F460134

General Info

Members Datasets Scaffolds Average Seq Length
531 185 1062 84

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10007112|Ga0157380_100071126
Length 94
Sequence LGNKGGEIMPVSEQPLVERIARVLAGAALSSNAEGSDPSAGEKVDMAWREHLNQALAVLHTMREPDDRMAAAGDPDNWARMVKAAIEEAEATAE

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
110 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
111 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
112 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
113 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
144 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
145 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.46
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 13.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10007112 3300014326 Bacteria 7929
2 MBSR1b_contig_10832106 2162886012 Bacteria 1010
3 MBSR1b_contig_624375 2162886012 Bacteria 1236
4 MBSR1b_contig_7366601 2162886012 Bacteria 977
5 JGI24741J21665_1016584 3300001915 Bacteria 1201
6 JGI24739J22299_10096239 3300001989 Bacteria 897
7 JGI24737J22298_10010906 3300001990 Bacteria 2985
8 JGI24735J21928_10050130 3300002067 Bacteria 1206
9 JGI24033J26618_1008505 3300002155 Bacteria 1182
10 Ga0065715_10414709 3300005293 Unclassified 865
11 Ga0070658_10017779 3300005327 Bacteria 5686
12 Ga0070658_10097338 3300005327 Bacteria 2430
13 Ga0070658_10277026 3300005327 Bacteria 1427
14 Ga0070658_10281012 3300005327 Bacteria 1417
15 Ga0070658_10315696 3300005327 Bacteria 1334
16 Ga0070658_10344487 3300005327 Bacteria 1275
17 Ga0070658_10368744 3300005327 Bacteria 1231
18 Ga0070658_11327976 3300005327 Bacteria 624
19 Ga0070676_10055919 3300005328 Bacteria 2330
20 Ga0070683_100234514 3300005329 Bacteria 1744
21 Ga0070683_100308877 3300005329 Bacteria 1504
22 Ga0070683_101747430 3300005329 Bacteria 598
23 Ga0070670_100003353 3300005331 Bacteria 13264
24 Ga0070670_100023833 3300005331 Bacteria 5266
25 Ga0070677_10003713 3300005333 Bacteria 4939
26 Ga0070677_10289040 3300005333 Bacteria 829
27 Ga0070666_10258917 3300005335 Unclassified 1233
28 Ga0070666_10987781 3300005335 Unclassified 624
29 Ga0070680_100057503 3300005336 Bacteria 3179
30 Ga0070682_100623300 3300005337 Bacteria 855
31 Ga0068868_100001303 3300005338 Bacteria 17189
32 Ga0070660_100003580 3300005339 Bacteria 10722
33 Ga0070660_100119302 3300005339 Unclassified 2104
34 Ga0070660_100286473 3300005339 Bacteria 1348
35 Ga0070660_100602213 3300005339 Bacteria 919
36 Ga0070660_101055880 3300005339 Bacteria 687
37 Ga0070661_100317282 3300005344 Unclassified 1217
38 Ga0070661_100454107 3300005344 Bacteria 1020
39 Ga0070661_101398013 3300005344 Bacteria 589
40 Ga0070692_10191962 3300005345 Bacteria 1191
41 Ga0070692_10630099 3300005345 Bacteria 713
42 Ga0070668_100023278 3300005347 Bacteria 4685
43 Ga0070668_100038240 3300005347 Bacteria 3667
44 Ga0070668_100204503 3300005347 Bacteria 1622
45 Ga0070668_100552466 3300005347 Bacteria 1002
46 Ga0070668_101166560 3300005347 Unclassified 697
47 Ga0070669_100042414 3300005353 Bacteria 3311
48 Ga0070669_100081250 3300005353 Bacteria 2414
49 Ga0070669_100226832 3300005353 Bacteria 1479
50 Ga0070669_100330879 3300005353 Bacteria 1232
51 Ga0070669_100451777 3300005353 Bacteria 1059
52 Ga0070675_100008239 3300005354 Bacteria 8085
53 Ga0070675_100009913 3300005354 Bacteria 7429
54 Ga0070671_100000786 3300005355 Bacteria 22862
55 Ga0070671_100004804 3300005355 Bacteria 10743
56 Ga0070671_100038208 3300005355 Bacteria 3985
57 Ga0070671_100109114 3300005355 Bacteria 2324
58 Ga0070671_100152512 3300005355 Bacteria 1951
59 Ga0070671_100821430 3300005355 Bacteria 810
60 Ga0070674_100058124 3300005356 Bacteria 2687
61 Ga0070674_100294566 3300005356 Bacteria 1291
62 Ga0070673_100002110 3300005364 Bacteria 12019
63 Ga0070673_100057523 3300005364 Bacteria 3072
64 Ga0070673_100181255 3300005364 Bacteria 1803
65 Ga0070673_100235037 3300005364 Bacteria 1591
66 Ga0070673_100541706 3300005364 Bacteria 1056
67 Ga0070673_100590500 3300005364 Bacteria 1012
68 Ga0070673_101236276 3300005364 Unclassified 700
69 Ga0070659_100191710 3300005366 Bacteria 1680
70 Ga0070659_100257607 3300005366 Bacteria 1447
71 Ga0070659_100426859 3300005366 Bacteria 1122
72 Ga0070659_100474142 3300005366 Bacteria 1064
73 Ga0070659_100516459 3300005366 Bacteria 1019
74 Ga0070659_100793669 3300005366 Bacteria 823
75 Ga0070659_100948053 3300005366 Bacteria 754
76 Ga0070667_100014916 3300005367 Bacteria 6418
77 Ga0070667_100159125 3300005367 Unclassified 1988
78 Ga0070714_100107346 3300005435 Bacteria 2467
79 Ga0070714_100358403 3300005435 Bacteria 1371
80 Ga0070714_101636320 3300005435 Bacteria 629
81 Ga0070663_100072026 3300005455 Bacteria 2516
82 Ga0070663_100759623 3300005455 Bacteria 828
83 Ga0070663_101325487 3300005455 Bacteria 636
84 Ga0070678_100763541 3300005456 Unclassified 875
85 Ga0070662_100011604 3300005457 Bacteria 5815
86 Ga0070662_100157717 3300005457 Bacteria 1773
87 Ga0070662_100188726 3300005457 Bacteria 1628
88 Ga0070662_100268847 3300005457 Unclassified 1376
89 Ga0070662_100330448 3300005457 Bacteria 1245
90 Ga0070662_101729368 3300005457 Unclassified 540
91 Ga0070681_10337076 3300005458 Bacteria 1417
92 Ga0070681_11254219 3300005458 Bacteria 664
93 Ga0070681_11613979 3300005458 Unclassified 574
94 Ga0068867_102147099 3300005459 Bacteria 529
95 Ga0070679_100394156 3300005530 Bacteria 1331
96 Ga0070679_100491411 3300005530 Bacteria 1171
97 Ga0070679_100695454 3300005530 Bacteria 959
98 Ga0070684_100474990 3300005535 Bacteria 1157
99 Ga0070684_100681324 3300005535 Bacteria 958
100 Ga0070684_101799814 3300005535 Bacteria 578
101 Ga0070672_100027982 3300005543 Bacteria 4211
102 Ga0070672_100038444 3300005543 Bacteria 3657
103 Ga0070672_100049285 3300005543 Bacteria 3276
104 Ga0070672_100991838 3300005543 Bacteria 744
105 Ga0068855_100086177 3300005563 Bacteria 3632
106 Ga0068855_100467389 3300005563 Bacteria 1374
107 Ga0068855_101188662 3300005563 Unclassified 793
108 Ga0070664_100006716 3300005564 Bacteria 9279
109 Ga0070664_100085131 3300005564 Bacteria 2730
110 Ga0070664_100252594 3300005564 Bacteria 1585
111 Ga0068857_100473193 3300005577 Bacteria 1173
112 Ga0068857_101596788 3300005577 Bacteria 637
113 Ga0068854_100175191 3300005578 Bacteria 1671
114 Ga0068854_100391863 3300005578 Bacteria 1147
115 Ga0068856_100107395 3300005614 Bacteria 2786
116 Ga0068856_100136244 3300005614 Bacteria 2460
117 Ga0068856_100195537 3300005614 Bacteria 2036
118 Ga0068856_100630716 3300005614 Bacteria 1092
119 Ga0068856_100804701 3300005614 Bacteria 959
120 Ga0068856_101743814 3300005614 Bacteria 635
121 Ga0068852_100105826 3300005616 Bacteria 2549
122 Ga0068852_100254587 3300005616 Bacteria 1683
123 Ga0068852_100308068 3300005616 Bacteria 1535
124 Ga0068852_101547704 3300005616 Bacteria 685
125 Ga0068852_101768675 3300005616 Bacteria 640
126 Ga0068864_100071021 3300005618 Bacteria 3031
127 Ga0068864_100080976 3300005618 Bacteria 2846
128 Ga0068851_10119691 3300005834 Bacteria 1414
129 Ga0068851_10478428 3300005834 Unclassified 744
130 Ga0068870_10476721 3300005840 Bacteria 827
131 Ga0068863_100187865 3300005841 Bacteria 1985
132 Ga0068863_100217282 3300005841 Bacteria 1841
133 Ga0068858_100299886 3300005842 Bacteria 1533
134 Ga0068862_100569486 3300005844 Bacteria 1084
135 Ga0068862_101297110 3300005844 Unclassified 729
136 Ga0081539_10025630 3300005985 Bacteria 3791
137 Ga0081539_10311833 3300005985 Bacteria 672
138 Ga0070716_100892645 3300006173 Bacteria 695
139 Ga0097621_100781016 3300006237 Unclassified 884
140 Ga0105245_10101191 3300009098 Bacteria 2667
141 Ga0105248_10001480 3300009177 Bacteria 26140
142 Ga0105248_10020641 3300009177 Bacteria 7300
143 Ga0105248_10288120 3300009177 Bacteria 1849
144 Ga0105248_10501768 3300009177 Bacteria 1368
145 Ga0105238_12890406 3300009551 Bacteria 516
146 Ga0157373_10095603 3300013100 Bacteria 2091
147 Ga0157373_10289450 3300013100 Bacteria 1162
148 Ga0157373_10362652 3300013100 Bacteria 1035
149 Ga0157371_10140990 3300013102 Bacteria 1717
150 Ga0157371_10293450 3300013102 Bacteria 1176
151 Ga0157371_11060467 3300013102 Bacteria 620
152 Ga0157371_11160501 3300013102 Bacteria 594
153 Ga0157371_11263247 3300013102 Bacteria 570
154 Ga0157370_10029958 3300013104 Bacteria 5334
155 Ga0157370_10336402 3300013104 Bacteria 1392
156 Ga0157369_10164346 3300013105 Bacteria 2342
157 Ga0157369_10179075 3300013105 Bacteria 2231
158 Ga0157369_10575306 3300013105 Bacteria 1163
159 Ga0157369_10917136 3300013105 Unclassified 898
160 Ga0157374_10753655 3300013296 Unclassified 988
161 Ga0157374_11694279 3300013296 Unclassified 657
162 Ga0157374_12725660 3300013296 Bacteria 522
163 Ga0157372_10681352 3300013307 Bacteria 1197
164 Ga0157372_10860195 3300013307 Bacteria 1052
165 Ga0157372_11021809 3300013307 Bacteria 957
166 Ga0157372_12622871 3300013307 Bacteria 578
167 Ga0157375_12391638 3300013308 Unclassified 630
168 Ga0163163_11078937 3300014325 Unclassified 866
169 Ga0163161_10603502 3300017792 Unclassified 905
170 Ga0206353_10277897 3300020082 Bacteria 516
171 Ga0206353_11061649 3300020082 Bacteria 570
172 Ga0206353_11951677 3300020082 Bacteria 506
173 Ga0207697_10169126 3300025315 Bacteria 955
174 Ga0207682_10006331 3300025893 Bacteria 4777
175 Ga0207682_10059228 3300025893 Unclassified 1600
176 Ga0207680_10761544 3300025903 Bacteria 694
177 Ga0207680_11047133 3300025903 Unclassified 584
178 Ga0207647_10015520 3300025904 Bacteria 5218
179 Ga0207647_10141884 3300025904 Bacteria 1408
180 Ga0207647_10227050 3300025904 Bacteria 1075
181 Ga0207645_10057854 3300025907 Bacteria 2475
182 Ga0207643_10153572 3300025908 Bacteria 1382
183 Ga0207705_10005168 3300025909 Bacteria 9783
184 Ga0207705_10105750 3300025909 Bacteria 2075
185 Ga0207705_10267648 3300025909 Unclassified 1306
186 Ga0207705_10529102 3300025909 Bacteria 916
187 Ga0207705_10539306 3300025909 Bacteria 907
188 Ga0207705_10625195 3300025909 Unclassified 837
189 Ga0207654_10581413 3300025911 Bacteria 798
190 Ga0207707_10340788 3300025912 Bacteria 1292
191 Ga0207707_11199812 3300025912 Bacteria 614
192 Ga0207660_10046816 3300025917 Bacteria 3054
193 Ga0207657_10003514 3300025919 Bacteria 16739
194 Ga0207657_10078027 3300025919 Bacteria 2790
195 Ga0207657_10143463 3300025919 Bacteria 1950
196 Ga0207657_10493834 3300025919 Bacteria 959
197 Ga0207649_10099591 3300025920 Bacteria 1921
198 Ga0207649_10117691 3300025920 Bacteria 1786
199 Ga0207649_10586487 3300025920 Bacteria 856
200 Ga0207649_10681377 3300025920 Unclassified 796
201 Ga0207652_10004701 3300025921 Bacteria 11073
202 Ga0207652_10818619 3300025921 Bacteria 826
203 Ga0207681_10027634 3300025923 Bacteria 3670
204 Ga0207681_10141027 3300025923 Bacteria 1795
205 Ga0207681_10657350 3300025923 Bacteria 869
206 Ga0207681_11480334 3300025923 Bacteria 569
207 Ga0207650_10005211 3300025925 Bacteria 8865
208 Ga0207650_10011226 3300025925 Bacteria 6161
209 Ga0207659_10014129 3300025926 Bacteria 5141
210 Ga0207659_10017850 3300025926 Bacteria 4643
211 Ga0207687_10008131 3300025927 Bacteria 6866
212 Ga0207700_10228349 3300025928 Bacteria 1581
213 Ga0207664_10106237 3300025929 Bacteria 2327
214 Ga0207664_10524092 3300025929 Bacteria 1062
215 Ga0207664_10642831 3300025929 Bacteria 953
216 Ga0207644_10007685 3300025931 Bacteria 7034
217 Ga0207644_10027683 3300025931 Bacteria 3917
218 Ga0207644_10077616 3300025931 Bacteria 2446
219 Ga0207644_10174282 3300025931 Bacteria 1681
220 Ga0207644_10710791 3300025931 Bacteria 838
221 Ga0207690_10085679 3300025932 Bacteria 2212
222 Ga0207690_10231089 3300025932 Bacteria 1420
223 Ga0207690_10311536 3300025932 Bacteria 1235
224 Ga0207690_10332648 3300025932 Bacteria 1197
225 Ga0207690_11563915 3300025932 Bacteria 551
226 Ga0207706_10012521 3300025933 Bacteria 7726
227 Ga0207706_10062518 3300025933 Bacteria 3279
228 Ga0207706_10078494 3300025933 Bacteria 2903
229 Ga0207706_10191091 3300025933 Bacteria 1797
230 Ga0207706_10200316 3300025933 Bacteria 1751
231 Ga0207669_10034813 3300025937 Bacteria 2858
232 Ga0207691_10006849 3300025940 Bacteria 11000
233 Ga0207691_10065551 3300025940 Bacteria 3287
234 Ga0207691_10119035 3300025940 Bacteria 2342
235 Ga0207691_10830441 3300025940 Bacteria 775
236 Ga0207711_10003298 3300025941 Bacteria 14027
237 Ga0207711_10195971 3300025941 Bacteria 1842
238 Ga0207661_10541358 3300025944 Bacteria 1066
239 Ga0207679_10061351 3300025945 Bacteria 2799
240 Ga0207679_10228754 3300025945 Bacteria 1569
241 Ga0207679_10253019 3300025945 Bacteria 1499
242 Ga0207679_10484959 3300025945 Bacteria 1101
243 Ga0207679_10703468 3300025945 Bacteria 917
244 Ga0207667_10342134 3300025949 Bacteria 1526
245 Ga0207667_10975206 3300025949 Bacteria 836
246 Ga0207667_11518988 3300025949 Bacteria 640
247 Ga0207651_10094761 3300025960 Bacteria 2196
248 Ga0207651_10154109 3300025960 Unclassified 1793
249 Ga0207651_11053283 3300025960 Unclassified 728
250 Ga0207651_11294738 3300025960 Unclassified 655
251 Ga0207651_11925990 3300025960 Unclassified 531
252 Ga0207668_10076534 3300025972 Bacteria 2410
253 Ga0207668_10148229 3300025972 Bacteria 1813
254 Ga0207640_10564348 3300025981 Bacteria 958
255 Ga0207640_10760396 3300025981 Bacteria 836
256 Ga0207640_11060269 3300025981 Bacteria 715
257 Ga0207658_10037774 3300025986 Bacteria 3473
258 Ga0207658_10344955 3300025986 Bacteria 1295
259 Ga0207677_10001069 3300026023 Bacteria 14951
260 Ga0207703_10365903 3300026035 Unclassified 1331
261 Ga0207639_11384492 3300026041 Bacteria 660
262 Ga0207678_10069119 3300026067 Bacteria 3029
263 Ga0207678_10611171 3300026067 Bacteria 956
264 Ga0207678_10950995 3300026067 Bacteria 760
265 Ga0207678_11837682 3300026067 Unclassified 530
266 Ga0207702_10053588 3300026078 Bacteria 3415
267 Ga0207702_11047998 3300026078 Bacteria 809
268 Ga0207702_11255736 3300026078 Bacteria 735
269 Ga0207702_11287397 3300026078 Unclassified 725
270 Ga0207702_11426545 3300026078 Bacteria 686
271 Ga0207641_10428905 3300026088 Unclassified 1274
272 Ga0207641_11066768 3300026088 Unclassified 806
273 Ga0207676_10001631 3300026095 Bacteria 16530
274 Ga0207676_10014881 3300026095 Bacteria 5604
275 Ga0207674_10147053 3300026116 Bacteria 2315
276 Ga0207674_10586373 3300026116 Bacteria 1077
277 Ga0207698_10002612 3300026142 Bacteria 10711
278 Ga0207698_10352127 3300026142 Bacteria 1391
279 Ga0207698_10421734 3300026142 Bacteria 1280
280 Ga0207698_12047476 3300026142 Unclassified 586
281 Ga0268266_10032037 3300028379 Bacteria 4466
282 Ga0268265_11101474 3300028380 Bacteria 788
283 Ga0316177_1127391 3300030731 Bacteria 557
284 Ga0316176_1185156 3300030732 Bacteria 585
285 Ga0314311_1192309 3300030733 Bacteria 571
286 Ga0316183_1160448 3300030742 Bacteria 839
287 Ga0316182_1047200 3300030745 Bacteria 3118
288 Ga0316182_1114491 3300030745 Bacteria 4811
289 Ga0307408_100015095 3300031548 Bacteria 5140
290 Ga0307408_100055728 3300031548 Bacteria 2863
291 Ga0307408_100515230 3300031548 Bacteria 1049
292 Ga0307408_100838217 3300031548 Bacteria 837
293 Ga0307408_101070121 3300031548 Bacteria 747
294 Ga0307408_101743769 3300031548 Bacteria 594
295 Ga0307408_101837443 3300031548 Bacteria 580
296 Ga0307408_101885983 3300031548 Bacteria 573
297 Ga0307405_10037022 3300031731 Bacteria 2929
298 Ga0307405_10109823 3300031731 Bacteria 1866
299 Ga0307405_10194875 3300031731 Bacteria 1466
300 Ga0307405_10531172 3300031731 Bacteria 948
301 Ga0307405_10685387 3300031731 Bacteria 847
302 Ga0307405_11730550 3300031731 Bacteria 554
303 Ga0307413_10034661 3300031824 Bacteria 2887
304 Ga0307413_10048181 3300031824 Bacteria 2545
305 Ga0307413_10131649 3300031824 Bacteria 1713
306 Ga0307413_10172479 3300031824 Bacteria 1532
307 Ga0307413_10209168 3300031824 Bacteria 1415
308 Ga0307413_10375312 3300031824 Unclassified 1106
309 Ga0307413_10594824 3300031824 Unclassified 904
310 Ga0307413_10598975 3300031824 Bacteria 902
311 Ga0307413_10687454 3300031824 Bacteria 848
312 Ga0307413_10743860 3300031824 Unclassified 819
313 Ga0307413_10786265 3300031824 Bacteria 798
314 Ga0307410_10000253 3300031852 Bacteria 20310
315 Ga0307410_10005837 3300031852 Bacteria 6571
316 Ga0307410_10014235 3300031852 Bacteria 4673
317 Ga0307410_10025855 3300031852 Bacteria 3688
318 Ga0307410_10050173 3300031852 Bacteria 2804
319 Ga0307410_10051409 3300031852 Bacteria 2777
320 Ga0307410_10085458 3300031852 Bacteria 2226
321 Ga0307410_10127106 3300031852 Bacteria 1867
322 Ga0307410_10144274 3300031852 Bacteria 1765
323 Ga0307410_10176881 3300031852 Bacteria 1613
324 Ga0307410_10186978 3300031852 Bacteria 1572
325 Ga0307410_10195812 3300031852 Bacteria 1540
326 Ga0307410_10206958 3300031852 Bacteria 1501
327 Ga0307410_10284316 3300031852 Bacteria 1299
328 Ga0307410_10725994 3300031852 Bacteria 839
329 Ga0307410_11467428 3300031852 Unclassified 600
330 Ga0307406_10026211 3300031901 Bacteria 3498
331 Ga0307406_10077004 3300031901 Bacteria 2205
332 Ga0307406_10144525 3300031901 Bacteria 1688
333 Ga0307406_10221241 3300031901 Bacteria 1407
334 Ga0307406_10666245 3300031901 Bacteria 865
335 Ga0307406_10800459 3300031901 Bacteria 795
336 Ga0307407_10037283 3300031903 Bacteria 2685
337 Ga0307407_10064631 3300031903 Bacteria 2151
338 Ga0307407_10111104 3300031903 Bacteria 1720
339 Ga0307407_10197750 3300031903 Bacteria 1345
340 Ga0307407_10694632 3300031903 Bacteria 766
341 Ga0307412_10019300 3300031911 Bacteria 4124
342 Ga0307412_10026273 3300031911 Bacteria 3617
343 Ga0307412_10049634 3300031911 Bacteria 2766
344 Ga0307412_10168908 3300031911 Bacteria 1634
345 Ga0307412_10281147 3300031911 Unclassified 1307
346 Ga0307412_10323232 3300031911 Bacteria 1228
347 Ga0307412_10389195 3300031911 Bacteria 1131
348 Ga0307412_10859931 3300031911 Bacteria 792
349 Ga0307409_100002661 3300031995 Bacteria 9405
350 Ga0307409_100003038 3300031995 Bacteria 8968
351 Ga0307409_100027457 3300031995 Bacteria 4034
352 Ga0307409_100067162 3300031995 Bacteria 2830
353 Ga0307409_100074159 3300031995 Bacteria 2718
354 Ga0307409_100084573 3300031995 Unclassified 2576
355 Ga0307409_100174684 3300031995 Bacteria 1895
356 Ga0307409_100299773 3300031995 Bacteria 1494
357 Ga0307409_100316828 3300031995 Bacteria 1458
358 Ga0307409_100356525 3300031995 Bacteria 1382
359 Ga0307409_100592307 3300031995 Bacteria 1094
360 Ga0307409_101105274 3300031995 Bacteria 814
361 Ga0307409_101846853 3300031995 Bacteria 633
362 Ga0307409_101866376 3300031995 Bacteria 630
363 Ga0307409_102287959 3300031995 Bacteria 570
364 Ga0307409_102517345 3300031995 Bacteria 543
365 Ga0307409_102935321 3300031995 Bacteria 503
366 Ga0307416_100000898 3300032002 Bacteria 15720
367 Ga0307416_100021383 3300032002 Bacteria 4644
368 Ga0307416_100067904 3300032002 Bacteria 2943
369 Ga0307416_100158545 3300032002 Bacteria 2087
370 Ga0307416_100169620 3300032002 Bacteria 2029
371 Ga0307416_100356096 3300032002 Bacteria 1483
372 Ga0307416_100776521 3300032002 Bacteria 1052
373 Ga0307416_100784638 3300032002 Bacteria 1047
374 Ga0307416_101441092 3300032002 Bacteria 794
375 Ga0307416_101962669 3300032002 Bacteria 688
376 Ga0307414_10045679 3300032004 Bacteria 3001
377 Ga0307414_10117416 3300032004 Unclassified 2038
378 Ga0307414_10150190 3300032004 Bacteria 1837
379 Ga0307414_10151431 3300032004 Bacteria 1830
380 Ga0307414_10171252 3300032004 Bacteria 1736
381 Ga0307414_10175148 3300032004 Bacteria 1719
382 Ga0307414_10286752 3300032004 Bacteria 1386
383 Ga0307414_10640097 3300032004 Bacteria 957
384 Ga0307414_11249557 3300032004 Unclassified 688
385 Ga0307414_12070020 3300032004 Unclassified 531
386 Ga0307411_10009106 3300032005 Bacteria 5195
387 Ga0307411_10021259 3300032005 Bacteria 3792
388 Ga0307411_10041438 3300032005 Bacteria 2929
389 Ga0307411_10042343 3300032005 Bacteria 2904
390 Ga0307411_10082601 3300032005 Bacteria 2216
391 Ga0307411_10088029 3300032005 Bacteria 2159
392 Ga0307411_10089069 3300032005 Bacteria 2148
393 Ga0307411_10105532 3300032005 Bacteria 2003
394 Ga0307411_10186662 3300032005 Bacteria 1579
395 Ga0307411_10658687 3300032005 Bacteria 907
396 Ga0307411_11093009 3300032005 Bacteria 718
397 Ga0307411_11227728 3300032005 Bacteria 680
398 Ga0307411_11543211 3300032005 Unclassified 611
399 Ga0307411_12105195 3300032005 Bacteria 528
400 Ga0307415_100000198 3300032126 Bacteria 26693
401 Ga0307415_100031044 3300032126 Bacteria 3437
402 Ga0307415_100037484 3300032126 Bacteria 3187
403 Ga0307415_100065261 3300032126 Bacteria 2536
404 Ga0307415_100103194 3300032126 Bacteria 2097
405 Ga0307415_100137465 3300032126 Bacteria 1861
406 Ga0307415_100146369 3300032126 Unclassified 1812
407 Ga0307415_100210554 3300032126 Bacteria 1550
408 Ga0307415_100242251 3300032126 Unclassified 1459
409 Ga0307415_100665509 3300032126 Bacteria 935
410 Ga0307415_101135255 3300032126 Bacteria 733
411 Ga0373923_0020471 3300035111 Bacteria 2571
412 Ga0373953_0093263 3300035117 Bacteria 1261
413 Ga0373954_0066962 3300035118 Unclassified 1701
414 Ga0373957_0076542 3300035120 Unclassified 1316
415 Ga0373955_0008035 3300035172 Bacteria 4878
416 Ga0373937_0069570 3300036401 Bacteria 3245
417 Ga0373937_2032902 3300036401 Unclassified 521
418 Ga0395899_0003725 3300037312 Bacteria 12064
419 Ga0395899_0717261 3300037312 Unclassified 626
420 Ga0395900_0002988 3300037418 Bacteria 18402
421 Ga0395900_0828932 3300037418 Unclassified 852
422 Ga0395900_1165950 3300037418 Unclassified 686
423 Ga0395898_0016609 3300037466 Bacteria 7524
424 Ga0395898_0150413 3300037466 Bacteria 2228
425 Ga0395898_0940662 3300037466 Bacteria 801
426 Ga0395905_0020581 3300037471 Bacteria 6246
427 Ga0395905_0057040 3300037471 Bacteria 3653
428 Ga0395905_0197347 3300037471 Bacteria 1887
429 Ga0395905_1330538 3300037471 Bacteria 622
430 Ga0395905_1497513 3300037471 Bacteria 579
431 Ga0395901_1197711 3300038443 Bacteria 725
432 Ga0436365_0508469 3300039437 Bacteria 521
433 Ga0436362_0298474 3300039453 Unclassified 579
434 Ga0439439_0130100 3300041406 Bacteria 706
435 Ga0439439_0131673 3300041406 Bacteria 703
436 Ga0439445_0253159 3300042004 Bacteria 526
437 Ga0439432_181389 3300042006 Unclassified 613
438 Ga0439432_253359 3300042006 Bacteria 504
439 Ga0439449_0105888 3300042007 Bacteria 1041
440 Ga0439449_0151508 3300042007 Bacteria 865
441 Ga0439449_0276672 3300042007 Bacteria 632
442 Ga0439462_0017132 3300042015 Bacteria 1877
443 Ga0439462_0133810 3300042015 Bacteria 693
444 Ga0450898_154323 3300042134 Unclassified 504
445 Ga0450907_085151 3300042146 Bacteria 549
446 Ga0439446_0255296 3300042156 Unclassified 606
447 Ga0466969_0026792 3300044656 Bacteria 2955
448 Ga0466972_0342429 3300044658 Bacteria 699
449 Ga0466965_0473522 3300044683 Bacteria 700
450 Ga0466965_0581212 3300044683 Unclassified 635
451 Ga0466966_0015313 3300044684 Bacteria 5071
452 Ga0466966_0453474 3300044684 Bacteria 771
453 Ga0466966_0591500 3300044684 Bacteria 668
454 Ga0466963_0083211 3300044694 Bacteria 2170
455 Ga0466963_0155365 3300044694 Bacteria 1590
456 Ga0466963_0181913 3300044694 Bacteria 1468
457 Ga0466963_0231814 3300044694 Bacteria 1294
458 Ga0466963_0740829 3300044694 Bacteria 693
459 Ga0466971_0172636 3300044719 Bacteria 1015
460 Ga0466971_0220667 3300044719 Bacteria 898
461 Ga0466968_0510056 3300044735 Bacteria 600
462 Ga0466970_0250145 3300044765 Bacteria 993
463 Ga0466957_0040297 3300044842 Bacteria 2820
464 Ga0466957_0084310 3300044842 Bacteria 1983
465 Ga0466957_0572267 3300044842 Bacteria 789
466 Ga0466957_1243671 3300044842 Bacteria 539
467 Ga0466959_0060439 3300045049 Bacteria 2757
468 Ga0466959_1037879 3300045049 Bacteria 546
469 Ga0466959_1109848 3300045049 Bacteria 526
470 Ga0466958_0167979 3300045836 Bacteria 1389
471 Ga0466958_0924640 3300045836 Bacteria 569
472 Ga0466967_0053308 3300045976 Bacteria 3554
473 Ga0466967_0058759 3300045976 Bacteria 3400
474 Ga0466967_0119702 3300045976 Bacteria 2431
475 Ga0466967_0214122 3300045976 Bacteria 1828
476 Ga0466967_0328115 3300045976 Bacteria 1477
477 Ga0495585_0176838 3300046492 Bacteria 1099
478 Ga0495644_0360138 3300046523 Bacteria 573
479 Ga0495663_0017985 3300046525 Bacteria 2010
480 Ga0495663_0048466 3300046525 Bacteria 1310
481 Ga0495663_0313315 3300046525 Unclassified 567
482 Ga0495598_0410614 3300046537 Unclassified 531
483 Ga0495621_0065975 3300046539 Bacteria 1323
484 Ga0495621_0161549 3300046539 Bacteria 886
485 Ga0495633_0005406 3300046558 Bacteria 7823
486 Ga0495623_0154479 3300046679 Bacteria 1354
487 Ga0495669_0004302 3300046684 Bacteria 5875
488 Ga0495669_0018015 3300046684 Bacteria 3033
489 Ga0495669_0052232 3300046684 Bacteria 1835
490 Ga0495669_0110758 3300046684 Unclassified 1281
491 Ga0495670_0030654 3300046691 Bacteria 2671
492 Ga0495670_0059972 3300046691 Bacteria 1911
493 Ga0495677_0050116 3300047445 Bacteria 1536
494 Ga0495602_0292786 3300048088 Bacteria 1194
495 Ga0496100_0079159 3300048903 Bacteria 2214
496 Ga0496101_0228318 3300048904 Unclassified 1446
497 Ga0496101_0385389 3300048904 Bacteria 1103
498 Ga0496102_1631349 3300048905 Unclassified 563
499 Ga0496106_0077460 3300048909 Bacteria 2549
500 Ga0496106_0435033 3300048909 Unclassified 1054
501 Ga0496107_0009149 3300048910 Bacteria 6867
502 Ga0496107_0074865 3300048910 Bacteria 2464
503 Ga0496108_0009820 3300048911 Bacteria 7755
504 Ga0496108_0019090 3300048911 Bacteria 5625
505 Ga0496108_0549359 3300048911 Bacteria 1008
506 Ga0496109_0002893 3300048912 Bacteria 14363
507 Ga0496109_0023392 3300048912 Bacteria 5485
508 Ga0496109_0026557 3300048912 Bacteria 5164
509 Ga0496109_0687335 3300048912 Bacteria 961
510 Ga0496110_0002702 3300048913 Bacteria 13404
511 Ga0496110_0017215 3300048913 Bacteria 6043
512 Ga0496110_1374795 3300048913 Unclassified 615
513 Ga0496111_0000588 3300048914 Bacteria 19077
514 Ga0496111_0007105 3300048914 Bacteria 7316
515 Ga0496111_0265964 3300048914 Bacteria 1272
516 Ga0496111_0392839 3300048914 Bacteria 1025
517 Ga0496112_0001074 3300048915 Bacteria 20212
518 Ga0496112_0160385 3300048915 Bacteria 2215
519 Ga0496112_0188146 3300048915 Bacteria 2027
520 Ga0496112_1942264 3300048915 Bacteria 500
521 Ga0496113_0115450 3300048916 Unclassified 2094
522 Ga0496113_0565519 3300048916 Unclassified 911
523 Ga0496114_0000019 3300048917 Bacteria 244365
524 Ga0501235_090690 3300049669 Bacteria 738
525 Ga0495601_0744936 3300053077 Bacteria 624
526 Ga0590075_070150 3300059424 Bacteria 905
527 Ga0590075_215261 3300059424 Bacteria 509
528 Ga0466962_0027081 3300061719 Bacteria 2753
529 Ga0466962_0244486 3300061719 Bacteria 881
530 Ga0466962_0252092 3300061719 Unclassified 867
531 Ga0466962_0509763 3300061719 Bacteria 609
532 Ga0157380_10007112
533 MBSR1b_contig_10832106
534 MBSR1b_contig_624375
535 MBSR1b_contig_7366601
536 JGI24741J21665_1016584
537 JGI24739J22299_10096239
538 JGI24737J22298_10010906
539 JGI24735J21928_10050130
540 JGI24033J26618_1008505
541 Ga0065715_10414709
542 Ga0070658_10017779
543 Ga0070658_10097338
544 Ga0070658_10277026
545 Ga0070658_10281012
546 Ga0070658_10315696
547 Ga0070658_10344487
548 Ga0070658_10368744
549 Ga0070658_11327976
550 Ga0070676_10055919
551 Ga0070683_100234514
552 Ga0070683_100308877
553 Ga0070683_101747430
554 Ga0070670_100003353
555 Ga0070670_100023833
556 Ga0070677_10003713
557 Ga0070677_10289040
558 Ga0070666_10258917
559 Ga0070666_10987781
560 Ga0070680_100057503
561 Ga0070682_100623300
562 Ga0068868_100001303
563 Ga0070660_100003580
564 Ga0070660_100119302
565 Ga0070660_100286473
566 Ga0070660_100602213
567 Ga0070660_101055880
568 Ga0070661_100317282
569 Ga0070661_100454107
570 Ga0070661_101398013
571 Ga0070692_10191962
572 Ga0070692_10630099
573 Ga0070668_100023278
574 Ga0070668_100038240
575 Ga0070668_100204503
576 Ga0070668_100552466
577 Ga0070668_101166560
578 Ga0070669_100042414
579 Ga0070669_100081250
580 Ga0070669_100226832
581 Ga0070669_100330879
582 Ga0070669_100451777
583 Ga0070675_100008239
584 Ga0070675_100009913
585 Ga0070671_100000786
586 Ga0070671_100004804
587 Ga0070671_100038208
588 Ga0070671_100109114
589 Ga0070671_100152512
590 Ga0070671_100821430
591 Ga0070674_100058124
592 Ga0070674_100294566
593 Ga0070673_100002110
594 Ga0070673_100057523
595 Ga0070673_100181255
596 Ga0070673_100235037
597 Ga0070673_100541706
598 Ga0070673_100590500
599 Ga0070673_101236276
600 Ga0070659_100191710
601 Ga0070659_100257607
602 Ga0070659_100426859
603 Ga0070659_100474142
604 Ga0070659_100516459
605 Ga0070659_100793669
606 Ga0070659_100948053
607 Ga0070667_100014916
608 Ga0070667_100159125
609 Ga0070714_100107346
610 Ga0070714_100358403
611 Ga0070714_101636320
612 Ga0070663_100072026
613 Ga0070663_100759623
614 Ga0070663_101325487
615 Ga0070678_100763541
616 Ga0070662_100011604
617 Ga0070662_100157717
618 Ga0070662_100188726
619 Ga0070662_100268847
620 Ga0070662_100330448
621 Ga0070662_101729368
622 Ga0070681_10337076
623 Ga0070681_11254219
624 Ga0070681_11613979
625 Ga0068867_102147099
626 Ga0070679_100394156
627 Ga0070679_100491411
628 Ga0070679_100695454
629 Ga0070684_100474990
630 Ga0070684_100681324
631 Ga0070684_101799814
632 Ga0070672_100027982
633 Ga0070672_100038444
634 Ga0070672_100049285
635 Ga0070672_100991838
636 Ga0068855_100086177
637 Ga0068855_100467389
638 Ga0068855_101188662
639 Ga0070664_100006716
640 Ga0070664_100085131
641 Ga0070664_100252594
642 Ga0068857_100473193
643 Ga0068857_101596788
644 Ga0068854_100175191
645 Ga0068854_100391863
646 Ga0068856_100107395
647 Ga0068856_100136244
648 Ga0068856_100195537
649 Ga0068856_100630716
650 Ga0068856_100804701
651 Ga0068856_101743814
652 Ga0068852_100105826
653 Ga0068852_100254587
654 Ga0068852_100308068
655 Ga0068852_101547704
656 Ga0068852_101768675
657 Ga0068864_100071021
658 Ga0068864_100080976
659 Ga0068851_10119691
660 Ga0068851_10478428
661 Ga0068870_10476721
662 Ga0068863_100187865
663 Ga0068863_100217282
664 Ga0068858_100299886
665 Ga0068862_100569486
666 Ga0068862_101297110
667 Ga0081539_10025630
668 Ga0081539_10311833
669 Ga0070716_100892645
670 Ga0097621_100781016
671 Ga0105245_10101191
672 Ga0105248_10001480
673 Ga0105248_10020641
674 Ga0105248_10288120
675 Ga0105248_10501768
676 Ga0105238_12890406
677 Ga0157373_10095603
678 Ga0157373_10289450
679 Ga0157373_10362652
680 Ga0157371_10140990
681 Ga0157371_10293450
682 Ga0157371_11060467
683 Ga0157371_11160501
684 Ga0157371_11263247
685 Ga0157370_10029958
686 Ga0157370_10336402
687 Ga0157369_10164346
688 Ga0157369_10179075
689 Ga0157369_10575306
690 Ga0157369_10917136
691 Ga0157374_10753655
692 Ga0157374_11694279
693 Ga0157374_12725660
694 Ga0157372_10681352
695 Ga0157372_10860195
696 Ga0157372_11021809
697 Ga0157372_12622871
698 Ga0157375_12391638
699 Ga0163163_11078937
700 Ga0163161_10603502
701 Ga0206353_10277897
702 Ga0206353_11061649
703 Ga0206353_11951677
704 Ga0207697_10169126
705 Ga0207682_10006331
706 Ga0207682_10059228
707 Ga0207680_10761544
708 Ga0207680_11047133
709 Ga0207647_10015520
710 Ga0207647_10141884
711 Ga0207647_10227050
712 Ga0207645_10057854
713 Ga0207643_10153572
714 Ga0207705_10005168
715 Ga0207705_10105750
716 Ga0207705_10267648
717 Ga0207705_10529102
718 Ga0207705_10539306
719 Ga0207705_10625195
720 Ga0207654_10581413
721 Ga0207707_10340788
722 Ga0207707_11199812
723 Ga0207660_10046816
724 Ga0207657_10003514
725 Ga0207657_10078027
726 Ga0207657_10143463
727 Ga0207657_10493834
728 Ga0207649_10099591
729 Ga0207649_10117691
730 Ga0207649_10586487
731 Ga0207649_10681377
732 Ga0207652_10004701
733 Ga0207652_10818619
734 Ga0207681_10027634
735 Ga0207681_10141027
736 Ga0207681_10657350
737 Ga0207681_11480334
738 Ga0207650_10005211
739 Ga0207650_10011226
740 Ga0207659_10014129
741 Ga0207659_10017850
742 Ga0207687_10008131
743 Ga0207700_10228349
744 Ga0207664_10106237
745 Ga0207664_10524092
746 Ga0207664_10642831
747 Ga0207644_10007685
748 Ga0207644_10027683
749 Ga0207644_10077616
750 Ga0207644_10174282
751 Ga0207644_10710791
752 Ga0207690_10085679
753 Ga0207690_10231089
754 Ga0207690_10311536
755 Ga0207690_10332648
756 Ga0207690_11563915
757 Ga0207706_10012521
758 Ga0207706_10062518
759 Ga0207706_10078494
760 Ga0207706_10191091
761 Ga0207706_10200316
762 Ga0207669_10034813
763 Ga0207691_10006849
764 Ga0207691_10065551
765 Ga0207691_10119035
766 Ga0207691_10830441
767 Ga0207711_10003298
768 Ga0207711_10195971
769 Ga0207661_10541358
770 Ga0207679_10061351
771 Ga0207679_10228754
772 Ga0207679_10253019
773 Ga0207679_10484959
774 Ga0207679_10703468
775 Ga0207667_10342134
776 Ga0207667_10975206
777 Ga0207667_11518988
778 Ga0207651_10094761
779 Ga0207651_10154109
780 Ga0207651_11053283
781 Ga0207651_11294738
782 Ga0207651_11925990
783 Ga0207668_10076534
784 Ga0207668_10148229
785 Ga0207640_10564348
786 Ga0207640_10760396
787 Ga0207640_11060269
788 Ga0207658_10037774
789 Ga0207658_10344955
790 Ga0207677_10001069
791 Ga0207703_10365903
792 Ga0207639_11384492
793 Ga0207678_10069119
794 Ga0207678_10611171
795 Ga0207678_10950995
796 Ga0207678_11837682
797 Ga0207702_10053588
798 Ga0207702_11047998
799 Ga0207702_11255736
800 Ga0207702_11287397
801 Ga0207702_11426545
802 Ga0207641_10428905
803 Ga0207641_11066768
804 Ga0207676_10001631
805 Ga0207676_10014881
806 Ga0207674_10147053
807 Ga0207674_10586373
808 Ga0207698_10002612
809 Ga0207698_10352127
810 Ga0207698_10421734
811 Ga0207698_12047476
812 Ga0268266_10032037
813 Ga0268265_11101474
814 Ga0316177_1127391
815 Ga0316176_1185156
816 Ga0314311_1192309
817 Ga0316183_1160448
818 Ga0316182_1047200
819 Ga0316182_1114491
820 Ga0307408_100015095
821 Ga0307408_100055728
822 Ga0307408_100515230
823 Ga0307408_100838217
824 Ga0307408_101070121
825 Ga0307408_101743769
826 Ga0307408_101837443
827 Ga0307408_101885983
828 Ga0307405_10037022
829 Ga0307405_10109823
830 Ga0307405_10194875
831 Ga0307405_10531172
832 Ga0307405_10685387
833 Ga0307405_11730550
834 Ga0307413_10034661
835 Ga0307413_10048181
836 Ga0307413_10131649
837 Ga0307413_10172479
838 Ga0307413_10209168
839 Ga0307413_10375312
840 Ga0307413_10594824
841 Ga0307413_10598975
842 Ga0307413_10687454
843 Ga0307413_10743860
844 Ga0307413_10786265
845 Ga0307410_10000253
846 Ga0307410_10005837
847 Ga0307410_10014235
848 Ga0307410_10025855
849 Ga0307410_10050173
850 Ga0307410_10051409
851 Ga0307410_10085458
852 Ga0307410_10127106
853 Ga0307410_10144274
854 Ga0307410_10176881
855 Ga0307410_10186978
856 Ga0307410_10195812
857 Ga0307410_10206958
858 Ga0307410_10284316
859 Ga0307410_10725994
860 Ga0307410_11467428
861 Ga0307406_10026211
862 Ga0307406_10077004
863 Ga0307406_10144525
864 Ga0307406_10221241
865 Ga0307406_10666245
866 Ga0307406_10800459
867 Ga0307407_10037283
868 Ga0307407_10064631
869 Ga0307407_10111104
870 Ga0307407_10197750
871 Ga0307407_10694632
872 Ga0307412_10019300
873 Ga0307412_10026273
874 Ga0307412_10049634
875 Ga0307412_10168908
876 Ga0307412_10281147
877 Ga0307412_10323232
878 Ga0307412_10389195
879 Ga0307412_10859931
880 Ga0307409_100002661
881 Ga0307409_100003038
882 Ga0307409_100027457
883 Ga0307409_100067162
884 Ga0307409_100074159
885 Ga0307409_100084573
886 Ga0307409_100174684
887 Ga0307409_100299773
888 Ga0307409_100316828
889 Ga0307409_100356525
890 Ga0307409_100592307
891 Ga0307409_101105274
892 Ga0307409_101846853
893 Ga0307409_101866376
894 Ga0307409_102287959
895 Ga0307409_102517345
896 Ga0307409_102935321
897 Ga0307416_100000898
898 Ga0307416_100021383
899 Ga0307416_100067904
900 Ga0307416_100158545
901 Ga0307416_100169620
902 Ga0307416_100356096
903 Ga0307416_100776521
904 Ga0307416_100784638
905 Ga0307416_101441092
906 Ga0307416_101962669
907 Ga0307414_10045679
908 Ga0307414_10117416
909 Ga0307414_10150190
910 Ga0307414_10151431
911 Ga0307414_10171252
912 Ga0307414_10175148
913 Ga0307414_10286752
914 Ga0307414_10640097
915 Ga0307414_11249557
916 Ga0307414_12070020
917 Ga0307411_10009106
918 Ga0307411_10021259
919 Ga0307411_10041438
920 Ga0307411_10042343
921 Ga0307411_10082601
922 Ga0307411_10088029
923 Ga0307411_10089069
924 Ga0307411_10105532
925 Ga0307411_10186662
926 Ga0307411_10658687
927 Ga0307411_11093009
928 Ga0307411_11227728
929 Ga0307411_11543211
930 Ga0307411_12105195
931 Ga0307415_100000198
932 Ga0307415_100031044
933 Ga0307415_100037484
934 Ga0307415_100065261
935 Ga0307415_100103194
936 Ga0307415_100137465
937 Ga0307415_100146369
938 Ga0307415_100210554
939 Ga0307415_100242251
940 Ga0307415_100665509
941 Ga0307415_101135255
942 Ga0373923_0020471
943 Ga0373953_0093263
944 Ga0373954_0066962
945 Ga0373957_0076542
946 Ga0373955_0008035
947 Ga0373937_0069570
948 Ga0373937_2032902
949 Ga0395899_0003725
950 Ga0395899_0717261
951 Ga0395900_0002988
952 Ga0395900_0828932
953 Ga0395900_1165950
954 Ga0395898_0016609
955 Ga0395898_0150413
956 Ga0395898_0940662
957 Ga0395905_0020581
958 Ga0395905_0057040
959 Ga0395905_0197347
960 Ga0395905_1330538
961 Ga0395905_1497513
962 Ga0395901_1197711
963 Ga0436365_0508469
964 Ga0436362_0298474
965 Ga0439439_0130100
966 Ga0439439_0131673
967 Ga0439445_0253159
968 Ga0439432_181389
969 Ga0439432_253359
970 Ga0439449_0105888
971 Ga0439449_0151508
972 Ga0439449_0276672
973 Ga0439462_0017132
974 Ga0439462_0133810
975 Ga0450898_154323
976 Ga0450907_085151
977 Ga0439446_0255296
978 Ga0466969_0026792
979 Ga0466972_0342429
980 Ga0466965_0473522
981 Ga0466965_0581212
982 Ga0466966_0015313
983 Ga0466966_0453474
984 Ga0466966_0591500
985 Ga0466963_0083211
986 Ga0466963_0155365
987 Ga0466963_0181913
988 Ga0466963_0231814
989 Ga0466963_0740829
990 Ga0466971_0172636
991 Ga0466971_0220667
992 Ga0466968_0510056
993 Ga0466970_0250145
994 Ga0466957_0040297
995 Ga0466957_0084310
996 Ga0466957_0572267
997 Ga0466957_1243671
998 Ga0466959_0060439
999 Ga0466959_1037879
1000 Ga0466959_1109848
1001 Ga0466958_0167979
1002 Ga0466958_0924640
1003 Ga0466967_0053308
1004 Ga0466967_0058759
1005 Ga0466967_0119702
1006 Ga0466967_0214122
1007 Ga0466967_0328115
1008 Ga0495585_0176838
1009 Ga0495644_0360138
1010 Ga0495663_0017985
1011 Ga0495663_0048466
1012 Ga0495663_0313315
1013 Ga0495598_0410614
1014 Ga0495621_0065975
1015 Ga0495621_0161549
1016 Ga0495633_0005406
1017 Ga0495623_0154479
1018 Ga0495669_0004302
1019 Ga0495669_0018015
1020 Ga0495669_0052232
1021 Ga0495669_0110758
1022 Ga0495670_0030654
1023 Ga0495670_0059972
1024 Ga0495677_0050116
1025 Ga0495602_0292786
1026 Ga0496100_0079159
1027 Ga0496101_0228318
1028 Ga0496101_0385389
1029 Ga0496102_1631349
1030 Ga0496106_0077460
1031 Ga0496106_0435033
1032 Ga0496107_0009149
1033 Ga0496107_0074865
1034 Ga0496108_0009820
1035 Ga0496108_0019090
1036 Ga0496108_0549359
1037 Ga0496109_0002893
1038 Ga0496109_0023392
1039 Ga0496109_0026557
1040 Ga0496109_0687335
1041 Ga0496110_0002702
1042 Ga0496110_0017215
1043 Ga0496110_1374795
1044 Ga0496111_0000588
1045 Ga0496111_0007105
1046 Ga0496111_0265964
1047 Ga0496111_0392839
1048 Ga0496112_0001074
1049 Ga0496112_0160385
1050 Ga0496112_0188146
1051 Ga0496112_1942264
1052 Ga0496113_0115450
1053 Ga0496113_0565519
1054 Ga0496114_0000019
1055 Ga0501235_090690
1056 Ga0495601_0744936
1057 Ga0590075_070150
1058 Ga0590075_215261
1059 Ga0466962_0027081
1060 Ga0466962_0244486
1061 Ga0466962_0252092
1062 Ga0466962_0509763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f95-assembly1.cif.gz_B-2 m intermediate structure of sensory rhodopsin ii/transducer complex in combination with the ground state structure 0.4282 17 58
6tb3-assembly1.cif.gz_BW yeast 80s ribosome in complex with the not5 subunit of the ccr4-not complex 0.3895 18 91
2f95-assembly1.cif.gz_B-2 m intermediate structure of sensory rhodopsin ii/transducer complex in combination with the ground state structure 0.3732 17 58
2dl1-assembly1.cif.gz_A solution structure of the mit domain from human spartin 0.3556 2 93
5jbr-assembly1.cif.gz_B crystal structure of uncharacterized protein bcav_2135 from beutenbergia cavernae 0.3537 42 94
ID Description Score Start End Superfamily
af_Q9UJY5_210_314_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5176 18 93 1.20.58.160
af_A9JT54_319_394_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.4954 14 93 1.20.58.80
af_Q4DV89_224_350_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.4557 14 93 1.20.58.340
af_I1KXX2_1_136_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4493 18 91 1.20.1410.10
af_A0A1D6PSC9_1_133_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4473 17 93 1.20.58.160
ID Description Score Start End GO Terms
AF-A0A7Y3NM38-F1-model_v4 Uncharacterized protein 0.8918 9 88
AF-A0A285QZF4-F1-model_v4 Flagellar protein FlgJ 0.8905 9 93
AF-A0A7W9RBT0-F1-model_v4 deleted 0.8893 9 92
AF-A0A7Y9SW67-F1-model_v4 Uncharacterized protein 0.8887 10 87
AF-T0HTG5-F1-model_v4 Uncharacterized protein 0.8875 9 91

Map