0021219
951 Ga0495623_0001030
952 Ga0495623_0113428
953 Ga0495646_0601879
954 Ga0495669_0049698
955 Ga0495669_0307797
956 Ga0495600_0145983
957 Ga0495604_0375459
958 Ga0495636_0152378
959 Ga0495674_0162166
960 Ga0495680_0108504
961 Ga0495675_0001362
962 Ga0495675_0033676
963 Ga0495677_0036485
964 Ga0495673_0291426
965 Ga0495684_0011322
966 Ga0495684_0776527
967 Ga0495602_0066884
968 Ga0495602_0961981
969 Ga0495615_0073356
970 Ga0495626_0011025
971 Ga0496100_0476942
972 Ga0496100_0652442
973 Ga0496101_0070442
974 Ga0496101_0476625
975 Ga0496102_0027171
976 Ga0496102_0030887
977 Ga0496102_0747299
978 Ga0496103_0074171
979 Ga0496103_0112306
980 Ga0496105_0336006
981 Ga0496105_0515090
982 Ga0496106_0124012
983 Ga0496106_0391023
984 Ga0496107_0207714
985 Ga0496109_0006588
986 Ga0496109_0433862
987 Ga0496110_0011619
988 Ga0496110_0827444
989 Ga0496111_0076220
990 Ga0496112_0128667
991 Ga0496112_0329301
992 Ga0496112_0488824
993 Ga0496113_0105891
994 Ga0496113_0111964
995 Ga0496114_0461409
996 Ga0496114_0579917
997 Ga0496114_1060480
998 Ga0496114_1536164
999 Ga0496115_0012130
1000 Ga0496119_0069680
1001 Ga0496121_0016937
1002 Ga0496121_0096602
1003 Ga0496125_0024057
1004 Ga0496126_0065674
1005 Ga0496126_0977527
1006 Ga0501292_136908
1007 Ga0501076_0734613
1008 Ga0501201_016083
1009 Ga0501202_000507
1010 Ga0501216_013641
1011 Ga0501217_002038
1012 Ga0501223_014092
1013 Ga0501230_011931
1014 Ga0501233_005464
1015 Ga0501239_052103
1016 Ga0501246_026658
1017 Ga0501259_123981
1018 Ga0501221_077878
1019 Ga0501225_0004615
1020 Ga0501229_008713
1021 Ga0501245_069052
1022 Ga0501079_0588647
1023 Ga0501080_1796014
1024 Ga0501273_005459
1025 Ga0501280_082445
1026 Ga0501045_0595925
1027 Ga0501204_011255
1028 nmdc:mga07m45_5826_c1
1029 nmdc:mga05p37_1194447_c1
1030 nmdc:mga05p37_1360481_c1
1031 nmdc:mga05p37_1651984_c1
1032 nmdc:mga05p37_2141600_c1
1033 nmdc:mga05p37_63_c1
1034 nmdc:mga05p37_983004_c1
1035 nmdc:mga0qj67_112305_c1
1036 nmdc:mga06r32_62953_c1
1037 nmdc:mga06r32_687853_c1
1038 nmdc:mga08y16_308323_c1
1039 nmdc:mga0n895_19806_c1
1040 nmdc:mga0n895_432885_c1
1041 nmdc:mga0n895_55054_c1
1042 nmdc:mga0n895_90213_c1
1043 nmdc:mga0rr50_1135260_c1
1044 nmdc:mga0rr50_265172_c1
1045 nmdc:mga0rr50_74521_c1
1046 nmdc:mga08x19_127090_c1
1047 nmdc:mga08x19_669498_c1
1048 nmdc:mga0a205_1388114_c1
1049 Ga0495601_0177842
1050 Ga0495612_0024164
1051 Ga0495595_0231291
1052 Ga0495619_0106607
1053 Ga0495619_0110832
1054 Ga0495619_0748908
1055 Ga0500566_0460549
1056 Ga0500555_160123
1057 Ga0500562_003085
1058 Ga0500655_012776
1059 Ga0500627_0283775
1060 Ga0500634_0276622
1061 Ga0530510_0309470
1062 Ga0530510_0309928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

47

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oyy-assembly2.cif.gz_B structure of pseudomonas aeruginosa elongation factor p 0.8925 81 114
7n4d-assembly2.cif.gz_B translation initiation factor eif-5a family protein from naegleria fowleri atcc 30863 0.8723 81 114
6bt2-assembly2.cif.gz_B structure of the human nocturnin catalytic domain with bound sulfate anion 0.8715 79 115
3oyy-assembly1.cif.gz_A structure of pseudomonas aeruginosa elongation factor p 0.8512 81 114
1yby-assembly1.cif.gz_B conserved hypothetical protein cth-95 from clostridium thermocellum 0.8505 81 114
ID Description Score Start End Superfamily
af_P06864_732_1002_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9063 81 103 2.70.98.10
af_Q557H6_34_95_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9052 81 114 2.30.30.30
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.903 81 114 2.30.30.30
3oyyB01 Mainly Beta;Roll;SH3 type barrels.; 0.8925 81 114 2.30.30.30
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8892 81 115 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1P8YPY5-F1-model_v4 Lysozyme family protein 0.9856 18 116
AF-A0A7V4G7W4-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9653 23 119
AF-A0A0E3Z1I2-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9642 21 115
AF-A0A3A8KT25-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9553 23 120
AF-A0A0C2D3V1-F1-model_v4 Uncharacterized protein 0.9545 69 118

Map