F460168

General Info

Members Datasets Scaffolds Average Seq Length
531 301 1062 97

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0054323|Ga0466972_0054323_438_785
Length 115
Sequence MAPHEKPAAAVAVPLGAPVIRHLVLFKLNEGVQRDDPRVVEGVRAFEALGGLIDELRFWELGWNISDRPVAHDFAINSAVDDADALKRYLEHPAHQAGVALWREFATWVIADYEI

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
79 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
80 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
81 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
82 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
83 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
84 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
85 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
88 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
89 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
90 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
91 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
92 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
93 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
94 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
95 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
96 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
97 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
98 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
225 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
226 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
227 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
242 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
243 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
244 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
245 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
246 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
247 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
250 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
251 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
252 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
256 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
257 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
258 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
259 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
260 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
261 2643221647 Streptomyces sp. Root369 Isolate Unclassified
262 2643221670 Streptomyces sp. Root431 Isolate Unclassified
263 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
264 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
265 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
266 2643221714 Streptomyces sp. Root264 Isolate Unclassified
267 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
268 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
269 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
270 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
271 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
272 2808606448 Streptomyces sp. 193411 Isolate Unclassified
273 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
274 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
275 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
276 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
277 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
278 2862574272 Streptomyces sp. AcE210 Isolate Nodule
279 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
280 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
281 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
282 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
283 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
284 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
285 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
286 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
287 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
288 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
289 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
290 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
291 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
292 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
293 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
294 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
295 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
296 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
297 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
298 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
299 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
300 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
301 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.77
Metatranscriptomes 0.38
Isolates 8.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.27
Nodule 0.56
Rhizoplane 1.51
Rhizosphere 80.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0054323 3300044658 Bacteria 1927
2 JGI24737J22298_10017641 3300001990 Bacteria 2297
3 JGI24735J21928_10006368 3300002067 Bacteria 3890
4 JGI24738J21930_10003895 3300002075 Bacteria 3725
5 rootH2_10073569 3300003320 Bacteria 1051
6 rootL2_10001618 3300003322 Bacteria 1643
7 rootL2_10004213 3300003322 Bacteria 4547
8 rootL2_10064025 3300003322 Bacteria 2024
9 rootL2_10136613 3300003322 Bacteria 1576
10 rootL2_10136614 3300003322 Bacteria 1585
11 rootH1_10007562 3300003323 Bacteria 8041
12 rootH1_10014175 3300003323 Bacteria 1100
13 rootH1_10014176 3300003323 Bacteria 2893
14 rootH1_10016106 3300003323 Bacteria 1077
15 Ga0006562J51391_1152912 3300003578 Bacteria 2614
16 Ga0006562J51391_1152913 3300003578 Bacteria 2610
17 Ga0070670_101517549 3300005331 Bacteria 615
18 Ga0070666_10316054 3300005335 Bacteria 1114
19 Ga0070674_100592925 3300005356 Bacteria 935
20 Ga0070667_101469373 3300005367 Bacteria 640
21 Ga0070672_101435925 3300005543 Bacteria 617
22 Ga0070665_100701639 3300005548 Bacteria 1025
23 Ga0070665_100832576 3300005548 Bacteria 936
24 Ga0068855_100584756 3300005563 Bacteria 1206
25 Ga0070664_100961398 3300005564 Bacteria 802
26 Ga0068856_100036864 3300005614 Bacteria 4795
27 Ga0081539_10040632 3300005985 Bacteria 2728
28 Ga0075363_100004940 3300006048 Bacteria 5894
29 Ga0075370_10048348 3300006353 Bacteria 2410
30 Ga0105251_10013311 3300009011 Bacteria 4607
31 Ga0105251_10637298 3300009011 Bacteria 509
32 Ga0105250_10086151 3300009092 Bacteria 1275
33 Ga0105245_10184237 3300009098 Bacteria 1996
34 Ga0105245_10532645 3300009098 Bacteria 1195
35 Ga0105243_10065044 3300009148 Bacteria 2928
36 Ga0105243_10577308 3300009148 Bacteria 1079
37 Ga0105243_12502432 3300009148 Bacteria 555
38 Ga0105243_12860571 3300009148 Bacteria 523
39 Ga0105242_10412383 3300009176 Bacteria 1263
40 Ga0105248_10558704 3300009177 Bacteria 1291
41 Ga0105238_10138897 3300009551 Bacteria 2407
42 Ga0105249_12849182 3300009553 Bacteria 555
43 Ga0105239_10133258 3300010375 Bacteria 2765
44 Ga0105246_10016632 3300011119 Bacteria 4660
45 Ga0157342_1068822 3300012507 Bacteria 535
46 Ga0157369_10044925 3300013105 Bacteria 4807
47 Ga0157369_11073777 3300013105 Bacteria 823
48 Ga0157374_10419004 3300013296 Bacteria 1338
49 Ga0157378_11065868 3300013297 Bacteria 844
50 Ga0157372_10062678 3300013307 Bacteria 4167
51 Ga0157375_10884754 3300013308 Bacteria 1038
52 Ga0163163_13077208 3300014325 Bacteria 520
53 Ga0157379_11134286 3300014968 Bacteria 750
54 Ga0183367_1008 3300015688 Bacteria 490626
55 Ga0163161_11510111 3300017792 Bacteria 590
56 Ga0207426_1098292 3300025302 Bacteria 760
57 Ga0207696_1009748 3300025711 Bacteria 3564
58 Ga0207713_1160531 3300025735 Bacteria 717
59 Ga0207647_10007139 3300025904 Bacteria 8101
60 Ga0207660_11298540 3300025917 Bacteria 591
61 Ga0207694_10617960 3300025924 Bacteria 912
62 Ga0207687_10133760 3300025927 Bacteria 1873
63 Ga0207709_10027226 3300025935 Bacteria 3291
64 Ga0207709_10541185 3300025935 Bacteria 914
65 Ga0207709_11433149 3300025935 Bacteria 572
66 Ga0207691_10511002 3300025940 Bacteria 1020
67 Ga0207667_10914419 3300025949 Bacteria 869
68 Ga0207712_11793430 3300025961 Bacteria 550
69 Ga0207678_10867633 3300026067 Bacteria 798
70 Ga0207702_10047376 3300026078 Bacteria 3622
71 Ga0209371_1019211 3300027312 Bacteria 1710
72 Ga0268266_10066849 3300028379 Bacteria 3110
73 Ga0268266_10423406 3300028379 Bacteria 1262
74 Ga0307517_10031105 3300028786 Bacteria 6227
75 Ga0307515_10000928 3300028794 Bacteria 67239
76 Ga0307515_10041883 3300028794 Bacteria 7185
77 Ga0268256_1021568 3300030500 Bacteria 1710
78 Ga0307511_10000945 3300030521 Bacteria 30807
79 Ga0307511_10121672 3300030521 Bacteria 1611
80 Ga0307511_10211038 3300030521 Bacteria 991
81 Ga0307512_10195982 3300030522 Bacteria 1103
82 Ga0307512_10293324 3300030522 Bacteria 765
83 Ga0307513_10101111 3300031456 Bacteria 2906
84 Ga0307513_10349533 3300031456 Bacteria 1226
85 Ga0307509_10080918 3300031507 Bacteria 3358
86 Ga0307509_10211446 3300031507 Bacteria 1763
87 Ga0307508_10038079 3300031616 Bacteria 4324
88 Ga0307508_10074612 3300031616 Bacteria 2968
89 Ga0307514_10006009 3300031649 Bacteria 10682
90 Ga0307514_10163203 3300031649 Bacteria 1470
91 Ga0307516_10048375 3300031730 Bacteria 4184
92 Ga0307413_10099819 3300031824 Bacteria 1915
93 Ga0307518_10291744 3300031838 Bacteria 999
94 Ga0307409_101341226 3300031995 Bacteria 741
95 Ga0307416_100881573 3300032002 Bacteria 994
96 Ga0307416_102196811 3300032002 Bacteria 653
97 Ga0307411_10052210 3300032005 Bacteria 2672
98 Ga0307507_10007659 3300033179 Bacteria 15491
99 Ga0307507_10088230 3300033179 Bacteria 2676
100 Ga0307510_10024795 3300033180 Bacteria 6925
101 Ga0307510_10100369 3300033180 Bacteria 2688
102 Ga0307510_10118193 3300033180 Bacteria 2365
103 Ga0307510_10258354 3300033180 Bacteria 1224
104 Ga0395899_0600053 3300037312 Bacteria 701
105 Ga0395900_0112552 3300037418 Bacteria 2795
106 Ga0395898_0003880 3300037466 Bacteria 16509
107 Ga0395898_0004096 3300037466 Bacteria 15992
108 Ga0395898_1008319 3300037466 Bacteria 768
109 Ga0395905_0336611 3300037471 Bacteria 1400
110 Ga0395905_0992799 3300037471 Bacteria 743
111 Ga0395901_0043464 3300038443 Bacteria 4661
112 Ga0439436_0017900 3300041404 Bacteria 2120
113 Ga0439439_0005709 3300041406 Bacteria 2854
114 Ga0439439_0060710 3300041406 Bacteria 1003
115 Ga0451797_1420531 3300041453 Bacteria 532
116 Ga0451797_1467713 3300041453 Bacteria 830
117 Ga0451802_1424078 3300041460 Bacteria 768
118 Ga0451835_0896507 3300041492 Bacteria 770
119 Ga0451841_0617769 3300041498 Bacteria 647
120 Ga0451845_0094680 3300041501 Bacteria 996
121 Ga0451845_0951856 3300041501 Bacteria 953
122 Ga0451849_0981227 3300041505 Bacteria 1724
123 Ga0451853_0607391 3300041512 Bacteria 4120
124 Ga0439433_0001999 3300041999 Bacteria 4278
125 Ga0439442_018903 3300042002 Bacteria 1425
126 Ga0439449_0000497 3300042007 Bacteria 14752
127 Ga0439449_0015010 3300042007 Bacteria 2910
128 Ga0439457_000550 3300042014 Bacteria 10958
129 Ga0439457_011664 3300042014 Bacteria 1993
130 Ga0439462_0000559 3300042015 Bacteria 7384
131 Ga0439462_0052757 3300042015 Bacteria 1094
132 Ga0450911_030832 3300042115 Bacteria 695
133 Ga0450890_056157 3300042127 Bacteria 609
134 Ga0450894_000065 3300042131 Bacteria 16610
135 Ga0450896_002488 3300042133 Bacteria 2382
136 Ga0450898_000114 3300042134 Bacteria 7618
137 Ga0450910_052606 3300042147 Bacteria 675
138 Ga0450908_001299 3300042184 Bacteria 4843
139 Ga0466969_0041050 3300044656 Bacteria 2316
140 Ga0466969_0319004 3300044656 Bacteria 703
141 Ga0466972_0146445 3300044658 Bacteria 1111
142 Ga0466972_0485316 3300044658 Bacteria 581
143 Ga0466965_0003938 3300044683 Bacteria 6575
144 Ga0466965_0008457 3300044683 Bacteria 4763
145 Ga0466966_0004723 3300044684 Bacteria 8963
146 Ga0466966_0007172 3300044684 Bacteria 7384
147 Ga0466966_0017306 3300044684 Bacteria 4762
148 Ga0466966_0684667 3300044684 Bacteria 618
149 Ga0466961_0001990 3300044693 Bacteria 12714
150 Ga0466961_0005480 3300044693 Bacteria 8003
151 Ga0466961_0016214 3300044693 Bacteria 4784
152 Ga0466961_0549368 3300044693 Bacteria 696
153 Ga0466961_0590681 3300044693 Bacteria 668
154 Ga0466963_0000690 3300044694 Bacteria 16420
155 Ga0466964_0271554 3300044706 Bacteria 844
156 Ga0466971_0000277 3300044719 Bacteria 19725
157 Ga0466971_0005633 3300044719 Bacteria 5446
158 Ga0466971_0474190 3300044719 Bacteria 615
159 Ga0466968_0015992 3300044735 Bacteria 2981
160 Ga0466970_0000443 3300044765 Bacteria 20304
161 Ga0466970_0007072 3300044765 Bacteria 5613
162 Ga0466970_0480097 3300044765 Bacteria 714
163 Ga0466957_0011386 3300044842 Bacteria 5130
164 Ga0466957_0508207 3300044842 Bacteria 836
165 Ga0466960_0013234 3300044901 Bacteria 3500
166 Ga0466960_0703746 3300044901 Bacteria 606
167 Ga0466959_0000619 3300045049 Bacteria 20595
168 Ga0466959_0005379 3300045049 Bacteria 8765
169 Ga0466958_0000999 3300045836 Bacteria 12806
170 Ga0466958_1057343 3300045836 Bacteria 530
171 Ga0466967_0027005 3300045976 Bacteria 4767
172 Ga0466967_0045343 3300045976 Bacteria 3819
173 Ga0466967_0422013 3300045976 Bacteria 1300
174 Ga0495627_003784 3300046453 Bacteria 6527
175 Ga0495627_082864 3300046453 Bacteria 928
176 Ga0495592_0001071 3300046454 Bacteria 18930
177 Ga0495592_0022702 3300046454 Bacteria 4772
178 Ga0495603_0002053 3300046455 Bacteria 11844
179 Ga0495603_0025168 3300046455 Bacteria 3599
180 Ga0495603_0037054 3300046455 Bacteria 2926
181 Ga0495603_0493657 3300046455 Bacteria 701
182 Ga0495590_0089633 3300046457 Bacteria 1087
183 Ga0495590_0364677 3300046457 Bacteria 550
184 Ga0495629_0048621 3300046459 Bacteria 2973
185 Ga0495629_0055861 3300046459 Bacteria 2761
186 Ga0495629_0061273 3300046459 Bacteria 2629
187 Ga0495629_0090531 3300046459 Bacteria 2134
188 Ga0495629_0236789 3300046459 Bacteria 1257
189 Ga0495629_0249809 3300046459 Bacteria 1220
190 Ga0495629_0793472 3300046459 Bacteria 625
191 Ga0495638_0025613 3300046460 Bacteria 3831
192 Ga0495638_0048939 3300046460 Bacteria 2644
193 Ga0495638_0167252 3300046460 Bacteria 1264
194 Ga0495651_0014295 3300046462 Bacteria 6135
195 Ga0495651_0026630 3300046462 Bacteria 4503
196 Ga0495653_0009683 3300046463 Bacteria 7879
197 Ga0495653_0261487 3300046463 Bacteria 1144
198 Ga0495580_0052865 3300046472 Bacteria 2868
199 Ga0495582_0092080 3300046473 Bacteria 1691
200 Ga0495582_0436392 3300046473 Bacteria 756
201 Ga0495605_0031093 3300046474 Bacteria 2729
202 Ga0495605_0062656 3300046474 Bacteria 1776
203 Ga0495639_0066457 3300046475 Bacteria 1660
204 Ga0495662_0000160 3300046476 Bacteria 26336
205 Ga0495662_0000395 3300046476 Bacteria 19477
206 Ga0495662_0031198 3300046476 Bacteria 2574
207 Ga0495662_0273465 3300046476 Bacteria 831
208 Ga0495664_0003661 3300046477 Bacteria 8374
209 Ga0495664_0023600 3300046477 Bacteria 3570
210 Ga0495664_0057113 3300046477 Bacteria 2321
211 Ga0495584_0138146 3300046491 Bacteria 1237
212 Ga0495585_0010394 3300046492 Bacteria 5542
213 Ga0495585_0228306 3300046492 Bacteria 936
214 Ga0495594_0113086 3300046499 Bacteria 1531
215 Ga0495596_0101995 3300046500 Bacteria 1114
216 Ga0495607_0049141 3300046501 Bacteria 2461
217 Ga0495607_0257901 3300046501 Bacteria 836
218 Ga0495583_0063478 3300046506 Bacteria 1641
219 Ga0495583_0117772 3300046506 Bacteria 1120
220 Ga0495583_0220997 3300046506 Bacteria 765
221 Ga0495606_0065169 3300046507 Bacteria 2315
222 Ga0495608_0002517 3300046511 Bacteria 13149
223 Ga0495610_0015701 3300046512 Bacteria 4390
224 Ga0495610_0107265 3300046512 Bacteria 1242
225 Ga0495616_0002920 3300046513 Bacteria 11131
226 Ga0495618_0011263 3300046514 Bacteria 5419
227 Ga0495620_0027034 3300046515 Bacteria 2690
228 Ga0495620_0046655 3300046515 Bacteria 1869
229 Ga0495628_0252142 3300046516 Bacteria 1317
230 Ga0495628_0713300 3300046516 Bacteria 707
231 Ga0495630_0046223 3300046517 Bacteria 3254
232 Ga0495630_0514961 3300046517 Bacteria 917
233 Ga0495630_0808647 3300046517 Bacteria 715
234 Ga0495631_0002725 3300046518 Bacteria 9797
235 Ga0495632_0099907 3300046519 Bacteria 1368
236 Ga0495637_0290725 3300046520 Bacteria 581
237 Ga0495643_0014232 3300046522 Bacteria 4737
238 Ga0495644_0014593 3300046523 Bacteria 3009
239 Ga0495648_0031467 3300046524 Bacteria 3492
240 Ga0495648_0178709 3300046524 Bacteria 1080
241 Ga0495666_0007611 3300046526 Bacteria 5421
242 Ga0495666_0127147 3300046526 Bacteria 1191
243 Ga0495666_0191762 3300046526 Bacteria 941
244 Ga0495666_0330210 3300046526 Bacteria 688
245 Ga0495642_0029307 3300046528 Bacteria 2197
246 Ga0495652_0100979 3300046529 Bacteria 2339
247 Ga0495652_0136534 3300046529 Bacteria 1934
248 Ga0495654_0136368 3300046530 Bacteria 1097
249 Ga0495665_0029659 3300046531 Bacteria 2931
250 Ga0495640_0018553 3300046533 Bacteria 5153
251 Ga0495640_0024854 3300046533 Bacteria 4352
252 Ga0495640_0064716 3300046533 Bacteria 2471
253 Ga0495640_0855775 3300046533 Bacteria 540
254 Ga0495586_0005855 3300046535 Bacteria 6568
255 Ga0495586_0014574 3300046535 Bacteria 4177
256 Ga0495586_0335365 3300046535 Bacteria 868
257 Ga0495587_0006149 3300046536 Bacteria 7835
258 Ga0495587_0217301 3300046536 Bacteria 1078
259 Ga0495609_0022763 3300046538 Bacteria 2887
260 Ga0495609_0152469 3300046538 Bacteria 982
261 Ga0495597_0063307 3300046542 Bacteria 1607
262 Ga0495597_0072069 3300046542 Bacteria 1486
263 Ga0495645_0010639 3300046543 Bacteria 6459
264 Ga0495645_0011236 3300046543 Bacteria 6295
265 Ga0495645_0049459 3300046543 Bacteria 3062
266 Ga0495622_0129220 3300046557 Bacteria 1151
267 Ga0495622_0168557 3300046557 Bacteria 985
268 Ga0495622_0351915 3300046557 Bacteria 637
269 Ga0495633_0073868 3300046558 Bacteria 1589
270 Ga0495633_0557024 3300046558 Bacteria 516
271 Ga0495667_0067359 3300046559 Bacteria 2339
272 Ga0495667_0243022 3300046559 Bacteria 1146
273 Ga0495667_0332319 3300046559 Bacteria 961
274 Ga0495667_0337079 3300046559 Bacteria 954
275 Ga0495668_0030665 3300046616 Bacteria 3034
276 Ga0495668_0109831 3300046616 Bacteria 1508
277 Ga0495634_0024770 3300046642 Bacteria 4206
278 Ga0495634_0046032 3300046642 Bacteria 2946
279 Ga0495634_0251654 3300046642 Bacteria 1080
280 Ga0495611_0080568 3300046648 Bacteria 1496
281 Ga0495611_0244115 3300046648 Bacteria 833
282 Ga0495625_0048503 3300046660 Bacteria 3057
283 Ga0495625_0351886 3300046660 Bacteria 931
284 Ga0495625_0426454 3300046660 Bacteria 823
285 Ga0495625_0755626 3300046660 Bacteria 569
286 Ga0495635_0000602 3300046663 Bacteria 23157
287 Ga0495635_0708543 3300046663 Bacteria 652
288 Ga0495635_0846643 3300046663 Bacteria 587
289 Ga0495661_0011402 3300046665 Bacteria 6034
290 Ga0495661_0471294 3300046665 Bacteria 602
291 Ga0495588_0001017 3300046674 Bacteria 12195
292 Ga0495588_0095097 3300046674 Bacteria 1562
293 Ga0495657_0002328 3300046675 Bacteria 15995
294 Ga0495657_0029097 3300046675 Bacteria 3878
295 Ga0495657_0033412 3300046675 Bacteria 3581
296 Ga0495657_0126942 3300046675 Bacteria 1601
297 Ga0495657_0575943 3300046675 Bacteria 652
298 Ga0495599_0061868 3300046678 Bacteria 2338
299 Ga0495623_0003588 3300046679 Bacteria 10259
300 Ga0495623_0132528 3300046679 Bacteria 1490
301 Ga0495646_0000580 3300046680 Bacteria 19850
302 Ga0495646_0060910 3300046680 Bacteria 2249
303 Ga0495646_0280471 3300046680 Bacteria 885
304 Ga0495613_0001160 3300046689 Bacteria 20120
305 Ga0495613_0030403 3300046689 Bacteria 4011
306 Ga0495613_0039696 3300046689 Bacteria 3489
307 Ga0495613_0088993 3300046689 Bacteria 2236
308 Ga0495613_0092735 3300046689 Bacteria 2186
309 Ga0495613_0138838 3300046689 Bacteria 1737
310 Ga0495613_0266886 3300046689 Bacteria 1191
311 Ga0495613_0524450 3300046689 Bacteria 795
312 Ga0495624_0110017 3300046690 Bacteria 1694
313 Ga0495624_0387452 3300046690 Bacteria 839
314 Ga0495670_0009954 3300046691 Bacteria 4673
315 Ga0495670_0334936 3300046691 Bacteria 813
316 Ga0495671_0029592 3300046692 Bacteria 2811
317 Ga0495671_0123050 3300046692 Bacteria 1265
318 Ga0495671_0205003 3300046692 Bacteria 956
319 Ga0495649_0294848 3300046694 Bacteria 826
320 Ga0495649_0324052 3300046694 Bacteria 781
321 Ga0495649_0415242 3300046694 Bacteria 674
322 Ga0495589_0004814 3300046794 Bacteria 7172
323 Ga0495589_0016940 3300046794 Bacteria 3741
324 Ga0495589_0017929 3300046794 Bacteria 3631
325 Ga0495589_0031809 3300046794 Bacteria 2655
326 Ga0495589_0055418 3300046794 Bacteria 1953
327 Ga0495589_0148862 3300046794 Bacteria 1118
328 Ga0495589_0165127 3300046794 Bacteria 1054
329 Ga0495600_0010174 3300046809 Bacteria 5828
330 Ga0495600_0074304 3300046809 Bacteria 2219
331 Ga0495600_0119851 3300046809 Bacteria 1711
332 Ga0495600_0275362 3300046809 Bacteria 1066
333 Ga0495660_0029829 3300046810 Bacteria 3075
334 Ga0495660_0101813 3300046810 Bacteria 1477
335 Ga0495581_0071220 3300047315 Bacteria 2011
336 Ga0495581_0295981 3300047315 Bacteria 946
337 Ga0495581_0328696 3300047315 Bacteria 893
338 Ga0495581_0628968 3300047315 Bacteria 621
339 Ga0495604_0004107 3300047317 Bacteria 11571
340 Ga0495604_0004679 3300047317 Bacteria 10852
341 Ga0495604_0050783 3300047317 Bacteria 3218
342 Ga0495604_0315780 3300047317 Bacteria 1045
343 Ga0495604_0403008 3300047317 Bacteria 900
344 Ga0495636_0012221 3300047318 Bacteria 3398
345 Ga0495636_0028092 3300047318 Bacteria 2292
346 Ga0495636_0035241 3300047318 Bacteria 2061
347 Ga0495636_0035939 3300047318 Bacteria 2041
348 Ga0495674_0233786 3300047319 Bacteria 1516
349 Ga0495674_0379847 3300047319 Bacteria 1143
350 Ga0495672_0040614 3300047320 Bacteria 2820
351 Ga0495676_0070295 3300047321 Bacteria 2696
352 Ga0495676_0113601 3300047321 Bacteria 1982
353 Ga0495680_0258310 3300047322 Bacteria 1232
354 Ga0495683_0080272 3300047323 Bacteria 1592
355 Ga0495683_0082568 3300047323 Bacteria 1565
356 Ga0495683_0104881 3300047323 Bacteria 1355
357 Ga0495683_0417402 3300047323 Bacteria 555
358 Ga0495687_002133 3300047443 Bacteria 16528
359 Ga0495687_016978 3300047443 Bacteria 3645
360 Ga0495687_063304 3300047443 Bacteria 1514
361 Ga0495687_104502 3300047443 Bacteria 1055
362 Ga0495687_214968 3300047443 Bacteria 599
363 Ga0495687_266935 3300047443 Bacteria 502
364 Ga0495675_0006994 3300047444 Bacteria 6938
365 Ga0495675_0041550 3300047444 Bacteria 2930
366 Ga0495675_0131528 3300047444 Bacteria 1555
367 Ga0495675_0235023 3300047444 Bacteria 1105
368 Ga0495675_0244329 3300047444 Bacteria 1079
369 Ga0495675_0622046 3300047444 Bacteria 610
370 Ga0495677_0071612 3300047445 Bacteria 1292
371 Ga0495677_0114980 3300047445 Bacteria 1024
372 Ga0495679_063879 3300047446 Bacteria 1074
373 Ga0495685_010733 3300047447 Bacteria 3078
374 Ga0495685_017478 3300047447 Bacteria 2457
375 Ga0495685_018023 3300047447 Bacteria 2420
376 Ga0495685_041256 3300047447 Bacteria 1577
377 Ga0495673_0121365 3300047469 Bacteria 1035
378 Ga0495681_0023501 3300047470 Bacteria 3273
379 Ga0495681_0081074 3300047470 Bacteria 1448
380 Ga0495684_0386667 3300047471 Bacteria 985
381 Ga0495684_0512327 3300047471 Bacteria 823
382 Ga0495686_0420021 3300047472 Bacteria 715
383 Ga0495593_0000360 3300047673 Bacteria 25155
384 Ga0495593_0037594 3300047673 Bacteria 2618
385 Ga0495593_0042987 3300047673 Bacteria 2424
386 Ga0495593_0576764 3300047673 Bacteria 564
387 Ga0495602_0013430 3300048088 Bacteria 8371
388 Ga0495602_0078972 3300048088 Bacteria 2777
389 Ga0495614_0006245 3300048089 Bacteria 5357
390 Ga0495614_0043208 3300048089 Bacteria 1932
391 Ga0495614_0181658 3300048089 Bacteria 946
392 Ga0495614_0183619 3300048089 Bacteria 941
393 Ga0495626_0096889 3300048091 Bacteria 1290
394 Ga0495626_0143475 3300048091 Bacteria 1011
395 Ga0495626_0213179 3300048091 Bacteria 787
396 Ga0496102_1690251 3300048905 Bacteria 551
397 Ga0496105_0642297 3300048908 Bacteria 820
398 Ga0496109_0028010 3300048912 Bacteria 5036
399 Ga0496110_0544753 3300048913 Bacteria 1055
400 Ga0496113_0438554 3300048916 Bacteria 1049
401 Ga0496125_0660725 3300048928 Bacteria 561
402 Ga0495678_008311 3300049459 Bacteria 5251
403 Ga0495682_0014494 3300049460 Bacteria 2989
404 Ga0501031_0260762 3300049568 Bacteria 1126
405 Ga0501031_0306278 3300049568 Bacteria 1029
406 Ga0501032_0430186 3300049569 Bacteria 846
407 Ga0501033_0002071 3300049570 Bacteria 17426
408 Ga0501033_0025930 3300049570 Bacteria 4413
409 Ga0501033_0045565 3300049570 Bacteria 3263
410 Ga0501034_0015782 3300049571 Bacteria 7757
411 Ga0501034_0330296 3300049571 Bacteria 1456
412 Ga0501034_1354145 3300049571 Bacteria 587
413 Ga0501036_0002995 3300049572 Bacteria 13436
414 Ga0501036_0081023 3300049572 Bacteria 2743
415 Ga0501036_1630736 3300049572 Bacteria 520
416 Ga0501037_0020763 3300049573 Bacteria 4849
417 Ga0501037_0070595 3300049573 Bacteria 2541
418 Ga0501037_0526868 3300049573 Bacteria 799
419 Ga0501038_0064490 3300049574 Bacteria 3123
420 Ga0501038_0095960 3300049574 Bacteria 2476
421 Ga0501038_0595203 3300049574 Bacteria 837
422 Ga0501043_0027864 3300049579 Bacteria 4434
423 Ga0501043_1321789 3300049579 Bacteria 502
424 Ga0501047_0000148 3300049581 Bacteria 85356
425 Ga0501047_0073640 3300049581 Bacteria 3288
426 Ga0501047_0366059 3300049581 Bacteria 1277
427 Ga0501048_0892057 3300049582 Bacteria 639
428 Ga0501068_0101323 3300049584 Bacteria 1785
429 Ga0501068_0450954 3300049584 Bacteria 832
430 Ga0501069_0764426 3300049585 Bacteria 585
431 Ga0501069_0941099 3300049585 Bacteria 526
432 Ga0501070_0040550 3300049586 Bacteria 3882
433 Ga0501070_0203953 3300049586 Bacteria 1624
434 Ga0501070_0691018 3300049586 Bacteria 807
435 Ga0501072_0135966 3300049588 Bacteria 1960
436 Ga0501074_0026890 3300049590 Bacteria 4170
437 Ga0501216_006218 3300049660 Bacteria 1826
438 Ga0501235_052145 3300049669 Bacteria 949
439 Ga0501235_061463 3300049669 Bacteria 880
440 Ga0501252_092140 3300049682 Bacteria 515
441 Ga0501257_170566 3300049686 Bacteria 611
442 Ga0501079_1290501 3300049741 Bacteria 575
443 Ga0501035_0041908 3300049822 Bacteria 4131
444 Ga0501035_0065054 3300049822 Bacteria 3239
445 Ga0501035_0103603 3300049822 Bacteria 2496
446 Ga0501035_0786167 3300049822 Bacteria 761
447 Ga0501035_0990329 3300049822 Bacteria 661
448 Ga0501035_1289380 3300049822 Bacteria 563
449 Ga0501044_0010468 3300049823 Bacteria 10063
450 Ga0501044_0298341 3300049823 Bacteria 1541
451 Ga0501044_1051984 3300049823 Bacteria 684
452 Ga0501044_1404768 3300049823 Bacteria 563
453 Ga0501045_0084933 3300049824 Bacteria 2335
454 nmdc:mga03n38_6252_c1 3300050490 Bacteria 4123
455 nmdc:mga04h51_544816_c1 3300050495 Bacteria 500
456 nmdc:mga07m45_16611_c1 3300050496 Bacteria 3941
457 Ga0500610_0221661 3300053079 Bacteria 895
458 Ga0495655_0067522 3300053083 Bacteria 991
459 Ga0495619_0027791 3300053085 Bacteria 3648
460 Ga0495619_0272803 3300053085 Bacteria 1172
461 Ga0500644_0030424 3300053088 Bacteria 1708
462 Ga0500644_0054281 3300053088 Bacteria 1386
463 Ga0500583_0409519 3300053092 Bacteria 649
464 Ga0500651_0407309 3300053093 Bacteria 763
465 Ga0500640_070445 3300053095 Bacteria 1500
466 Ga0500650_0174773 3300053098 Bacteria 986
467 Ga0500660_101229 3300053100 Bacteria 1255
468 Ga0500558_155363 3300053106 Bacteria 845
469 Ga0500560_005813 3300053107 Bacteria 2764
470 Ga0500560_010267 3300053107 Bacteria 2338
471 Ga0500572_013379 3300053111 Bacteria 2029
472 Ga0500608_059907 3300053122 Bacteria 1821
473 Ga0500652_164106 3300053131 Bacteria 917
474 Ga0500573_0045437 3300053140 Bacteria 2532
475 Ga0500573_0054946 3300053140 Bacteria 2286
476 Ga0500600_0041832 3300053149 Bacteria 2642
477 Ga0500600_0101045 3300053149 Bacteria 1521
478 Ga0500600_0154424 3300053149 Bacteria 1137
479 Ga0500624_041072 3300053157 Bacteria 831
480 Ga0500634_0104823 3300053161 Bacteria 1408
481 Ga0500636_0158367 3300053177 Bacteria 1237
482 Ga0466962_0000163 3300061719 Bacteria 28323
483 Ga0466962_0026662 3300061719 Bacteria 2774
484 Ga0466962_0135172 3300061719 Bacteria 1193
485 2547405974 2547132111 Bacteria 8013147
486 2585314439 2582581314 Bacteria 11452267
487 2616700244 2616644814 Bacteria 11555299
488 2643947800 2643221587 Bacteria 7586415
489 2644018484 2643221601 Bacteria 7493239
490 2644177519 2643221631 Bacteria 8168043
491 2644262978 2643221647 Bacteria 10741251
492 2644390759 2643221670 Bacteria 6497041
493 2644405747 2643221673 Bacteria 9196637
494 2644433665 2643221677 Bacteria 7584031
495 2644443201 2643221678 Bacteria 9540101
496 2644626984 2643221714 Bacteria 9015452
497 2784588912 2784132148 Bacteria 8627943
498 2785342968 2784746763 Bacteria 9783172
499 2785369863 2784746768 Bacteria 10036182
500 2808842358 2808606359 Bacteria 9866990
501 2808920882 2808606375 Bacteria 9466072
502 2809232531 2808606448 Bacteria 8656184
503 2812357746 2811994879 Bacteria 9313447
504 2852637131 2852635781 Bacteria 8251373
505 2862285980 2862281513 Bacteria 9621493
506 2862389632 2862382967 Bacteria 10317375
507 2862508021 2862507626 Bacteria 9425308
508 2862578933 2862574272 Bacteria 10567477
509 2863404233 2863404153 Bacteria 9672205
510 2873155416 2873151551 Bacteria 8625867
511 2877680768 2877676314 Bacteria 9512378
512 2912719513 2912715099 Bacteria 9460473
513 2912731338 2912723979 Bacteria 8557534
514 2912761179 2912757875 Bacteria 7940295
515 2918505247 2918501144 Bacteria 8668083
516 2919471965 2919468124 Bacteria 9133025
517 2946068125 2946064051 Bacteria 8957905
518 2946076217 2946072368 Bacteria 8999607
519 2954385873 2954380949 Bacteria 10050426
520 2954696532 2954691527 Bacteria 10720516
521 2954705754 2954701450 Bacteria 10834262
522 2995471573 2995463766 Bacteria 8577691
523 3006393918 3006393351 Bacteria 6615579
524 8008566928 8008558824 Bacteria 10610750
525 8008578599 8008574985 Bacteria 7815457
526 8023624061 8023623736 Bacteria 8593882
527 8025478599 8025478263 Bacteria 8209203
528 8025534270 8025530807 Bacteria 8495698
529 8048409460 8048406513 Bacteria 8936924
530 8056447542 8056447290 Bacteria 7680491
531 8056833355 8056829672 Bacteria 9045328
532 Ga0466972_0054323
533 JGI24737J22298_10017641
534 JGI24735J21928_10006368
535 JGI24738J21930_10003895
536 rootH2_10073569
537 rootL2_10001618
538 rootL2_10004213
539 rootL2_10064025
540 rootL2_10136613
541 rootL2_10136614
542 rootH1_10007562
543 rootH1_10014175
544 rootH1_10014176
545 rootH1_10016106
546 Ga0006562J51391_1152912
547 Ga0006562J51391_1152913
548 Ga0070670_101517549
549 Ga0070666_10316054
550 Ga0070674_100592925
551 Ga0070667_101469373
552 Ga0070672_101435925
553 Ga0070665_100701639
554 Ga0070665_100832576
555 Ga0068855_100584756
556 Ga0070664_100961398
557 Ga0068856_100036864
558 Ga0081539_10040632
559 Ga0075363_100004940
560 Ga0075370_10048348
561 Ga0105251_10013311
562 Ga0105251_10637298
563 Ga0105250_10086151
564 Ga0105245_10184237
565 Ga0105245_10532645
566 Ga0105243_10065044
567 Ga0105243_10577308
568 Ga0105243_12502432
569 Ga0105243_12860571
570 Ga0105242_10412383
571 Ga0105248_10558704
572 Ga0105238_10138897
573 Ga0105249_12849182
574 Ga0105239_10133258
575 Ga0105246_10016632
576 Ga0157342_1068822
577 Ga0157369_10044925
578 Ga0157369_11073777
579 Ga0157374_10419004
580 Ga0157378_11065868
581 Ga0157372_10062678
582 Ga0157375_10884754
583 Ga0163163_13077208
584 Ga0157379_11134286
585 Ga0183367_1008
586 Ga0163161_11510111
587 Ga0207426_1098292
588 Ga0207696_1009748
589 Ga0207713_1160531
590 Ga0207647_10007139
591 Ga0207660_11298540
592 Ga0207694_10617960
593 Ga0207687_10133760
594 Ga0207709_10027226
595 Ga0207709_10541185
596 Ga0207709_11433149
597 Ga0207691_10511002
598 Ga0207667_10914419
599 Ga0207712_11793430
600 Ga0207678_10867633
601 Ga0207702_10047376
602 Ga0209371_1019211
603 Ga0268266_10066849
604 Ga0268266_10423406
605 Ga0307517_10031105
606 Ga0307515_10000928
607 Ga0307515_10041883
608 Ga0268256_1021568
609 Ga0307511_10000945
610 Ga0307511_10121672
611 Ga0307511_10211038
612 Ga0307512_10195982
613 Ga0307512_10293324
614 Ga0307513_10101111
615 Ga0307513_10349533
616 Ga0307509_10080918
617 Ga0307509_10211446
618 Ga0307508_10038079
619 Ga0307508_10074612
620 Ga0307514_10006009
621 Ga0307514_10163203
622 Ga0307516_10048375
623 Ga0307413_10099819
624 Ga0307518_10291744
625 Ga0307409_101341226
626 Ga0307416_100881573
627 Ga0307416_102196811
628 Ga0307411_10052210
629 Ga0307507_10007659
630 Ga0307507_10088230
631 Ga0307510_10024795
632 Ga0307510_10100369
633 Ga0307510_10118193
634 Ga0307510_10258354
635 Ga0395899_0600053
636 Ga0395900_0112552
637 Ga0395898_0003880
638 Ga0395898_0004096
639 Ga0395898_1008319
640 Ga0395905_0336611
641 Ga0395905_0992799
642 Ga0395901_0043464
643 Ga0439436_0017900
644 Ga0439439_0005709
645 Ga0439439_0060710
646 Ga0451797_1420531
647 Ga0451797_1467713
648 Ga0451802_1424078
649 Ga0451835_0896507
650 Ga0451841_0617769
651 Ga0451845_0094680
652 Ga0451845_0951856
653 Ga0451849_0981227
654 Ga0451853_0607391
655 Ga0439433_0001999
656 Ga0439442_018903
657 Ga0439449_0000497
658 Ga0439449_0015010
659 Ga0439457_000550
660 Ga0439457_011664
661 Ga0439462_0000559
662 Ga0439462_0052757
663 Ga0450911_030832
664 Ga0450890_056157
665 Ga0450894_000065
666 Ga0450896_002488
667 Ga0450898_000114
668 Ga0450910_052606
669 Ga0450908_001299
670 Ga0466969_0041050
671 Ga0466969_0319004
672 Ga0466972_0146445
673 Ga0466972_0485316
674 Ga0466965_0003938
675 Ga0466965_0008457
676 Ga0466966_0004723
677 Ga0466966_0007172
678 Ga0466966_0017306
679 Ga0466966_0684667
680 Ga0466961_0001990
681 Ga0466961_0005480
682 Ga0466961_0016214
683 Ga0466961_0549368
684 Ga0466961_0590681
685 Ga0466963_0000690
686 Ga0466964_0271554
687 Ga0466971_0000277
688 Ga0466971_0005633
689 Ga0466971_0474190
690 Ga0466968_0015992
691 Ga0466970_0000443
692 Ga0466970_0007072
693 Ga0466970_0480097
694 Ga0466957_0011386
695 Ga0466957_0508207
696 Ga0466960_0013234
697 Ga0466960_0703746
698 Ga0466959_0000619
699 Ga0466959_0005379
700 Ga0466958_0000999
701 Ga0466958_1057343
702 Ga0466967_0027005
703 Ga0466967_0045343
704 Ga0466967_0422013
705 Ga0495627_003784
706 Ga0495627_082864
707 Ga0495592_0001071
708 Ga0495592_0022702
709 Ga0495603_0002053
710 Ga0495603_0025168
711 Ga0495603_0037054
712 Ga0495603_0493657
713 Ga0495590_0089633
714 Ga0495590_0364677
715 Ga0495629_0048621
716 Ga0495629_0055861
717 Ga0495629_0061273
718 Ga0495629_0090531
719 Ga0495629_0236789
720 Ga0495629_0249809
721 Ga0495629_0793472
722 Ga0495638_0025613
723 Ga0495638_0048939
724 Ga0495638_0167252
725 Ga0495651_0014295
726 Ga0495651_0026630
727 Ga0495653_0009683
728 Ga0495653_0261487
729 Ga0495580_0052865
730 Ga0495582_0092080
731 Ga0495582_0436392
732 Ga0495605_0031093
733 Ga0495605_0062656
734 Ga0495639_0066457
735 Ga0495662_0000160
736 Ga0495662_0000395
737 Ga0495662_0031198
738 Ga0495662_0273465
739 Ga0495664_0003661
740 Ga0495664_0023600
741 Ga0495664_0057113
742 Ga0495584_0138146
743 Ga0495585_0010394
744 Ga0495585_0228306
745 Ga0495594_0113086
746 Ga0495596_0101995
747 Ga0495607_0049141
748 Ga0495607_0257901
749 Ga0495583_0063478
750 Ga0495583_0117772
751 Ga0495583_0220997
752 Ga0495606_0065169
753 Ga0495608_0002517
754 Ga0495610_0015701
755 Ga0495610_0107265
756 Ga0495616_0002920
757 Ga0495618_0011263
758 Ga0495620_0027034
759 Ga0495620_0046655
760 Ga0495628_0252142
761 Ga0495628_0713300
762 Ga0495630_0046223
763 Ga0495630_0514961
764 Ga0495630_0808647
765 Ga0495631_0002725
766 Ga0495632_0099907
767 Ga0495637_0290725
768 Ga0495643_0014232
769 Ga0495644_0014593
770 Ga0495648_0031467
771 Ga0495648_0178709
772 Ga0495666_0007611
773 Ga0495666_0127147
774 Ga0495666_0191762
775 Ga0495666_0330210
776 Ga0495642_0029307
777 Ga0495652_0100979
778 Ga0495652_0136534
779 Ga0495654_0136368
780 Ga0495665_0029659
781 Ga0495640_0018553
782 Ga0495640_0024854
783 Ga0495640_0064716
784 Ga0495640_0855775
785 Ga0495586_0005855
786 Ga0495586_0014574
787 Ga0495586_0335365
788 Ga0495587_0006149
789 Ga0495587_0217301
790 Ga0495609_0022763
791 Ga0495609_0152469
792 Ga0495597_0063307
793 Ga0495597_0072069
794 Ga0495645_0010639
795 Ga0495645_0011236
796 Ga0495645_0049459
797 Ga0495622_0129220
798 Ga0495622_0168557
799 Ga0495622_0351915
800 Ga0495633_0073868
801 Ga0495633_0557024
802 Ga0495667_0067359
803 Ga0495667_0243022
804 Ga0495667_0332319
805 Ga0495667_0337079
806 Ga0495668_0030665
807 Ga0495668_0109831
808 Ga0495634_0024770
809 Ga0495634_0046032
810 Ga0495634_0251654
811 Ga0495611_0080568
812 Ga0495611_0244115
813 Ga0495625_0048503
814 Ga0495625_0351886
815 Ga0495625_0426454
816 Ga0495625_0755626
817 Ga0495635_0000602
818 Ga0495635_0708543
819 Ga0495635_0846643
820 Ga0495661_0011402
821 Ga0495661_0471294
822 Ga0495588_0001017
823 Ga0495588_0095097
824 Ga0495657_0002328
825 Ga0495657_0029097
826 Ga0495657_0033412
827 Ga0495657_0126942
828 Ga0495657_0575943
829 Ga0495599_0061868
830 Ga0495623_0003588
831 Ga0495623_0132528
832 Ga0495646_0000580
833 Ga0495646_0060910
834 Ga0495646_0280471
835 Ga0495613_0001160
836 Ga0495613_0030403
837 Ga0495613_0039696
838 Ga0495613_0088993
839 Ga0495613_0092735
840 Ga0495613_0138838
841 Ga0495613_0266886
842 Ga0495613_0524450
843 Ga0495624_0110017
844 Ga0495624_0387452
845 Ga0495670_0009954
846 Ga0495670_0334936
847 Ga0495671_0029592
848 Ga0495671_0123050
849 Ga0495671_0205003
850 Ga0495649_0294848
851 Ga0495649_0324052
852 Ga0495649_0415242
853 Ga0495589_0004814
854 Ga0495589_0016940
855 Ga0495589_0017929
856 Ga0495589_0031809
857 Ga0495589_0055418
858 Ga0495589_0148862
859 Ga0495589_0165127
860 Ga0495600_0010174
861 Ga0495600_0074304
862 Ga0495600_0119851
863 Ga0495600_0275362
864 Ga0495660_0029829
865 Ga0495660_0101813
866 Ga0495581_0071220
867 Ga0495581_0295981
868 Ga0495581_0328696
869 Ga0495581_0628968
870 Ga0495604_0004107
871 Ga0495604_0004679
872 Ga0495604_0050783
873 Ga0495604_0315780
874 Ga0495604_0403008
875 Ga0495636_0012221
876 Ga0495636_0028092
877 Ga0495636_0035241
878 Ga0495636_0035939
879 Ga0495674_0233786
880 Ga0495674_0379847
881 Ga0495672_0040614
882 Ga0495676_0070295
883 Ga0495676_0113601
884 Ga0495680_0258310
885 Ga0495683_0080272
886 Ga0495683_0082568
887 Ga0495683_0104881
888 Ga0495683_0417402
889 Ga0495687_002133
890 Ga0495687_016978
891 Ga0495687_063304
892 Ga0495687_104502
893 Ga0495687_214968
894 Ga0495687_266935
895 Ga0495675_0006994
896 Ga0495675_0041550
897 Ga0495675_0131528
898 Ga0495675_0235023
899 Ga0495675_0244329
900 Ga0495675_0622046
901 Ga0495677_0071612
902 Ga0495677_0114980
903 Ga0495679_063879
904 Ga0495685_010733
905 Ga0495685_017478
906 Ga0495685_018023
907 Ga0495685_041256
908 Ga0495673_0121365
909 Ga0495681_0023501
910 Ga0495681_0081074
911 Ga0495684_0386667
912 Ga0495684_0512327
913 Ga0495686_0420021
914 Ga0495593_0000360
915 Ga0495593_0037594
916 Ga0495593_0042987
917 Ga0495593_0576764
918 Ga0495602_0013430
919 Ga0495602_0078972
920 Ga0495614_0006245
921 Ga0495614_0043208
922 Ga0495614_0181658
923 Ga0495614_0183619
924 Ga0495626_0096889
925 Ga0495626_0143475
926 Ga0495626_0213179
927 Ga0496102_1690251
928 Ga0496105_0642297
929 Ga0496109_0028010
930 Ga0496110_0544753
931 Ga0496113_0438554
932 Ga0496125_0660725
933 Ga0495678_008311
934 Ga0495682_0014494
935 Ga0501031_0260762
936 Ga0501031_0306278
937 Ga0501032_0430186
938 Ga0501033_0002071
939 Ga0501033_0025930
940 Ga0501033_0045565
941 Ga0501034_0015782
942 Ga0501034_0330296
943 Ga0501034_1354145
944 Ga0501036_0002995
945 Ga0501036_0081023
946 Ga0501036_1630736
947 Ga0501037_0020763
948 Ga0501037_0070595
949 Ga0501037_0526868
950 Ga0501038_0064490
951 Ga0501038_0095960
952 Ga0501038_0595203
953 Ga0501043_0027864
954 Ga0501043_1321789
955 Ga0501047_0000148
956 Ga0501047_0073640
957 Ga0501047_0366059
958 Ga0501048_0892057
959 Ga0501068_0101323
960 Ga0501068_0450954
961 Ga0501069_0764426
962 Ga0501069_0941099
963 Ga0501070_0040550
964 Ga0501070_0203953
965 Ga0501070_0691018
966 Ga0501072_0135966
967 Ga0501074_0026890
968 Ga0501216_006218
969 Ga0501235_052145
970 Ga0501235_061463
971 Ga0501252_092140
972 Ga0501257_170566
973 Ga0501079_1290501
974 Ga0501035_0041908
975 Ga0501035_0065054
976 Ga0501035_0103603
977 Ga0501035_0786167
978 Ga0501035_0990329
979 Ga0501035_1289380
980 Ga0501044_0010468
981 Ga0501044_0298341
982 Ga0501044_1051984
983 Ga0501044_1404768
984 Ga0501045_0084933
985 nmdc:mga03n38_6252_c1
986 nmdc:mga04h51_544816_c1
987 nmdc:mga07m45_16611_c1
988 Ga0500610_0221661
989 Ga0495655_0067522
990 Ga0495619_0027791
991 Ga0495619_0272803
992 Ga0500644_0030424
993 Ga0500644_0054281
994 Ga0500583_0409519
995 Ga0500651_0407309
996 Ga0500640_070445
997 Ga0500650_0174773
998 Ga0500660_101229
999 Ga0500558_155363
1000 Ga0500560_005813
1001 Ga0500560_010267
1002 Ga0500572_013379
1003 Ga0500608_059907
1004 Ga0500652_164106
1005 Ga0500573_0045437
1006 Ga0500573_0054946
1007 Ga0500600_0041832
1008 Ga0500600_0101045
1009 Ga0500600_0154424
1010 Ga0500624_041072
1011 Ga0500634_0104823
1012 Ga0500636_0158367
1013 Ga0466962_0000163
1014 Ga0466962_0026662
1015 Ga0466962_0135172
1016 2547405974
1017 2585314439
1018 2616700244
1019 2643947800
1020 2644018484
1021 2644177519
1022 2644262978
1023 2644390759
1024 2644405747
1025 2644433665
1026 2644443201
1027 2644626984
1028 2784588912
1029 2785342968
1030 2785369863
1031 2808842358
1032 2808920882
1033 2809232531
1034 2812357746
1035 2852637131
1036 2862285980
1037 2862389632
1038 2862508021
1039 2862578933
1040 2863404233
1041 2873155416
1042 2877680768
1043 2912719513
1044 2912731338
1045 2912761179
1046 2918505247
1047 2919471965
1048 2946068125
1049 2946076217
1050 2954385873
1051 2954696532
1052 2954705754
1053 2995471573
1054 3006393918
1055 8008566928
1056 8008578599
1057 8023624061
1058 8025478599
1059 8025534270
1060 8048409460
1061 8056447542
1062 8056833355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07876

Dabb

Stress responsive A/B Barrel Domain

20

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bgu-assembly1.cif.gz_A crystal structure of a dimeric ferredoxin-like protein of unknown function (tfu_0763) from thermobifida fusca yx at 1.50 a resolution 0.8875 2 97
3bgu-assembly1.cif.gz_A crystal structure of a dimeric ferredoxin-like protein of unknown function (tfu_0763) from thermobifida fusca yx at 1.50 a resolution 0.8624 2 97
3fmb-assembly1.cif.gz_B crystal structure of dimeric protein of unknown function and ferredoxin-like fold (yp_212648.1) from bacteroides fragilis nctc 9343 at 1.85 a resolution 0.8614 2 97
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.8491 1 97
3fmb-assembly1.cif.gz_B crystal structure of dimeric protein of unknown function and ferredoxin-like fold (yp_212648.1) from bacteroides fragilis nctc 9343 at 1.85 a resolution 0.8453 2 97
ID Description Score Start End Superfamily
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9114 1 97 3.30.70.100
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9026 1 97 3.30.70.100
af_A0A1D6PLI0_180_283_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8681 2 95 3.30.70.100
af_C0HHH9_33_145_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8637 2 97 3.30.70.100
af_I1LY42_1_101_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8612 2 95 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A0M9ZIC4-F1-model_v4 Stress-response A/B barrel domain-containing protein 0.9802 2 97
AF-A0A6M1S7J0-F1-model_v4 Dabb family protein 0.9769 1 96
AF-A0A6B3HTS5-F1-model_v4 Dabb family protein 0.9748 7 89
AF-A0A2U9P3V2-F1-model_v4 Stress-response A/B barrel domain-containing protein 0.9737 1 97
AF-A0A0B9GD70-F1-model_v4 Stress responsive protein 0.9735 1 96

Map