F459993

General Info

Members Datasets Scaffolds Average Seq Length
530 299 519 313

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0010057|Ga0466958_0010057_3010_4119
Length 358
Sequence LETVGPIGYTYRDGLIRPIAVPLEPLVSRADSDIAGDVATDVDAGGPGALPAEVYIEAVGLEKRFGDYLAVDGIDFRVRRGEAFGFLGPNGAGKSSTMRMIGCVSPVTAGSLRILGLDPAADGPAIRRRLGVVPQDDTLDMELTVRENILVYGRYFDLPRREIRARADELLEFVQLAERSDAKVEHLSGGMRRRLTIARSLVNDPDVLLLDEPTTGLDPQARHVVWDRLYRLKQRGVTLVLTTHYMDEAEQLCDRLVVMDKGRIAAEGSPMELIGRYSSREVLELRFAPGEAEHRVADVEDLAERVEVLPDRLLLYADDGEAAAARVHARGVVPISMLVRRSTLEDVFLRLTGRTLID

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
3 2739367898 Nocardioides sp. CF479 Isolate Unclassified
4 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
5 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
6 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
7 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
8 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
9 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
10 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
213 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 0.75
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 8.11
Rhizosphere 88.3
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10030121 3300001990 Bacteria 1699
2 JGI24744J21845_10000545 3300002077 Bacteria 6764
3 JGI25407J50210_10004461 3300003373 Bacteria 3405
4 Ga0070658_10026555 3300005327 Bacteria 4645
5 Ga0070658_10040098 3300005327 Bacteria 3778
6 Ga0070658_10085736 3300005327 Bacteria 2590
7 Ga0070676_10036155 3300005328 Bacteria 2844
8 Ga0070683_100099023 3300005329 Bacteria 2744
9 Ga0070683_100225704 3300005329 Bacteria 1780
10 Ga0070683_100463737 3300005329 Bacteria 1209
11 Ga0070690_100040037 3300005330 Bacteria 2963
12 Ga0068869_100031104 3300005334 Bacteria 3754
13 Ga0068869_100039413 3300005334 Bacteria 3373
14 Ga0068869_100220673 3300005334 Bacteria 1502
15 Ga0070666_10006718 3300005335 Bacteria 7082
16 Ga0070666_10086441 3300005335 Bacteria 2148
17 Ga0070680_100019850 3300005336 Bacteria 5329
18 Ga0070680_100045197 3300005336 Bacteria 3580
19 Ga0070680_100056004 3300005336 Bacteria 3223
20 Ga0070682_100005590 3300005337 Bacteria 7006
21 Ga0070682_100017200 3300005337 Bacteria 4213
22 Ga0070682_100036541 3300005337 Bacteria 3003
23 Ga0070682_100051246 3300005337 Bacteria 2579
24 Ga0068868_100015311 3300005338 Bacteria 5669
25 Ga0068868_100059582 3300005338 Bacteria 3020
26 Ga0068868_100073754 3300005338 Bacteria 2725
27 Ga0070660_100010729 3300005339 Bacteria 6484
28 Ga0070660_100036062 3300005339 Bacteria 3744
29 Ga0070660_100038745 3300005339 Bacteria 3619
30 Ga0070660_100039585 3300005339 Bacteria 3584
31 Ga0070660_100044493 3300005339 Bacteria 3397
32 Ga0070689_100031570 3300005340 Bacteria 4027
33 Ga0070689_100034973 3300005340 Bacteria 3836
34 Ga0070689_100069027 3300005340 Bacteria 2757
35 Ga0070691_10061776 3300005341 Bacteria 1803
36 Ga0070687_100051835 3300005343 Bacteria 2127
37 Ga0070661_100125786 3300005344 Bacteria 1923
38 Ga0070692_10005129 3300005345 Bacteria 5544
39 Ga0070692_10006244 3300005345 Bacteria 5160
40 Ga0070692_10077594 3300005345 Bacteria 1782
41 Ga0070668_100004474 3300005347 Bacteria 10363
42 Ga0070668_100026766 3300005347 Bacteria 4378
43 Ga0070675_100001736 3300005354 Bacteria 16094
44 Ga0070671_100089434 3300005355 Bacteria 2578
45 Ga0070674_100046836 3300005356 Bacteria 2960
46 Ga0070673_100011571 3300005364 Bacteria 6028
47 Ga0070688_100014703 3300005365 Bacteria 4439
48 Ga0070659_100009691 3300005366 Bacteria 7079
49 Ga0070659_100015288 3300005366 Bacteria 5746
50 Ga0070659_100103578 3300005366 Bacteria 2292
51 Ga0070667_100061539 3300005367 Bacteria 3178
52 Ga0070703_10018689 3300005406 Bacteria 2007
53 Ga0070703_10027438 3300005406 Bacteria 1697
54 Ga0070709_10030733 3300005434 Bacteria 3226
55 Ga0070714_100019745 3300005435 Bacteria 5496
56 Ga0070714_100024226 3300005435 Bacteria 4994
57 Ga0070713_100225978 3300005436 Bacteria 1700
58 Ga0070713_100265278 3300005436 Bacteria 1571
59 Ga0070701_10004503 3300005438 Bacteria 5653
60 Ga0070701_10024991 3300005438 Bacteria 2896
61 Ga0070711_100001075 3300005439 Bacteria 14603
62 Ga0070711_100018634 3300005439 Bacteria 4435
63 Ga0070705_100012689 3300005440 Bacteria 4291
64 Ga0070700_100007469 3300005441 Bacteria 5906
65 Ga0070700_100018475 3300005441 Bacteria 4008
66 Ga0070700_100271409 3300005441 Bacteria 1226
67 Ga0070694_100021359 3300005444 Bacteria 4135
68 Ga0070708_100245364 3300005445 Bacteria 1682
69 Ga0070663_100004470 3300005455 Bacteria 8232
70 Ga0070663_100007874 3300005455 Bacteria 6518
71 Ga0070663_100030501 3300005455 Bacteria 3696
72 Ga0070678_100019929 3300005456 Bacteria 4388
73 Ga0070678_100261392 3300005456 Bacteria 1456
74 Ga0070662_100015307 3300005457 Bacteria 5135
75 Ga0070662_100037828 3300005457 Bacteria 3424
76 Ga0068867_100010996 3300005459 Bacteria 6381
77 Ga0070685_10006574 3300005466 Bacteria 5930
78 Ga0070685_10075681 3300005466 Bacteria 2006
79 Ga0070706_100010936 3300005467 Bacteria 8426
80 Ga0070706_100033206 3300005467 Bacteria 4763
81 Ga0070706_100123628 3300005467 Bacteria 2412
82 Ga0070707_100000635 3300005468 Bacteria 35108
83 Ga0070707_100012722 3300005468 Bacteria 7856
84 Ga0070707_100031619 3300005468 Bacteria 5043
85 Ga0070698_100001447 3300005471 Bacteria 26354
86 Ga0070698_100121812 3300005471 Bacteria 2567
87 Ga0070699_100004137 3300005518 Bacteria 12817
88 Ga0070699_100345317 3300005518 Bacteria 1340
89 Ga0070679_100039850 3300005530 Bacteria 4670
90 Ga0070679_100130014 3300005530 Bacteria 2499
91 Ga0070684_100007429 3300005535 Bacteria 8517
92 Ga0070697_100039791 3300005536 Bacteria 3802
93 Ga0068853_100024124 3300005539 Bacteria 5098
94 Ga0068853_100128707 3300005539 Bacteria 2264
95 Ga0070672_100016444 3300005543 Bacteria 5297
96 Ga0070672_100228061 3300005543 Bacteria 1564
97 Ga0070686_100009810 3300005544 Bacteria 5381
98 Ga0070695_100077633 3300005545 Bacteria 2188
99 Ga0070696_100070710 3300005546 Bacteria 2455
100 Ga0070696_100084546 3300005546 Bacteria 2251
101 Ga0070693_100017250 3300005547 Bacteria 3750
102 Ga0070693_100033717 3300005547 Bacteria 2828
103 Ga0070665_100003419 3300005548 Bacteria 16959
104 Ga0070665_100032592 3300005548 Bacteria 5244
105 Ga0070665_100072829 3300005548 Bacteria 3443
106 Ga0070704_100223077 3300005549 Bacteria 1533
107 Ga0068855_100033888 3300005563 Bacteria 6091
108 Ga0068855_100086601 3300005563 Bacteria 3622
109 Ga0068855_100087187 3300005563 Bacteria 3608
110 Ga0068855_100089581 3300005563 Bacteria 3552
111 Ga0068855_100105730 3300005563 Bacteria 3236
112 Ga0068855_100249612 3300005563 Bacteria 1979
113 Ga0070664_100101896 3300005564 Bacteria 2497
114 Ga0068857_100008769 3300005577 Bacteria 8760
115 Ga0068854_100082572 3300005578 Bacteria 2375
116 Ga0068856_100016290 3300005614 Bacteria 7194
117 Ga0068856_100039021 3300005614 Bacteria 4663
118 Ga0068856_100046948 3300005614 Bacteria 4254
119 Ga0068856_100335295 3300005614 Bacteria 1530
120 Ga0070702_100001788 3300005615 Bacteria 8926
121 Ga0070702_100012528 3300005615 Bacteria 4252
122 Ga0070702_100043982 3300005615 Bacteria 2519
123 Ga0068852_100002353 3300005616 Bacteria 13020
124 Ga0068852_100009242 3300005616 Bacteria 7303
125 Ga0068852_100054285 3300005616 Bacteria 3453
126 Ga0068852_100218138 3300005616 Bacteria 1813
127 Ga0068859_100075629 3300005617 Bacteria 3408
128 Ga0068864_100035439 3300005618 Bacteria 4248
129 Ga0068866_10007635 3300005718 Bacteria 4534
130 Ga0068866_10210285 3300005718 Bacteria 1167
131 Ga0068861_100011898 3300005719 Bacteria 6059
132 Ga0068861_100090326 3300005719 Bacteria 2416
133 Ga0068851_10006785 3300005834 Bacteria 5240
134 Ga0068863_100060043 3300005841 Bacteria 3596
135 Ga0068863_100222824 3300005841 Bacteria 1817
136 Ga0068858_100140183 3300005842 Bacteria 2269
137 Ga0068860_100111399 3300005843 Bacteria 2617
138 Ga0068862_100109523 3300005844 Bacteria 2423
139 Ga0068862_100312772 3300005844 Bacteria 1448
140 Ga0081538_10000049 3300005981 Bacteria 110906
141 Ga0081538_10038364 3300005981 Bacteria 3091
142 Ga0081540_1003473 3300005983 Bacteria 12437
143 Ga0081539_10038831 3300005985 Bacteria 2816
144 Ga0070717_10079799 3300006028 Bacteria 2744
145 Ga0075365_10185883 3300006038 Bacteria 1453
146 Ga0070716_100011674 3300006173 Bacteria 4427
147 Ga0070712_100025640 3300006175 Bacteria 3921
148 Ga0075367_10036937 3300006178 Bacteria 2835
149 Ga0097621_100013980 3300006237 Bacteria 5996
150 Ga0097621_100015174 3300006237 Bacteria 5788
151 Ga0097621_100048732 3300006237 Bacteria 3439
152 Ga0068871_100006377 3300006358 Bacteria 8339
153 Ga0068871_100014424 3300006358 Bacteria 5893
154 Ga0068871_100041942 3300006358 Bacteria 3671
155 Ga0075428_100062002 3300006844 Bacteria 4095
156 Ga0075428_100090538 3300006844 Bacteria 3337
157 Ga0075430_100003484 3300006846 Bacteria 13164
158 Ga0075430_100085669 3300006846 Bacteria 2638
159 Ga0075430_100136720 3300006846 Bacteria 2041
160 Ga0075431_100012225 3300006847 Bacteria 8666
161 Ga0075431_100235015 3300006847 Bacteria 1866
162 Ga0075433_10425664 3300006852 Bacteria 1171
163 Ga0075429_100013032 3300006880 Bacteria 7215
164 Ga0068865_100004949 3300006881 Bacteria 8056
165 Ga0068865_100014446 3300006881 Bacteria 5017
166 Ga0075436_100005573 3300006914 Bacteria 8645
167 Ga0075436_100058529 3300006914 Bacteria 2661
168 Ga0097620_100075631 3300006931 Bacteria 3408
169 Ga0075435_100014980 3300007076 Bacteria 5816
170 Ga0075435_100020196 3300007076 Bacteria 5099
171 Ga0105240_10093724 3300009093 Bacteria 3665
172 Ga0105240_10118923 3300009093 Bacteria 3184
173 Ga0111539_10045488 3300009094 Bacteria 5254
174 Ga0105245_10044961 3300009098 Bacteria 3942
175 Ga0105245_10046722 3300009098 Bacteria 3869
176 Ga0105245_10322263 3300009098 Bacteria 1523
177 Ga0105247_10005243 3300009101 Bacteria 8180
178 Ga0105247_10033774 3300009101 Bacteria 3114
179 Ga0114129_10000031 3300009147 Bacteria 111827
180 Ga0114129_10004129 3300009147 Bacteria 20516
181 Ga0105243_10030792 3300009148 Bacteria 4134
182 Ga0105243_10038471 3300009148 Bacteria 3725
183 Ga0105243_10067972 3300009148 Bacteria 2871
184 Ga0105241_10033100 3300009174 Bacteria 3879
185 Ga0105242_10014129 3300009176 Bacteria 6182
186 Ga0105242_10181238 3300009176 Bacteria 1858
187 Ga0105248_10026459 3300009177 Bacteria 6454
188 Ga0105248_10045083 3300009177 Bacteria 4945
189 Ga0105248_10047870 3300009177 Bacteria 4795
190 Ga0105248_10166209 3300009177 Bacteria 2487
191 Ga0105237_10164035 3300009545 Bacteria 2221
192 Ga0105238_10041390 3300009551 Bacteria 4666
193 Ga0105238_10086054 3300009551 Bacteria 3130
194 Ga0105249_10001347 3300009553 Bacteria 21460
195 Ga0105249_10024591 3300009553 Bacteria 5414
196 Ga0105249_10576702 3300009553 Bacteria 1178
197 Ga0105239_10009547 3300010375 Bacteria 10917
198 Ga0105239_10057810 3300010375 Bacteria 4255
199 Ga0105246_10398628 3300011119 Bacteria 1142
200 Ga0157371_10010959 3300013102 Bacteria 7027
201 Ga0157370_10034064 3300013104 Bacteria 4962
202 Ga0157370_10070116 3300013104 Bacteria 3310
203 Ga0157370_10109761 3300013104 Bacteria 2579
204 Ga0157369_10009918 3300013105 Bacteria 10883
205 Ga0157369_10027326 3300013105 Bacteria 6327
206 Ga0157369_10254116 3300013105 Bacteria 1834
207 Ga0157374_10015577 3300013296 Bacteria 6672
208 Ga0157378_10006940 3300013297 Bacteria 9880
209 Ga0157378_10223309 3300013297 Bacteria 1792
210 Ga0163162_10013364 3300013306 Bacteria 8017
211 Ga0163162_10027647 3300013306 Bacteria 5610
212 Ga0157372_10211441 3300013307 Bacteria 2248
213 Ga0157372_10696458 3300013307 Bacteria 1182
214 Ga0157375_10024586 3300013308 Bacteria 5578
215 Ga0157375_10034939 3300013308 Bacteria 4794
216 Ga0157375_10064065 3300013308 Bacteria 3659
217 Ga0157375_10083117 3300013308 Bacteria 3246
218 Ga0163163_10029525 3300014325 Bacteria 5276
219 Ga0163163_10033950 3300014325 Bacteria 4939
220 Ga0163163_10182291 3300014325 Bacteria 2147
221 Ga0157380_10008097 3300014326 Bacteria 7490
222 Ga0157377_10005998 3300014745 Bacteria 5756
223 Ga0157377_10022170 3300014745 Bacteria 3350
224 Ga0157379_10505087 3300014968 Bacteria 1121
225 Ga0157376_10020185 3300014969 Bacteria 5150
226 Ga0157376_10036577 3300014969 Bacteria 3978
227 Ga0163161_10010508 3300017792 Bacteria 6411
228 Ga0206356_10427959 3300020070 Bacteria 3837
229 Ga0206354_10719510 3300020081 Bacteria 2404
230 Ga0206354_10843100 3300020081 Bacteria 2342
231 Ga0206353_11193225 3300020082 Bacteria 4331
232 Ga0213871_10066000 3300021441 Bacteria 1015
233 Ga0207692_10004373 3300025898 Bacteria 5595
234 Ga0207642_10004902 3300025899 Bacteria 4336
235 Ga0207710_10130136 3300025900 Bacteria 1208
236 Ga0207688_10023993 3300025901 Bacteria 3344
237 Ga0207688_10036365 3300025901 Bacteria 2729
238 Ga0207688_10044967 3300025901 Bacteria 2462
239 Ga0207680_10026642 3300025903 Bacteria 3207
240 Ga0207680_10056408 3300025903 Bacteria 2372
241 Ga0207647_10008509 3300025904 Bacteria 7351
242 Ga0207647_10033696 3300025904 Bacteria 3276
243 Ga0207699_10041704 3300025906 Bacteria 2653
244 Ga0207645_10067108 3300025907 Bacteria 2293
245 Ga0207645_10090760 3300025907 Bacteria 1964
246 Ga0207643_10000112 3300025908 Bacteria 55805
247 Ga0207643_10058599 3300025908 Bacteria 2195
248 Ga0207705_10094338 3300025909 Bacteria 2194
249 Ga0207705_10171805 3300025909 Bacteria 1632
250 Ga0207684_10091589 3300025910 Bacteria 2591
251 Ga0207654_10096048 3300025911 Bacteria 1817
252 Ga0207707_10056943 3300025912 Bacteria 3402
253 Ga0207671_10052335 3300025914 Bacteria 3026
254 Ga0207671_10127655 3300025914 Bacteria 1950
255 Ga0207693_10000409 3300025915 Bacteria 39089
256 Ga0207693_10001176 3300025915 Bacteria 23358
257 Ga0207663_10060209 3300025916 Bacteria 2405
258 Ga0207660_10007499 3300025917 Bacteria 7060
259 Ga0207660_10222278 3300025917 Bacteria 1482
260 Ga0207662_10052854 3300025918 Bacteria 2418
261 Ga0207657_10003179 3300025919 Bacteria 17568
262 Ga0207657_10005213 3300025919 Bacteria 13615
263 Ga0207657_10065016 3300025919 Bacteria 3111
264 Ga0207657_10119832 3300025919 Bacteria 2165
265 Ga0207652_10012926 3300025921 Bacteria 6754
266 Ga0207652_10045951 3300025921 Bacteria 3724
267 Ga0207652_10053775 3300025921 Bacteria 3459
268 Ga0207646_10002084 3300025922 Bacteria 24000
269 Ga0207646_10007636 3300025922 Bacteria 10947
270 Ga0207694_10047309 3300025924 Bacteria 3328
271 Ga0207650_10004590 3300025925 Bacteria 9446
272 Ga0207659_10005948 3300025926 Bacteria 7445
273 Ga0207687_10003050 3300025927 Bacteria 11358
274 Ga0207687_10056798 3300025927 Bacteria 2747
275 Ga0207700_10123007 3300025928 Bacteria 2107
276 Ga0207664_10025967 3300025929 Bacteria 4421
277 Ga0207664_10032082 3300025929 Bacteria 4024
278 Ga0207664_10042739 3300025929 Bacteria 3540
279 Ga0207644_10081838 3300025931 Bacteria 2387
280 Ga0207644_10100121 3300025931 Bacteria 2176
281 Ga0207690_10027965 3300025932 Bacteria 3569
282 Ga0207690_10090892 3300025932 Bacteria 2156
283 Ga0207690_10108327 3300025932 Bacteria 1996
284 Ga0207690_10352944 3300025932 Bacteria 1163
285 Ga0207706_10003043 3300025933 Bacteria 16167
286 Ga0207706_10024684 3300025933 Bacteria 5387
287 Ga0207706_10113924 3300025933 Bacteria 2378
288 Ga0207686_10003864 3300025934 Bacteria 8034
289 Ga0207686_10026043 3300025934 Bacteria 3410
290 Ga0207709_10012187 3300025935 Bacteria 4739
291 Ga0207709_10062374 3300025935 Bacteria 2333
292 Ga0207669_10021389 3300025937 Bacteria 3414
293 Ga0207669_10072106 3300025937 Bacteria 2173
294 Ga0207704_10005166 3300025938 Bacteria 6012
295 Ga0207704_10079420 3300025938 Bacteria 2114
296 Ga0207665_10006099 3300025939 Bacteria 8005
297 Ga0207665_10181263 3300025939 Bacteria 1525
298 Ga0207691_10022722 3300025940 Bacteria 5913
299 Ga0207691_10142454 3300025940 Bacteria 2111
300 Ga0207689_10000247 3300025942 Bacteria 48421
301 Ga0207689_10057931 3300025942 Bacteria 3186
302 Ga0207661_10021608 3300025944 Bacteria 4824
303 Ga0207661_10025730 3300025944 Bacteria 4477
304 Ga0207661_10079054 3300025944 Bacteria 2710
305 Ga0207679_10187512 3300025945 Bacteria 1716
306 Ga0207667_10019931 3300025949 Bacteria 7473
307 Ga0207667_10030735 3300025949 Bacteria 5805
308 Ga0207667_10273780 3300025949 Bacteria 1726
309 Ga0207651_10041567 3300025960 Bacteria 3053
310 Ga0207668_10008002 3300025972 Bacteria 6291
311 Ga0207668_10127140 3300025972 Bacteria 1940
312 Ga0207640_10061985 3300025981 Bacteria 2479
313 Ga0207677_10009652 3300026023 Bacteria 5434
314 Ga0207703_10185058 3300026035 Bacteria 1840
315 Ga0207703_10201433 3300026035 Bacteria 1769
316 Ga0207678_10002660 3300026067 Bacteria 16232
317 Ga0207678_10004730 3300026067 Bacteria 12226
318 Ga0207678_10006233 3300026067 Bacteria 10593
319 Ga0207678_10007527 3300026067 Bacteria 9627
320 Ga0207708_10001288 3300026075 Bacteria 18839
321 Ga0207708_10010392 3300026075 Bacteria 6909
322 Ga0207708_10168519 3300026075 Bacteria 1733
323 Ga0207702_10003223 3300026078 Bacteria 15072
324 Ga0207702_10012065 3300026078 Bacteria 7187
325 Ga0207702_10025530 3300026078 Bacteria 4904
326 Ga0207702_10065017 3300026078 Bacteria 3123
327 Ga0207702_10159160 3300026078 Bacteria 2061
328 Ga0207641_10201328 3300026088 Bacteria 1836
329 Ga0207641_10205724 3300026088 Bacteria 1817
330 Ga0207648_10000136 3300026089 Bacteria 73368
331 Ga0207676_10001377 3300026095 Bacteria 18083
332 Ga0207674_10023525 3300026116 Bacteria 6596
333 Ga0207675_100053991 3300026118 Bacteria 3748
334 Ga0207675_100102502 3300026118 Bacteria 2697
335 Ga0207675_100117780 3300026118 Bacteria 2511
336 Ga0207683_10000371 3300026121 Bacteria 41225
337 Ga0207683_10001767 3300026121 Bacteria 19129
338 Ga0207683_10005450 3300026121 Bacteria 10898
339 Ga0207428_10017252 3300027907 Bacteria 6199
340 Ga0207428_10028153 3300027907 Bacteria 4671
341 Ga0268266_10017670 3300028379 Bacteria 6082
342 Ga0268265_10075331 3300028380 Bacteria 2643
343 Ga0268265_10251362 3300028380 Bacteria 1566
344 Ga0268264_10027520 3300028381 Bacteria 4647
345 Ga0268264_10143485 3300028381 Bacteria 2132
346 Ga0268264_10526121 3300028381 Bacteria 1157
347 Ga0307513_10235564 3300031456 Bacteria 1640
348 Ga0316577_10001679 3300031733 Bacteria 10609
349 Ga0316577_10153117 3300031733 Bacteria 1300
350 Ga0307410_10256611 3300031852 Bacteria 1362
351 Ga0307406_10008721 3300031901 Bacteria 5667
352 Ga0307406_10072018 3300031901 Bacteria 2267
353 Ga0307407_10232777 3300031903 Bacteria 1252
354 Ga0307507_10000090 3300033179 Bacteria 142457
355 Ga0373938_0007430 3300034957 Bacteria 1927
356 Ga0373938_0018038 3300034957 Bacteria 1396
357 Ga0373951_0021390 3300035091 Bacteria 1486
358 Ga0373943_0143582 3300035170 Bacteria 1288
359 Ga0373931_0063704 3300035691 Bacteria 1993
360 Ga0395899_0007122 3300037312 Bacteria 8651
361 Ga0395899_0013580 3300037312 Bacteria 6226
362 Ga0395899_0088251 3300037312 Bacteria 2250
363 Ga0395900_0001036 3300037418 Bacteria 35631
364 Ga0395900_0093344 3300037418 Bacteria 3091
365 Ga0395898_0001318 3300037466 Bacteria 36063
366 Ga0395898_0010178 3300037466 Bacteria 9845
367 Ga0395898_0059579 3300037466 Bacteria 3713
368 Ga0395898_0244177 3300037466 Bacteria 1712
369 Ga0395905_0007007 3300037471 Bacteria 11268
370 Ga0395905_0304086 3300037471 Bacteria 1482
371 Ga0436364_1475170 3300037853 Bacteria 3888
372 Ga0395901_0040462 3300038443 Bacteria 4828
373 Ga0395901_0442324 3300038443 Bacteria 1330
374 Ga0400485_15906 3300038735 Bacteria 2673
375 Ga0436360_0802153 3300039438 Bacteria 5012
376 Ga0436360_1224020 3300039438 Bacteria 1815
377 Ga0451795_1479959 3300041456 Bacteria 2088
378 Ga0451800_0130591 3300041459 Bacteria 1286
379 Ga0451833_0174647 3300041491 Bacteria 3665
380 Ga0451839_1186836 3300041496 Bacteria 2734
381 Ga0451853_1398733 3300041512 Bacteria 5192
382 Ga0439450_025599 3300042008 Bacteria 1295
383 Ga0439458_0021472 3300042157 Bacteria 1495
384 Ga0439459_0004658 3300042438 Bacteria 2217
385 Ga0466969_0046218 3300044656 Bacteria 2159
386 Ga0466966_0016415 3300044684 Bacteria 4893
387 Ga0466963_0015316 3300044694 Bacteria 4744
388 Ga0466963_0067077 3300044694 Bacteria 2407
389 Ga0466963_0138280 3300044694 Bacteria 1686
390 Ga0466970_0017951 3300044765 Bacteria 3660
391 Ga0466957_0023206 3300044842 Bacteria 3666
392 Ga0466957_0122923 3300044842 Bacteria 1656
393 Ga0466957_0210089 3300044842 Bacteria 1281
394 Ga0466960_0006554 3300044901 Bacteria 4675
395 Ga0466960_0008279 3300044901 Bacteria 4253
396 Ga0466960_0020471 3300044901 Bacteria 2931
397 Ga0466958_0010057 3300045836 Bacteria 5288
398 Ga0466958_0065680 3300045836 Bacteria 2214
399 Ga0466967_0070336 3300045976 Bacteria 3131
400 Ga0466967_0608088 3300045976 Bacteria 1079
401 Ga0495603_0163354 3300046455 Bacteria 1291
402 Ga0495629_0321513 3300046459 Bacteria 1058
403 Ga0495641_0046397 3300046461 Bacteria 1998
404 Ga0495582_0019253 3300046473 Bacteria 3733
405 Ga0495582_0051079 3300046473 Bacteria 2279
406 Ga0495596_0081277 3300046500 Bacteria 1258
407 Ga0495607_0071824 3300046501 Bacteria 1929
408 Ga0495628_0233265 3300046516 Bacteria 1379
409 Ga0495663_0022204 3300046525 Bacteria 1832
410 Ga0495586_0036394 3300046535 Bacteria 2642
411 Ga0495609_0072193 3300046538 Bacteria 1516
412 Ga0495656_0062822 3300046615 Bacteria 1626
413 Ga0495668_0075739 3300046616 Bacteria 1848
414 Ga0495634_0033804 3300046642 Bacteria 3511
415 Ga0495625_0006148 3300046660 Bacteria 10750
416 Ga0495588_0206037 3300046674 Bacteria 1039
417 Ga0495647_0045356 3300046681 Bacteria 1688
418 Ga0495589_0089684 3300046794 Bacteria 1493
419 Ga0495676_0104132 3300047321 Bacteria 2094
420 Ga0495683_0033576 3300047323 Bacteria 2610
421 Ga0495677_0067882 3300047445 Bacteria 1327
422 Ga0495684_0050774 3300047471 Bacteria 3166
423 Ga0495614_0060465 3300048089 Bacteria 1628
424 Ga0495626_0000784 3300048091 Bacteria 28861
425 Ga0496100_0234149 3300048903 Bacteria 1352
426 Ga0496101_0001995 3300048904 Bacteria 12381
427 Ga0496101_0321973 3300048904 Bacteria 1213
428 Ga0496102_0015059 3300048905 Bacteria 6731
429 Ga0496102_0105287 3300048905 Bacteria 2624
430 Ga0496103_0004353 3300048906 Bacteria 8595
431 Ga0496104_0054633 3300048907 Bacteria 3775
432 Ga0496104_0139194 3300048907 Bacteria 2332
433 Ga0496105_0013282 3300048908 Bacteria 6535
434 Ga0496105_0045250 3300048908 Bacteria 3631
435 Ga0496105_0071739 3300048908 Bacteria 2862
436 Ga0496105_0178068 3300048908 Bacteria 1741
437 Ga0496105_0211082 3300048908 Bacteria 1582
438 Ga0496106_0003272 3300048909 Bacteria 12106
439 Ga0496106_0003308 3300048909 Bacteria 12017
440 Ga0496107_0014241 3300048910 Bacteria 5569
441 Ga0496108_0009239 3300048911 Bacteria 7977
442 Ga0496108_0112864 3300048911 Bacteria 2325
443 Ga0496108_0175768 3300048911 Bacteria 1853
444 Ga0496108_0265716 3300048911 Bacteria 1493
445 Ga0496109_0004612 3300048912 Bacteria 11501
446 Ga0496109_0008315 3300048912 Bacteria 8812
447 Ga0496109_0020626 3300048912 Bacteria 5822
448 Ga0496109_0032504 3300048912 Bacteria 4690
449 Ga0496109_0037431 3300048912 Bacteria 4382
450 Ga0496109_0482993 3300048912 Bacteria 1170
451 Ga0496110_0007957 3300048913 Bacteria 8490
452 Ga0496110_0058833 3300048913 Bacteria 3385
453 Ga0496110_0090814 3300048913 Bacteria 2731
454 Ga0496110_0146853 3300048913 Bacteria 2133
455 Ga0496111_0004766 3300048914 Bacteria 8604
456 Ga0496111_0011523 3300048914 Bacteria 5961
457 Ga0496112_0001031 3300048915 Bacteria 20495
458 Ga0496112_0016365 3300048915 Bacteria 6945
459 Ga0496112_0020727 3300048915 Bacteria 6236
460 Ga0496112_0051384 3300048915 Bacteria 4043
461 Ga0496112_0081851 3300048915 Bacteria 3193
462 Ga0496114_0039819 3300048917 Bacteria 3889
463 Ga0496114_0396632 3300048917 Bacteria 1222
464 Ga0496115_0003007 3300048918 Bacteria 12105
465 Ga0496115_0003930 3300048918 Bacteria 10708
466 Ga0501032_0014627 3300049569 Bacteria 5559
467 Ga0501034_0042176 3300049571 Bacteria 4619
468 Ga0501034_0223019 3300049571 Bacteria 1837
469 Ga0501036_0105172 3300049572 Bacteria 2387
470 Ga0501036_0158258 3300049572 Bacteria 1910
471 Ga0501036_0236158 3300049572 Bacteria 1533
472 Ga0501036_0532618 3300049572 Bacteria 976
473 Ga0501037_0048648 3300049573 Bacteria 3106
474 Ga0501038_0003462 3300049574 Bacteria 14721
475 Ga0501039_0043255 3300049575 Bacteria 3480
476 Ga0501040_0010511 3300049576 Bacteria 6054
477 Ga0501046_0161631 3300049580 Bacteria 1684
478 Ga0501046_0163438 3300049580 Bacteria 1673
479 Ga0501047_0003842 3300049581 Bacteria 14123
480 Ga0501048_0001586 3300049582 Bacteria 17266
481 Ga0501048_0079127 3300049582 Bacteria 2320
482 Ga0501069_0000015 3300049585 Bacteria 144828
483 Ga0501070_0000005 3300049586 Bacteria 250033
484 Ga0501072_0048035 3300049588 Bacteria 3361
485 Ga0501072_0120312 3300049588 Bacteria 2092
486 Ga0501073_0252634 3300049589 Bacteria 1217
487 Ga0501075_0265262 3300049591 Bacteria 1309
488 Ga0501079_0357495 3300049741 Bacteria 1144
489 Ga0501080_0113700 3300049742 Bacteria 2510
490 Ga0501081_0059112 3300049743 Bacteria 2653
491 Ga0501081_0243136 3300049743 Bacteria 1313
492 Ga0501035_0021169 3300049822 Bacteria 5977
493 Ga0501044_0028149 3300049823 Bacteria 5932
494 Ga0501044_0197182 3300049823 Bacteria 1973
495 nmdc:mga06z11_103606_c1 3300050494 Bacteria 1565
496 nmdc:mga05p37_18065_c1 3300050507 Bacteria 8519
497 nmdc:mga05p37_988_c1 3300050507 Bacteria 32390
498 nmdc:mga09592_11_c2 3300050508 Bacteria 31986
499 nmdc:mga09592_15716_c1 3300050508 Bacteria 6185
500 nmdc:mga0qj67_122711_c1 3300050509 Bacteria 2102
501 nmdc:mga0qj67_2886_c1 3300050509 Bacteria 10551
502 nmdc:mga0qj67_95_c1 3300050509 Bacteria 59712
503 nmdc:mga06r32_31796_c1 3300050510 Bacteria 4960
504 nmdc:mga06r32_73821_c1 3300050510 Bacteria 3306
505 nmdc:mga08y16_23821_c1 3300050511 Bacteria 6465
506 nmdc:mga0n895_147901_c1 3300050512 Bacteria 2379
507 nmdc:mga0n895_53044_c1 3300050512 Bacteria 3982
508 nmdc:mga0n895_56284_c1 3300050512 Bacteria 3874
509 nmdc:mga0rr50_2965_c1 3300050513 Bacteria 9710
510 nmdc:mga0rr50_32652_c1 3300050513 Bacteria 3712
511 nmdc:mga0a205_22916_c1 3300050515 Bacteria 5921
512 nmdc:mga0a205_30741_c1 3300050515 Bacteria 5144
513 Ga0495619_0054362 3300053085 Bacteria 2650
514 Ga0500556_0000873 3300053104 Bacteria 17059
515 Ga0500593_000011 3300053117 Bacteria 62847
516 Ga0501084_0000039 3300054114 Bacteria 107409
517 Ga0501084_0219145 3300054114 Bacteria 1606
518 Ga0501082_0109127 3300060353 Bacteria 2395
519 Ga0530510_0172938 3300061734 Bacteria 1600

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10058599 Ga0207643_100585992 264
2 3300049571 Ga0501034_0223019 Ga0501034_0223019_641_1525 271
3 3300031733 Ga0316577_10001679 Ga0316577_100016794 282
4 3300003373 JGI25407J50210_10004461 JGI25407J50210_100044611 285
5 3300005981 Ga0081538_10000049 Ga0081538_1000004940 285
6 3300048917 Ga0496114_0396632 Ga0496114_0396632_54_980 286
7 3300005614 Ga0068856_100016290 Ga0068856_1000162907 288
8 3300026078 Ga0207702_10012065 Ga0207702_100120653 288
9 3300049572 Ga0501036_0532618 Ga0501036_0532618_17_886 288
10 3300013307 Ga0157372_10696458 Ga0157372_106964581 289
11 3300049580 Ga0501046_0161631 Ga0501046_0161631_113_982 289
12 3300013308 Ga0157375_10034939 Ga0157375_100349394 290
13 3300037466 Ga0395898_0010178 Ga0395898_0010178_862_1776 290
14 3300038443 Ga0395901_0040462 Ga0395901_0040462_3060_3974 290
15 3300044656 Ga0466969_0046218 Ga0466969_0046218_356_1270 290
16 3300044684 Ga0466966_0016415 Ga0466966_0016415_2086_3000 290
17 3300044694 Ga0466963_0015316 Ga0466963_0015316_1296_2210 290
18 3300044842 Ga0466957_0210089 Ga0466957_0210089_321_1235 290
19 3300045836 Ga0466958_0065680 Ga0466958_0065680_1146_2060 290
20 3300050515 nmdc:mga0a205_22916_c1 nmdc:mga0a205_22916_c1_1385_2284 290
21 3300049823 Ga0501044_0197182 Ga0501044_0197182_980_1918 291
22 3300049572 Ga0501036_0236158 Ga0501036_0236158_562_1455 296
23 3300060353 Ga0501082_0109127 Ga0501082_0109127_1098_1991 296
24 3300037418 Ga0395900_0001036 Ga0395900_0001036_24530_25441 297
25 3300037466 Ga0395898_0001318 Ga0395898_0001318_9584_10495 297
26 3300037466 Ga0395898_0244177 Ga0395898_0244177_285_1196 297
27 3300037471 Ga0395905_0007007 Ga0395905_0007007_6264_7175 297
28 3300048908 Ga0496105_0071739 Ga0496105_0071739_655_1599 297
29 3300050509 nmdc:mga0qj67_122711_c1 nmdc:mga0qj67_122711_c1_736_1629 297
30 3300009147 Ga0114129_10004129 Ga0114129_100041296 298
31 3300050507 nmdc:mga05p37_18065_c1 nmdc:mga05p37_18065_c1_1498_2394 298
32 3300050508 nmdc:mga09592_15716_c1 nmdc:mga09592_15716_c1_3328_4224 298
33 3300050510 nmdc:mga06r32_31796_c1 nmdc:mga06r32_31796_c1_305_1201 298
34 3300014325 Ga0163163_10182291 Ga0163163_101822912 300
35 3300046459 Ga0495629_0321513 Ga0495629_0321513_87_1016 300
36 3300046535 Ga0495586_0036394 Ga0495586_0036394_1440_2357 300
37 3300046642 Ga0495634_0033804 Ga0495634_0033804_2147_3064 300
38 3300049585 Ga0501069_0000015 Ga0501069_0000015_38744_39658 300
39 3300049586 Ga0501070_0000005 Ga0501070_0000005_194159_195073 300
40 3300049591 Ga0501075_0265262 Ga0501075_0265262_182_1105 300
41 3300049742 Ga0501080_0113700 Ga0501080_0113700_577_1503 300
42 3300050512 nmdc:mga0n895_53044_c1 nmdc:mga0n895_53044_c1_2267_3256 300
43 iso_pu_bacteria 2739367898 2740169179 300
44 iso_pu_bacteria 2773857762 2774392054 300
45 iso_pu_bacteria 2808606439 2809195843 300
46 iso_pu_bacteria 2811994878 2812352012 300
47 3300025933 Ga0207706_10113924 Ga0207706_101139242 301
48 3300049743 Ga0501081_0243136 Ga0501081_0243136_187_1095 301
49 3300061734 Ga0530510_0172938 Ga0530510_0172938_501_1409 301
50 3300005327 Ga0070658_10026555 Ga0070658_100265556 302
51 3300005336 Ga0070680_100019850 Ga0070680_1000198505 302
52 3300005337 Ga0070682_100036541 Ga0070682_1000365412 302
53 3300005339 Ga0070660_100039585 Ga0070660_1000395851 302
54 3300005339 Ga0070660_100044493 Ga0070660_1000444932 302
55 3300005435 Ga0070714_100019745 Ga0070714_1000197457 302
56 3300005530 Ga0070679_100039850 Ga0070679_1000398505 302
57 3300005563 Ga0068855_100087187 Ga0068855_1000871877 302
58 3300005563 Ga0068855_100249612 Ga0068855_1002496122 302
59 3300005981 Ga0081538_10038364 Ga0081538_100383643 302
60 3300006844 Ga0075428_100090538 Ga0075428_1000905382 302
61 3300006846 Ga0075430_100085669 Ga0075430_1000856693 302
62 3300006847 Ga0075431_100235015 Ga0075431_1002350153 302
63 3300009093 Ga0105240_10093724 Ga0105240_100937246 302
64 3300009147 Ga0114129_10000031 Ga0114129_10000031101 302
65 3300013104 Ga0157370_10034064 Ga0157370_100340643 302
66 3300013104 Ga0157370_10070116 Ga0157370_100701163 302
67 3300013105 Ga0157369_10009918 Ga0157369_1000991812 302
68 3300013105 Ga0157369_10027326 Ga0157369_100273265 302
69 3300013307 Ga0157372_10211441 Ga0157372_102114413 302
70 3300020070 Ga0206356_10427959 Ga0206356_104279594 302
71 3300020082 Ga0206353_11193225 Ga0206353_111932253 302
72 3300021441 Ga0213871_10066000 Ga0213871_100660001 302
73 3300025912 Ga0207707_10056943 Ga0207707_100569433 302
74 3300025917 Ga0207660_10007499 Ga0207660_1000749910 302
75 3300025919 Ga0207657_10003179 Ga0207657_1000317917 302
76 3300025921 Ga0207652_10053775 Ga0207652_100537752 302
77 3300025929 Ga0207664_10032082 Ga0207664_100320825 302
78 3300025949 Ga0207667_10030735 Ga0207667_100307352 302
79 3300037466 Ga0395898_0059579 Ga0395898_0059579_931_1869 302
80 3300039438 Ga0436360_0802153 Ga0436360_0802153_3287_4216 302
81 3300039438 Ga0436360_1224020 Ga0436360_1224020_102_1031 302
82 3300045976 Ga0466967_0608088 Ga0466967_0608088_104_1033 302
83 3300046660 Ga0495625_0006148 Ga0495625_0006148_4977_5921 302
84 3300047323 Ga0495683_0033576 Ga0495683_0033576_941_1885 302
85 3300048091 Ga0495626_0000784 Ga0495626_0000784_22724_23668 302
86 3300048915 Ga0496112_0051384 Ga0496112_0051384_2685_3614 302
87 3300049573 Ga0501037_0048648 Ga0501037_0048648_2080_3018 302
88 3300049589 Ga0501073_0252634 Ga0501073_0252634_264_1202 302
89 3300049741 Ga0501079_0357495 Ga0501079_0357495_144_1082 302
90 3300049743 Ga0501081_0059112 Ga0501081_0059112_1549_2487 302
91 3300050507 nmdc:mga05p37_988_c1 nmdc:mga05p37_988_c1_28879_29808 302
92 3300050508 nmdc:mga09592_11_c2 nmdc:mga09592_11_c2_28694_29623 302
93 3300050509 nmdc:mga0qj67_95_c1 nmdc:mga0qj67_95_c1_2364_3293 302
94 3300050510 nmdc:mga06r32_73821_c1 nmdc:mga06r32_73821_c1_14_943 302
95 3300054114 Ga0501084_0219145 Ga0501084_0219145_508_1446 302
96 iso_pu_bacteria 2675903059 2676482800 302
97 iso_pu_bacteria 8055066027 8055069151 302
98 3300002077 JGI24744J21845_10000545 JGI24744J21845_100005452 303
99 3300005327 Ga0070658_10040098 Ga0070658_100400983 303
100 3300005327 Ga0070658_10085736 Ga0070658_100857362 303
101 3300005328 Ga0070676_10036155 Ga0070676_100361552 303
102 3300005329 Ga0070683_100099023 Ga0070683_1000990233 303
103 3300005329 Ga0070683_100225704 Ga0070683_1002257041 303
104 3300005329 Ga0070683_100463737 Ga0070683_1004637372 303
105 3300005330 Ga0070690_100040037 Ga0070690_1000400372 303
106 3300005334 Ga0068869_100031104 Ga0068869_1000311044 303
107 3300005334 Ga0068869_100039413 Ga0068869_1000394133 303
108 3300005334 Ga0068869_100220673 Ga0068869_1002206732 303
109 3300005335 Ga0070666_10006718 Ga0070666_100067185 303
110 3300005335 Ga0070666_10086441 Ga0070666_100864412 303
111 3300005336 Ga0070680_100045197 Ga0070680_1000451974 303
112 3300005336 Ga0070680_100056004 Ga0070680_1000560043 303
113 3300005337 Ga0070682_100005590 Ga0070682_1000055903 303
114 3300005337 Ga0070682_100017200 Ga0070682_1000172004 303
115 3300005337 Ga0070682_100051246 Ga0070682_1000512462 303
116 3300005338 Ga0068868_100015311 Ga0068868_1000153115 303
117 3300005338 Ga0068868_100059582 Ga0068868_1000595823 303
118 3300005338 Ga0068868_100073754 Ga0068868_1000737544 303
119 3300005339 Ga0070660_100010729 Ga0070660_1000107295 303
120 3300005339 Ga0070660_100036062 Ga0070660_1000360623 303
121 3300005339 Ga0070660_100038745 Ga0070660_1000387453 303
122 3300005340 Ga0070689_100031570 Ga0070689_1000315702 303
123 3300005340 Ga0070689_100034973 Ga0070689_1000349732 303
124 3300005340 Ga0070689_100069027 Ga0070689_1000690273 303
125 3300005341 Ga0070691_10061776 Ga0070691_100617762 303
126 3300005343 Ga0070687_100051835 Ga0070687_1000518353 303
127 3300005344 Ga0070661_100125786 Ga0070661_1001257862 303
128 3300005345 Ga0070692_10005129 Ga0070692_100051291 303
129 3300005345 Ga0070692_10006244 Ga0070692_100062443 303
130 3300005345 Ga0070692_10077594 Ga0070692_100775942 303
131 3300005347 Ga0070668_100004474 Ga0070668_1000044748 303
132 3300005347 Ga0070668_100026766 Ga0070668_1000267662 303
133 3300005354 Ga0070675_100001736 Ga0070675_10000173610 303
134 3300005355 Ga0070671_100089434 Ga0070671_1000894342 303
135 3300005356 Ga0070674_100046836 Ga0070674_1000468362 303
136 3300005364 Ga0070673_100011571 Ga0070673_1000115712 303
137 3300005365 Ga0070688_100014703 Ga0070688_1000147034 303
138 3300005366 Ga0070659_100009691 Ga0070659_1000096914 303
139 3300005366 Ga0070659_100015288 Ga0070659_1000152882 303
140 3300005366 Ga0070659_100103578 Ga0070659_1001035783 303
141 3300005367 Ga0070667_100061539 Ga0070667_1000615392 303
142 3300005406 Ga0070703_10018689 Ga0070703_100186892 303
143 3300005406 Ga0070703_10027438 Ga0070703_100274382 303
144 3300005434 Ga0070709_10030733 Ga0070709_100307331 303
145 3300005435 Ga0070714_100024226 Ga0070714_1000242265 303
146 3300005436 Ga0070713_100225978 Ga0070713_1002259781 303
147 3300005438 Ga0070701_10004503 Ga0070701_100045034 303
148 3300005438 Ga0070701_10024991 Ga0070701_100249912 303
149 3300005439 Ga0070711_100001075 Ga0070711_1000010755 303
150 3300005439 Ga0070711_100018634 Ga0070711_1000186344 303
151 3300005440 Ga0070705_100012689 Ga0070705_1000126893 303
152 3300005441 Ga0070700_100007469 Ga0070700_1000074697 303
153 3300005441 Ga0070700_100018475 Ga0070700_1000184753 303
154 3300005441 Ga0070700_100271409 Ga0070700_1002714092 303
155 3300005444 Ga0070694_100021359 Ga0070694_1000213594 303
156 3300005445 Ga0070708_100245364 Ga0070708_1002453642 303
157 3300005455 Ga0070663_100004470 Ga0070663_1000044705 303
158 3300005455 Ga0070663_100007874 Ga0070663_1000078744 303
159 3300005455 Ga0070663_100030501 Ga0070663_1000305013 303
160 3300005456 Ga0070678_100019929 Ga0070678_1000199293 303
161 3300005456 Ga0070678_100261392 Ga0070678_1002613922 303
162 3300005457 Ga0070662_100015307 Ga0070662_1000153075 303
163 3300005457 Ga0070662_100037828 Ga0070662_1000378284 303
164 3300005459 Ga0068867_100010996 Ga0068867_1000109968 303
165 3300005466 Ga0070685_10006574 Ga0070685_100065743 303
166 3300005466 Ga0070685_10075681 Ga0070685_100756811 303
167 3300005467 Ga0070706_100010936 Ga0070706_10001093610 303
168 3300005467 Ga0070706_100033206 Ga0070706_1000332061 303
169 3300005467 Ga0070706_100123628 Ga0070706_1001236283 303
170 3300005468 Ga0070707_100000635 Ga0070707_10000063537 303
171 3300005468 Ga0070707_100012722 Ga0070707_1000127223 303
172 3300005468 Ga0070707_100031619 Ga0070707_1000316198 303
173 3300005471 Ga0070698_100001447 Ga0070698_10000144712 303
174 3300005471 Ga0070698_100121812 Ga0070698_1001218122 303
175 3300005518 Ga0070699_100004137 Ga0070699_10000413712 303
176 3300005518 Ga0070699_100345317 Ga0070699_1003453172 303
177 3300005530 Ga0070679_100130014 Ga0070679_1001300142 303
178 3300005535 Ga0070684_100007429 Ga0070684_1000074298 303
179 3300005536 Ga0070697_100039791 Ga0070697_1000397912 303
180 3300005539 Ga0068853_100024124 Ga0068853_1000241246 303
181 3300005539 Ga0068853_100128707 Ga0068853_1001287073 303
182 3300005543 Ga0070672_100016444 Ga0070672_1000164445 303
183 3300005543 Ga0070672_100228061 Ga0070672_1002280612 303
184 3300005544 Ga0070686_100009810 Ga0070686_1000098105 303
185 3300005545 Ga0070695_100077633 Ga0070695_1000776332 303
186 3300005546 Ga0070696_100070710 Ga0070696_1000707101 303
187 3300005546 Ga0070696_100084546 Ga0070696_1000845463 303
188 3300005547 Ga0070693_100017250 Ga0070693_1000172505 303
189 3300005547 Ga0070693_100033717 Ga0070693_1000337172 303
190 3300005548 Ga0070665_100003419 Ga0070665_10000341913 303
191 3300005548 Ga0070665_100032592 Ga0070665_1000325925 303
192 3300005548 Ga0070665_100072829 Ga0070665_1000728293 303
193 3300005549 Ga0070704_100223077 Ga0070704_1002230772 303
194 3300005563 Ga0068855_100033888 Ga0068855_1000338884 303
195 3300005563 Ga0068855_100086601 Ga0068855_1000866013 303
196 3300005563 Ga0068855_100089581 Ga0068855_1000895814 303
197 3300005563 Ga0068855_100105730 Ga0068855_1001057303 303
198 3300005564 Ga0070664_100101896 Ga0070664_1001018962 303
199 3300005577 Ga0068857_100008769 Ga0068857_1000087696 303
200 3300005578 Ga0068854_100082572 Ga0068854_1000825722 303
201 3300005614 Ga0068856_100039021 Ga0068856_1000390213 303
202 3300005614 Ga0068856_100046948 Ga0068856_1000469482 303
203 3300005614 Ga0068856_100335295 Ga0068856_1003352952 303
204 3300005615 Ga0070702_100001788 Ga0070702_1000017883 303
205 3300005615 Ga0070702_100012528 Ga0070702_1000125282 303
206 3300005615 Ga0070702_100043982 Ga0070702_1000439822 303
207 3300005616 Ga0068852_100002353 Ga0068852_10000235310 303
208 3300005616 Ga0068852_100009242 Ga0068852_1000092426 303
209 3300005616 Ga0068852_100054285 Ga0068852_1000542852 303
210 3300005616 Ga0068852_100218138 Ga0068852_1002181381 303
211 3300005617 Ga0068859_100075629 Ga0068859_1000756292 303
212 3300005618 Ga0068864_100035439 Ga0068864_1000354393 303
213 3300005718 Ga0068866_10007635 Ga0068866_100076355 303
214 3300005718 Ga0068866_10210285 Ga0068866_102102852 303
215 3300005719 Ga0068861_100011898 Ga0068861_1000118982 303
216 3300005719 Ga0068861_100090326 Ga0068861_1000903262 303
217 3300005834 Ga0068851_10006785 Ga0068851_100067854 303
218 3300005841 Ga0068863_100060043 Ga0068863_1000600434 303
219 3300005841 Ga0068863_100222824 Ga0068863_1002228242 303
220 3300005842 Ga0068858_100140183 Ga0068858_1001401832 303
221 3300005843 Ga0068860_100111399 Ga0068860_1001113992 303
222 3300005844 Ga0068862_100109523 Ga0068862_1001095232 303
223 3300005844 Ga0068862_100312772 Ga0068862_1003127722 303
224 3300005983 Ga0081540_1003473 Ga0081540_10034739 303
225 3300005985 Ga0081539_10038831 Ga0081539_100388312 303
226 3300006028 Ga0070717_10079799 Ga0070717_100797992 303
227 3300006038 Ga0075365_10185883 Ga0075365_101858832 303
228 3300006173 Ga0070716_100011674 Ga0070716_1000116744 303
229 3300006175 Ga0070712_100025640 Ga0070712_1000256403 303
230 3300006178 Ga0075367_10036937 Ga0075367_100369373 303
231 3300006237 Ga0097621_100013980 Ga0097621_1000139802 303
232 3300006237 Ga0097621_100015174 Ga0097621_1000151742 303
233 3300006237 Ga0097621_100048732 Ga0097621_1000487324 303
234 3300006358 Ga0068871_100006377 Ga0068871_1000063777 303
235 3300006358 Ga0068871_100014424 Ga0068871_1000144246 303
236 3300006358 Ga0068871_100041942 Ga0068871_1000419423 303
237 3300006844 Ga0075428_100062002 Ga0075428_1000620024 303
238 3300006846 Ga0075430_100003484 Ga0075430_1000034842 303
239 3300006846 Ga0075430_100136720 Ga0075430_1001367202 303
240 3300006847 Ga0075431_100012225 Ga0075431_1000122256 303
241 3300006852 Ga0075433_10425664 Ga0075433_104256642 303
242 3300006880 Ga0075429_100013032 Ga0075429_1000130328 303
243 3300006881 Ga0068865_100004949 Ga0068865_1000049492 303
244 3300006881 Ga0068865_100014446 Ga0068865_1000144463 303
245 3300006914 Ga0075436_100005573 Ga0075436_1000055731 303
246 3300006914 Ga0075436_100058529 Ga0075436_1000585292 303
247 3300006931 Ga0097620_100075631 Ga0097620_1000756312 303
248 3300007076 Ga0075435_100014980 Ga0075435_1000149806 303
249 3300007076 Ga0075435_100020196 Ga0075435_1000201964 303
250 3300009093 Ga0105240_10118923 Ga0105240_101189234 303
251 3300009094 Ga0111539_10045488 Ga0111539_100454884 303
252 3300009098 Ga0105245_10044961 Ga0105245_100449613 303
253 3300009098 Ga0105245_10046722 Ga0105245_100467222 303
254 3300009101 Ga0105247_10005243 Ga0105247_100052435 303
255 3300009101 Ga0105247_10033774 Ga0105247_100337742 303
256 3300009148 Ga0105243_10030792 Ga0105243_100307924 303
257 3300009148 Ga0105243_10038471 Ga0105243_100384713 303
258 3300009148 Ga0105243_10067972 Ga0105243_100679722 303
259 3300009174 Ga0105241_10033100 Ga0105241_100331003 303
260 3300009176 Ga0105242_10014129 Ga0105242_100141294 303
261 3300009176 Ga0105242_10181238 Ga0105242_101812382 303
262 3300009177 Ga0105248_10026459 Ga0105248_100264595 303
263 3300009177 Ga0105248_10045083 Ga0105248_100450832 303
264 3300009177 Ga0105248_10047870 Ga0105248_100478702 303
265 3300009177 Ga0105248_10166209 Ga0105248_101662092 303
266 3300009545 Ga0105237_10164035 Ga0105237_101640352 303
267 3300009551 Ga0105238_10041390 Ga0105238_100413902 303
268 3300009551 Ga0105238_10086054 Ga0105238_100860542 303
269 3300009553 Ga0105249_10001347 Ga0105249_1000134714 303
270 3300009553 Ga0105249_10024591 Ga0105249_100245916 303
271 3300009553 Ga0105249_10576702 Ga0105249_105767021 303
272 3300010375 Ga0105239_10009547 Ga0105239_100095477 303
273 3300010375 Ga0105239_10057810 Ga0105239_100578104 303
274 3300011119 Ga0105246_10398628 Ga0105246_103986282 303
275 3300013102 Ga0157371_10010959 Ga0157371_100109596 303
276 3300013104 Ga0157370_10109761 Ga0157370_101097613 303
277 3300013105 Ga0157369_10254116 Ga0157369_102541162 303
278 3300013296 Ga0157374_10015577 Ga0157374_100155776 303
279 3300013297 Ga0157378_10006940 Ga0157378_100069405 303
280 3300013297 Ga0157378_10223309 Ga0157378_102233092 303
281 3300013306 Ga0163162_10013364 Ga0163162_100133644 303
282 3300013306 Ga0163162_10027647 Ga0163162_100276474 303
283 3300013308 Ga0157375_10024586 Ga0157375_100245862 303
284 3300013308 Ga0157375_10064065 Ga0157375_100640652 303
285 3300013308 Ga0157375_10083117 Ga0157375_100831173 303
286 3300014325 Ga0163163_10029525 Ga0163163_100295255 303
287 3300014325 Ga0163163_10033950 Ga0163163_100339502 303
288 3300014326 Ga0157380_10008097 Ga0157380_100080975 303
289 3300014745 Ga0157377_10005998 Ga0157377_100059985 303
290 3300014745 Ga0157377_10022170 Ga0157377_100221704 303
291 3300014968 Ga0157379_10505087 Ga0157379_105050871 303
292 3300014969 Ga0157376_10020185 Ga0157376_100201855 303
293 3300014969 Ga0157376_10036577 Ga0157376_100365774 303
294 3300017792 Ga0163161_10010508 Ga0163161_100105085 303
295 3300020081 Ga0206354_10719510 Ga0206354_107195103 303
296 3300020081 Ga0206354_10843100 Ga0206354_108431002 303
297 3300025898 Ga0207692_10004373 Ga0207692_100043732 303
298 3300025899 Ga0207642_10004902 Ga0207642_100049025 303
299 3300025900 Ga0207710_10130136 Ga0207710_101301361 303
300 3300025901 Ga0207688_10023993 Ga0207688_100239932 303
301 3300025901 Ga0207688_10036365 Ga0207688_100363651 303
302 3300025901 Ga0207688_10044967 Ga0207688_100449672 303
303 3300025903 Ga0207680_10026642 Ga0207680_100266423 303
304 3300025903 Ga0207680_10056408 Ga0207680_100564083 303
305 3300025904 Ga0207647_10008509 Ga0207647_100085096 303
306 3300025904 Ga0207647_10033696 Ga0207647_100336963 303
307 3300025906 Ga0207699_10041704 Ga0207699_100417043 303
308 3300025907 Ga0207645_10067108 Ga0207645_100671083 303
309 3300025907 Ga0207645_10090760 Ga0207645_100907603 303
310 3300025908 Ga0207643_10000112 Ga0207643_1000011211 303
311 3300025909 Ga0207705_10094338 Ga0207705_100943382 303
312 3300025909 Ga0207705_10171805 Ga0207705_101718052 303
313 3300025910 Ga0207684_10091589 Ga0207684_100915892 303
314 3300025911 Ga0207654_10096048 Ga0207654_100960481 303
315 3300025914 Ga0207671_10052335 Ga0207671_100523352 303
316 3300025914 Ga0207671_10127655 Ga0207671_101276552 303
317 3300025915 Ga0207693_10000409 Ga0207693_1000040915 303
318 3300025915 Ga0207693_10001176 Ga0207693_1000117613 303
319 3300025916 Ga0207663_10060209 Ga0207663_100602092 303
320 3300025917 Ga0207660_10222278 Ga0207660_102222782 303
321 3300025918 Ga0207662_10052854 Ga0207662_100528542 303
322 3300025919 Ga0207657_10005213 Ga0207657_100052138 303
323 3300025919 Ga0207657_10065016 Ga0207657_100650162 303
324 3300025919 Ga0207657_10119832 Ga0207657_101198322 303
325 3300025921 Ga0207652_10012926 Ga0207652_100129265 303
326 3300025921 Ga0207652_10045951 Ga0207652_100459514 303
327 3300025922 Ga0207646_10002084 Ga0207646_1000208424 303
328 3300025922 Ga0207646_10007636 Ga0207646_1000763611 303
329 3300025924 Ga0207694_10047309 Ga0207694_100473092 303
330 3300025925 Ga0207650_10004590 Ga0207650_100045905 303
331 3300025926 Ga0207659_10005948 Ga0207659_100059484 303
332 3300025927 Ga0207687_10003050 Ga0207687_100030503 303
333 3300025927 Ga0207687_10056798 Ga0207687_100567981 303
334 3300025928 Ga0207700_10123007 Ga0207700_101230072 303
335 3300025929 Ga0207664_10025967 Ga0207664_100259675 303
336 3300025929 Ga0207664_10042739 Ga0207664_100427392 303
337 3300025931 Ga0207644_10081838 Ga0207644_100818383 303
338 3300025931 Ga0207644_10100121 Ga0207644_101001213 303
339 3300025932 Ga0207690_10027965 Ga0207690_100279653 303
340 3300025932 Ga0207690_10090892 Ga0207690_100908922 303
341 3300025932 Ga0207690_10108327 Ga0207690_101083272 303
342 3300025932 Ga0207690_10352944 Ga0207690_103529441 303
343 3300025933 Ga0207706_10003043 Ga0207706_100030437 303
344 3300025933 Ga0207706_10024684 Ga0207706_100246845 303
345 3300025934 Ga0207686_10003864 Ga0207686_100038645 303
346 3300025934 Ga0207686_10026043 Ga0207686_100260434 303
347 3300025935 Ga0207709_10012187 Ga0207709_100121874 303
348 3300025935 Ga0207709_10062374 Ga0207709_100623742 303
349 3300025937 Ga0207669_10021389 Ga0207669_100213894 303
350 3300025937 Ga0207669_10072106 Ga0207669_100721063 303
351 3300025938 Ga0207704_10005166 Ga0207704_100051667 303
352 3300025938 Ga0207704_10079420 Ga0207704_100794202 303
353 3300025939 Ga0207665_10006099 Ga0207665_100060994 303
354 3300025939 Ga0207665_10181263 Ga0207665_101812632 303
355 3300025940 Ga0207691_10022722 Ga0207691_100227225 303
356 3300025940 Ga0207691_10142454 Ga0207691_101424543 303
357 3300025942 Ga0207689_10000247 Ga0207689_1000024739 303
358 3300025942 Ga0207689_10057931 Ga0207689_100579313 303
359 3300025944 Ga0207661_10021608 Ga0207661_100216085 303
360 3300025944 Ga0207661_10025730 Ga0207661_100257304 303
361 3300025944 Ga0207661_10079054 Ga0207661_100790542 303
362 3300025945 Ga0207679_10187512 Ga0207679_101875121 303
363 3300025949 Ga0207667_10019931 Ga0207667_100199318 303
364 3300025949 Ga0207667_10273780 Ga0207667_102737802 303
365 3300025960 Ga0207651_10041567 Ga0207651_100415672 303
366 3300025972 Ga0207668_10008002 Ga0207668_100080025 303
367 3300025972 Ga0207668_10127140 Ga0207668_101271401 303
368 3300025981 Ga0207640_10061985 Ga0207640_100619852 303
369 3300026023 Ga0207677_10009652 Ga0207677_100096522 303
370 3300026035 Ga0207703_10185058 Ga0207703_101850582 303
371 3300026035 Ga0207703_10201433 Ga0207703_102014332 303
372 3300026067 Ga0207678_10002660 Ga0207678_1000266011 303
373 3300026067 Ga0207678_10004730 Ga0207678_100047305 303
374 3300026067 Ga0207678_10006233 Ga0207678_100062334 303
375 3300026067 Ga0207678_10007527 Ga0207678_100075273 303
376 3300026075 Ga0207708_10001288 Ga0207708_1000128818 303
377 3300026075 Ga0207708_10010392 Ga0207708_100103925 303
378 3300026075 Ga0207708_10168519 Ga0207708_101685192 303
379 3300026078 Ga0207702_10003223 Ga0207702_100032235 303
380 3300026078 Ga0207702_10025530 Ga0207702_100255303 303
381 3300026078 Ga0207702_10065017 Ga0207702_100650172 303
382 3300026078 Ga0207702_10159160 Ga0207702_101591602 303
383 3300026088 Ga0207641_10201328 Ga0207641_102013282 303
384 3300026088 Ga0207641_10205724 Ga0207641_102057241 303
385 3300026089 Ga0207648_10000136 Ga0207648_1000013661 303
386 3300026095 Ga0207676_10001377 Ga0207676_1000137711 303
387 3300026116 Ga0207674_10023525 Ga0207674_100235254 303
388 3300026118 Ga0207675_100053991 Ga0207675_1000539912 303
389 3300026118 Ga0207675_100102502 Ga0207675_1001025022 303
390 3300026118 Ga0207675_100117780 Ga0207675_1001177802 303
391 3300026121 Ga0207683_10000371 Ga0207683_1000037132 303
392 3300026121 Ga0207683_10001767 Ga0207683_1000176712 303
393 3300026121 Ga0207683_10005450 Ga0207683_1000545010 303
394 3300027907 Ga0207428_10017252 Ga0207428_100172524 303
395 3300027907 Ga0207428_10028153 Ga0207428_100281531 303
396 3300028379 Ga0268266_10017670 Ga0268266_100176705 303
397 3300028380 Ga0268265_10075331 Ga0268265_100753312 303
398 3300028380 Ga0268265_10251362 Ga0268265_102513622 303
399 3300028381 Ga0268264_10027520 Ga0268264_100275205 303
400 3300028381 Ga0268264_10143485 Ga0268264_101434852 303
401 3300028381 Ga0268264_10526121 Ga0268264_105261212 303
402 3300031733 Ga0316577_10153117 Ga0316577_101531171 303
403 3300031852 Ga0307410_10256611 Ga0307410_102566112 303
404 3300031901 Ga0307406_10008721 Ga0307406_100087214 303
405 3300031901 Ga0307406_10072018 Ga0307406_100720182 303
406 3300031903 Ga0307407_10232777 Ga0307407_102327772 303
407 3300033179 Ga0307507_10000090 Ga0307507_10000090106 303
408 3300034957 Ga0373938_0007430 Ga0373938_0007430_824_1762 303
409 3300034957 Ga0373938_0018038 Ga0373938_0018038_411_1325 303
410 3300035091 Ga0373951_0021390 Ga0373951_0021390_312_1250 303
411 3300035170 Ga0373943_0143582 Ga0373943_0143582_166_1095 303
412 3300035691 Ga0373931_0063704 Ga0373931_0063704_814_1752 303
413 3300037312 Ga0395899_0007122 Ga0395899_0007122_280_1236 303
414 3300037312 Ga0395899_0013580 Ga0395899_0013580_2837_3772 303
415 3300037312 Ga0395899_0088251 Ga0395899_0088251_496_1425 303
416 3300037418 Ga0395900_0093344 Ga0395900_0093344_95_1051 303
417 3300037471 Ga0395905_0304086 Ga0395905_0304086_432_1388 303
418 3300037853 Ga0436364_1475170 Ga0436364_1475170_2469_3431 303
419 3300038443 Ga0395901_0442324 Ga0395901_0442324_280_1236 303
420 3300038735 Ga0400485_15906 Ga0400485_15906_1082_2020 303
421 3300041456 Ga0451795_1479959 Ga0451795_1479959_953_1882 303
422 3300041459 Ga0451800_0130591 Ga0451800_0130591_177_1106 303
423 3300041491 Ga0451833_0174647 Ga0451833_0174647_1200_2129 303
424 3300041496 Ga0451839_1186836 Ga0451839_1186836_1250_2179 303
425 3300041512 Ga0451853_1398733 Ga0451853_1398733_1118_2047 303
426 3300042008 Ga0439450_025599 Ga0439450_025599_121_1038 303
427 3300042157 Ga0439458_0021472 Ga0439458_0021472_399_1337 303
428 3300042438 Ga0439459_0004658 Ga0439459_0004658_356_1294 303
429 3300044694 Ga0466963_0067077 Ga0466963_0067077_1209_2252 303
430 3300044694 Ga0466963_0138280 Ga0466963_0138280_441_1484 303
431 3300044765 Ga0466970_0017951 Ga0466970_0017951_2649_3590 303
432 3300044842 Ga0466957_0023206 Ga0466957_0023206_1971_3002 303
433 3300044842 Ga0466957_0122923 Ga0466957_0122923_357_1400 303
434 3300044901 Ga0466960_0006554 Ga0466960_0006554_2923_3915 303
435 3300044901 Ga0466960_0008279 Ga0466960_0008279_3171_4163 303
436 3300044901 Ga0466960_0020471 Ga0466960_0020471_1819_2850 303
437 3300045836 Ga0466958_0010057 Ga0466958_0010057_3010_4119 303
438 3300045976 Ga0466967_0070336 Ga0466967_0070336_1090_2121 303
439 3300046455 Ga0495603_0163354 Ga0495603_0163354_130_1089 303
440 3300046461 Ga0495641_0046397 Ga0495641_0046397_781_1740 303
441 3300046473 Ga0495582_0019253 Ga0495582_0019253_1043_2002 303
442 3300046473 Ga0495582_0051079 Ga0495582_0051079_151_1110 303
443 3300046500 Ga0495596_0081277 Ga0495596_0081277_91_1020 303
444 3300046501 Ga0495607_0071824 Ga0495607_0071824_543_1502 303
445 3300046516 Ga0495628_0233265 Ga0495628_0233265_391_1305 303
446 3300046525 Ga0495663_0022204 Ga0495663_0022204_388_1317 303
447 3300046538 Ga0495609_0072193 Ga0495609_0072193_57_1004 303
448 3300046615 Ga0495656_0062822 Ga0495656_0062822_320_1279 303
449 3300046616 Ga0495668_0075739 Ga0495668_0075739_533_1462 303
450 3300046674 Ga0495588_0206037 Ga0495588_0206037_38_982 303
451 3300046681 Ga0495647_0045356 Ga0495647_0045356_60_1019 303
452 3300046794 Ga0495589_0089684 Ga0495589_0089684_178_1107 303
453 3300047321 Ga0495676_0104132 Ga0495676_0104132_260_1219 303
454 3300047445 Ga0495677_0067882 Ga0495677_0067882_245_1204 303
455 3300047471 Ga0495684_0050774 Ga0495684_0050774_1395_2309 303
456 3300048089 Ga0495614_0060465 Ga0495614_0060465_432_1391 303
457 3300048903 Ga0496100_0234149 Ga0496100_0234149_301_1239 303
458 3300048904 Ga0496101_0001995 Ga0496101_0001995_8299_9258 303
459 3300048904 Ga0496101_0321973 Ga0496101_0321973_144_1082 303
460 3300048905 Ga0496102_0015059 Ga0496102_0015059_2474_3433 303
461 3300048905 Ga0496102_0105287 Ga0496102_0105287_1014_1952 303
462 3300048906 Ga0496103_0004353 Ga0496103_0004353_4744_5703 303
463 3300048907 Ga0496104_0054633 Ga0496104_0054633_715_1752 303
464 3300048907 Ga0496104_0139194 Ga0496104_0139194_41_979 303
465 3300048908 Ga0496105_0013282 Ga0496105_0013282_4170_5108 303
466 3300048908 Ga0496105_0045250 Ga0496105_0045250_54_983 303
467 3300048908 Ga0496105_0178068 Ga0496105_0178068_147_1085 303
468 3300048908 Ga0496105_0211082 Ga0496105_0211082_551_1510 303
469 3300048909 Ga0496106_0003272 Ga0496106_0003272_3648_4586 303
470 3300048909 Ga0496106_0003308 Ga0496106_0003308_7316_8275 303
471 3300048910 Ga0496107_0014241 Ga0496107_0014241_2456_3415 303
472 3300048911 Ga0496108_0009239 Ga0496108_0009239_1071_2108 303
473 3300048911 Ga0496108_0112864 Ga0496108_0112864_10_948 303
474 3300048911 Ga0496108_0175768 Ga0496108_0175768_746_1684 303
475 3300048911 Ga0496108_0265716 Ga0496108_0265716_260_1273 303
476 3300048912 Ga0496109_0004612 Ga0496109_0004612_7022_8059 303
477 3300048912 Ga0496109_0020626 Ga0496109_0020626_1205_2164 303
478 3300048912 Ga0496109_0032504 Ga0496109_0032504_174_1112 303
479 3300048912 Ga0496109_0037431 Ga0496109_0037431_1333_2271 303
480 3300048912 Ga0496109_0482993 Ga0496109_0482993_73_1086 303
481 3300048913 Ga0496110_0007957 Ga0496110_0007957_4520_5557 303
482 3300048913 Ga0496110_0058833 Ga0496110_0058833_1979_2917 303
483 3300048913 Ga0496110_0090814 Ga0496110_0090814_283_1212 303
484 3300048913 Ga0496110_0146853 Ga0496110_0146853_1070_2008 303
485 3300048914 Ga0496111_0004766 Ga0496111_0004766_7516_8454 303
486 3300048914 Ga0496111_0011523 Ga0496111_0011523_516_1553 303
487 3300048915 Ga0496112_0016365 Ga0496112_0016365_1177_2106 303
488 3300048915 Ga0496112_0020727 Ga0496112_0020727_397_1356 303
489 3300048915 Ga0496112_0081851 Ga0496112_0081851_1338_2276 303
490 3300048917 Ga0496114_0039819 Ga0496114_0039819_450_1388 303
491 3300048918 Ga0496115_0003007 Ga0496115_0003007_6702_7661 303
492 3300048918 Ga0496115_0003930 Ga0496115_0003930_7734_8672 303
493 3300049569 Ga0501032_0014627 Ga0501032_0014627_1239_2276 303
494 3300049571 Ga0501034_0042176 Ga0501034_0042176_2171_3208 303
495 3300049572 Ga0501036_0105172 Ga0501036_0105172_362_1399 303
496 3300049572 Ga0501036_0158258 Ga0501036_0158258_957_1871 303
497 3300049574 Ga0501038_0003462 Ga0501038_0003462_5482_6519 303
498 3300049575 Ga0501039_0043255 Ga0501039_0043255_467_1381 303
499 3300049576 Ga0501040_0010511 Ga0501040_0010511_3546_4460 303
500 3300049580 Ga0501046_0163438 Ga0501046_0163438_605_1642 303
501 3300049581 Ga0501047_0003842 Ga0501047_0003842_8415_9452 303
502 3300049582 Ga0501048_0001586 Ga0501048_0001586_14389_15426 303
503 3300049582 Ga0501048_0079127 Ga0501048_0079127_425_1339 303
504 3300049588 Ga0501072_0120312 Ga0501072_0120312_1059_2057 303
505 3300049822 Ga0501035_0021169 Ga0501035_0021169_3180_4217 303
506 3300049823 Ga0501044_0028149 Ga0501044_0028149_3248_4285 303
507 3300050494 nmdc:mga06z11_103606_c1 nmdc:mga06z11_103606_c1_132_1046 303
508 3300050509 nmdc:mga0qj67_2886_c1 nmdc:mga0qj67_2886_c1_624_1556 303
509 3300050511 nmdc:mga08y16_23821_c1 nmdc:mga08y16_23821_c1_3714_4652 303
510 3300050512 nmdc:mga0n895_147901_c1 nmdc:mga0n895_147901_c1_10_948 303
511 3300050512 nmdc:mga0n895_56284_c1 nmdc:mga0n895_56284_c1_194_1132 303
512 3300050513 nmdc:mga0rr50_2965_c1 nmdc:mga0rr50_2965_c1_1085_2023 303
513 3300050513 nmdc:mga0rr50_32652_c1 nmdc:mga0rr50_32652_c1_958_1896 303
514 3300050515 nmdc:mga0a205_30741_c1 nmdc:mga0a205_30741_c1_2037_2975 303
515 3300053085 Ga0495619_0054362 Ga0495619_0054362_120_1034 303
516 3300053104 Ga0500556_0000873 Ga0500556_0000873_180_1094 303
517 3300053117 Ga0500593_000011 Ga0500593_000011_45682_46596 303
518 iso_pu_bacteria 2515154155 2515855055 303
519 iso_pu_bacteria 2837268691 2837273106 303
520 iso_pu_bacteria 2868088558 2868091040 303
521 iso_pu_bacteria 2891968417 2891970333 303
522 3300005436 Ga0070713_100265278 Ga0070713_1002652782 304
523 3300048912 Ga0496109_0008315 Ga0496109_0008315_1692_2618 304
524 3300048915 Ga0496112_0001031 Ga0496112_0001031_13010_13936 304
525 3300049588 Ga0501072_0048035 Ga0501072_0048035_1006_1953 304
526 3300054114 Ga0501084_0000039 Ga0501084_0000039_49365_50312 304
527 3300001990 JGI24737J22298_10030121 JGI24737J22298_100301212 307
528 3300009098 Ga0105245_10322263 Ga0105245_103222632 307
529 3300031456 Ga0307513_10235564 Ga0307513_102355642 307
530 iso_pu_bacteria 2816332119 2816427906 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

71

215

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

157

245

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9401 2 222
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9367 14 219
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.9301 2 214
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9296 2 221
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9292 3 221
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9673 2 222 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9673 2 214 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9669 2 214 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9668 2 224 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 2 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0R0D0B4-F1-model_v4 ABC transporter domain-containing protein 0.9716 2 219 GO:0005524
GO:0016887
AF-A0A1V5YM67-F1-model_v4 Daunorubicin/doxorubicin resistance ATP-binding protein DrrA (EC 3.6.3.-) 0.9699 2 215 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A535F3M6-F1-model_v4 ABC transporter ATP-binding protein 0.969 2 221 GO:0005524
GO:0016887
AF-A0A381GRC3-F1-model_v4 deleted 0.9688 2 214
AF-A0A3D2KNM8-F1-model_v4 ABC transporter 0.9687 1 221 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.37 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map