F459993
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 530 | 299 | 519 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0010057|Ga0466958_0010057_3010_4119 |
| Length | 358 |
| Sequence | LETVGPIGYTYRDGLIRPIAVPLEPLVSRADSDIAGDVATDVDAGGPGALPAEVYIEAVGLEKRFGDYLAVDGIDFRVRRGEAFGFLGPNGAGKSSTMRMIGCVSPVTAGSLRILGLDPAADGPAIRRRLGVVPQDDTLDMELTVRENILVYGRYFDLPRREIRARADELLEFVQLAERSDAKVEHLSGGMRRRLTIARSLVNDPDVLLLDEPTTGLDPQARHVVWDRLYRLKQRGVTLVLTTHYMDEAEQLCDRLVVMDKGRIAAEGSPMELIGRYSSREVLELRFAPGEAEHRVADVEDLAERVEVLPDRLLLYADDGEAAAARVHARGVVPISMLVRRSTLEDVFLRLTGRTLID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 3 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 4 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 5 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 6 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 7 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 8 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 9 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 10 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 198 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 199 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 213 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 216 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 217 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 296 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 299 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.17 |
| Metatranscriptomes | 0.75 |
| Isolates | 2.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 8.11 |
| Rhizosphere | 88.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10030121 | 3300001990 | Bacteria | 1699 |
| 2 | JGI24744J21845_10000545 | 3300002077 | Bacteria | 6764 |
| 3 | JGI25407J50210_10004461 | 3300003373 | Bacteria | 3405 |
| 4 | Ga0070658_10026555 | 3300005327 | Bacteria | 4645 |
| 5 | Ga0070658_10040098 | 3300005327 | Bacteria | 3778 |
| 6 | Ga0070658_10085736 | 3300005327 | Bacteria | 2590 |
| 7 | Ga0070676_10036155 | 3300005328 | Bacteria | 2844 |
| 8 | Ga0070683_100099023 | 3300005329 | Bacteria | 2744 |
| 9 | Ga0070683_100225704 | 3300005329 | Bacteria | 1780 |
| 10 | Ga0070683_100463737 | 3300005329 | Bacteria | 1209 |
| 11 | Ga0070690_100040037 | 3300005330 | Bacteria | 2963 |
| 12 | Ga0068869_100031104 | 3300005334 | Bacteria | 3754 |
| 13 | Ga0068869_100039413 | 3300005334 | Bacteria | 3373 |
| 14 | Ga0068869_100220673 | 3300005334 | Bacteria | 1502 |
| 15 | Ga0070666_10006718 | 3300005335 | Bacteria | 7082 |
| 16 | Ga0070666_10086441 | 3300005335 | Bacteria | 2148 |
| 17 | Ga0070680_100019850 | 3300005336 | Bacteria | 5329 |
| 18 | Ga0070680_100045197 | 3300005336 | Bacteria | 3580 |
| 19 | Ga0070680_100056004 | 3300005336 | Bacteria | 3223 |
| 20 | Ga0070682_100005590 | 3300005337 | Bacteria | 7006 |
| 21 | Ga0070682_100017200 | 3300005337 | Bacteria | 4213 |
| 22 | Ga0070682_100036541 | 3300005337 | Bacteria | 3003 |
| 23 | Ga0070682_100051246 | 3300005337 | Bacteria | 2579 |
| 24 | Ga0068868_100015311 | 3300005338 | Bacteria | 5669 |
| 25 | Ga0068868_100059582 | 3300005338 | Bacteria | 3020 |
| 26 | Ga0068868_100073754 | 3300005338 | Bacteria | 2725 |
| 27 | Ga0070660_100010729 | 3300005339 | Bacteria | 6484 |
| 28 | Ga0070660_100036062 | 3300005339 | Bacteria | 3744 |
| 29 | Ga0070660_100038745 | 3300005339 | Bacteria | 3619 |
| 30 | Ga0070660_100039585 | 3300005339 | Bacteria | 3584 |
| 31 | Ga0070660_100044493 | 3300005339 | Bacteria | 3397 |
| 32 | Ga0070689_100031570 | 3300005340 | Bacteria | 4027 |
| 33 | Ga0070689_100034973 | 3300005340 | Bacteria | 3836 |
| 34 | Ga0070689_100069027 | 3300005340 | Bacteria | 2757 |
| 35 | Ga0070691_10061776 | 3300005341 | Bacteria | 1803 |
| 36 | Ga0070687_100051835 | 3300005343 | Bacteria | 2127 |
| 37 | Ga0070661_100125786 | 3300005344 | Bacteria | 1923 |
| 38 | Ga0070692_10005129 | 3300005345 | Bacteria | 5544 |
| 39 | Ga0070692_10006244 | 3300005345 | Bacteria | 5160 |
| 40 | Ga0070692_10077594 | 3300005345 | Bacteria | 1782 |
| 41 | Ga0070668_100004474 | 3300005347 | Bacteria | 10363 |
| 42 | Ga0070668_100026766 | 3300005347 | Bacteria | 4378 |
| 43 | Ga0070675_100001736 | 3300005354 | Bacteria | 16094 |
| 44 | Ga0070671_100089434 | 3300005355 | Bacteria | 2578 |
| 45 | Ga0070674_100046836 | 3300005356 | Bacteria | 2960 |
| 46 | Ga0070673_100011571 | 3300005364 | Bacteria | 6028 |
| 47 | Ga0070688_100014703 | 3300005365 | Bacteria | 4439 |
| 48 | Ga0070659_100009691 | 3300005366 | Bacteria | 7079 |
| 49 | Ga0070659_100015288 | 3300005366 | Bacteria | 5746 |
| 50 | Ga0070659_100103578 | 3300005366 | Bacteria | 2292 |
| 51 | Ga0070667_100061539 | 3300005367 | Bacteria | 3178 |
| 52 | Ga0070703_10018689 | 3300005406 | Bacteria | 2007 |
| 53 | Ga0070703_10027438 | 3300005406 | Bacteria | 1697 |
| 54 | Ga0070709_10030733 | 3300005434 | Bacteria | 3226 |
| 55 | Ga0070714_100019745 | 3300005435 | Bacteria | 5496 |
| 56 | Ga0070714_100024226 | 3300005435 | Bacteria | 4994 |
| 57 | Ga0070713_100225978 | 3300005436 | Bacteria | 1700 |
| 58 | Ga0070713_100265278 | 3300005436 | Bacteria | 1571 |
| 59 | Ga0070701_10004503 | 3300005438 | Bacteria | 5653 |
| 60 | Ga0070701_10024991 | 3300005438 | Bacteria | 2896 |
| 61 | Ga0070711_100001075 | 3300005439 | Bacteria | 14603 |
| 62 | Ga0070711_100018634 | 3300005439 | Bacteria | 4435 |
| 63 | Ga0070705_100012689 | 3300005440 | Bacteria | 4291 |
| 64 | Ga0070700_100007469 | 3300005441 | Bacteria | 5906 |
| 65 | Ga0070700_100018475 | 3300005441 | Bacteria | 4008 |
| 66 | Ga0070700_100271409 | 3300005441 | Bacteria | 1226 |
| 67 | Ga0070694_100021359 | 3300005444 | Bacteria | 4135 |
| 68 | Ga0070708_100245364 | 3300005445 | Bacteria | 1682 |
| 69 | Ga0070663_100004470 | 3300005455 | Bacteria | 8232 |
| 70 | Ga0070663_100007874 | 3300005455 | Bacteria | 6518 |
| 71 | Ga0070663_100030501 | 3300005455 | Bacteria | 3696 |
| 72 | Ga0070678_100019929 | 3300005456 | Bacteria | 4388 |
| 73 | Ga0070678_100261392 | 3300005456 | Bacteria | 1456 |
| 74 | Ga0070662_100015307 | 3300005457 | Bacteria | 5135 |
| 75 | Ga0070662_100037828 | 3300005457 | Bacteria | 3424 |
| 76 | Ga0068867_100010996 | 3300005459 | Bacteria | 6381 |
| 77 | Ga0070685_10006574 | 3300005466 | Bacteria | 5930 |
| 78 | Ga0070685_10075681 | 3300005466 | Bacteria | 2006 |
| 79 | Ga0070706_100010936 | 3300005467 | Bacteria | 8426 |
| 80 | Ga0070706_100033206 | 3300005467 | Bacteria | 4763 |
| 81 | Ga0070706_100123628 | 3300005467 | Bacteria | 2412 |
| 82 | Ga0070707_100000635 | 3300005468 | Bacteria | 35108 |
| 83 | Ga0070707_100012722 | 3300005468 | Bacteria | 7856 |
| 84 | Ga0070707_100031619 | 3300005468 | Bacteria | 5043 |
| 85 | Ga0070698_100001447 | 3300005471 | Bacteria | 26354 |
| 86 | Ga0070698_100121812 | 3300005471 | Bacteria | 2567 |
| 87 | Ga0070699_100004137 | 3300005518 | Bacteria | 12817 |
| 88 | Ga0070699_100345317 | 3300005518 | Bacteria | 1340 |
| 89 | Ga0070679_100039850 | 3300005530 | Bacteria | 4670 |
| 90 | Ga0070679_100130014 | 3300005530 | Bacteria | 2499 |
| 91 | Ga0070684_100007429 | 3300005535 | Bacteria | 8517 |
| 92 | Ga0070697_100039791 | 3300005536 | Bacteria | 3802 |
| 93 | Ga0068853_100024124 | 3300005539 | Bacteria | 5098 |
| 94 | Ga0068853_100128707 | 3300005539 | Bacteria | 2264 |
| 95 | Ga0070672_100016444 | 3300005543 | Bacteria | 5297 |
| 96 | Ga0070672_100228061 | 3300005543 | Bacteria | 1564 |
| 97 | Ga0070686_100009810 | 3300005544 | Bacteria | 5381 |
| 98 | Ga0070695_100077633 | 3300005545 | Bacteria | 2188 |
| 99 | Ga0070696_100070710 | 3300005546 | Bacteria | 2455 |
| 100 | Ga0070696_100084546 | 3300005546 | Bacteria | 2251 |
| 101 | Ga0070693_100017250 | 3300005547 | Bacteria | 3750 |
| 102 | Ga0070693_100033717 | 3300005547 | Bacteria | 2828 |
| 103 | Ga0070665_100003419 | 3300005548 | Bacteria | 16959 |
| 104 | Ga0070665_100032592 | 3300005548 | Bacteria | 5244 |
| 105 | Ga0070665_100072829 | 3300005548 | Bacteria | 3443 |
| 106 | Ga0070704_100223077 | 3300005549 | Bacteria | 1533 |
| 107 | Ga0068855_100033888 | 3300005563 | Bacteria | 6091 |
| 108 | Ga0068855_100086601 | 3300005563 | Bacteria | 3622 |
| 109 | Ga0068855_100087187 | 3300005563 | Bacteria | 3608 |
| 110 | Ga0068855_100089581 | 3300005563 | Bacteria | 3552 |
| 111 | Ga0068855_100105730 | 3300005563 | Bacteria | 3236 |
| 112 | Ga0068855_100249612 | 3300005563 | Bacteria | 1979 |
| 113 | Ga0070664_100101896 | 3300005564 | Bacteria | 2497 |
| 114 | Ga0068857_100008769 | 3300005577 | Bacteria | 8760 |
| 115 | Ga0068854_100082572 | 3300005578 | Bacteria | 2375 |
| 116 | Ga0068856_100016290 | 3300005614 | Bacteria | 7194 |
| 117 | Ga0068856_100039021 | 3300005614 | Bacteria | 4663 |
| 118 | Ga0068856_100046948 | 3300005614 | Bacteria | 4254 |
| 119 | Ga0068856_100335295 | 3300005614 | Bacteria | 1530 |
| 120 | Ga0070702_100001788 | 3300005615 | Bacteria | 8926 |
| 121 | Ga0070702_100012528 | 3300005615 | Bacteria | 4252 |
| 122 | Ga0070702_100043982 | 3300005615 | Bacteria | 2519 |
| 123 | Ga0068852_100002353 | 3300005616 | Bacteria | 13020 |
| 124 | Ga0068852_100009242 | 3300005616 | Bacteria | 7303 |
| 125 | Ga0068852_100054285 | 3300005616 | Bacteria | 3453 |
| 126 | Ga0068852_100218138 | 3300005616 | Bacteria | 1813 |
| 127 | Ga0068859_100075629 | 3300005617 | Bacteria | 3408 |
| 128 | Ga0068864_100035439 | 3300005618 | Bacteria | 4248 |
| 129 | Ga0068866_10007635 | 3300005718 | Bacteria | 4534 |
| 130 | Ga0068866_10210285 | 3300005718 | Bacteria | 1167 |
| 131 | Ga0068861_100011898 | 3300005719 | Bacteria | 6059 |
| 132 | Ga0068861_100090326 | 3300005719 | Bacteria | 2416 |
| 133 | Ga0068851_10006785 | 3300005834 | Bacteria | 5240 |
| 134 | Ga0068863_100060043 | 3300005841 | Bacteria | 3596 |
| 135 | Ga0068863_100222824 | 3300005841 | Bacteria | 1817 |
| 136 | Ga0068858_100140183 | 3300005842 | Bacteria | 2269 |
| 137 | Ga0068860_100111399 | 3300005843 | Bacteria | 2617 |
| 138 | Ga0068862_100109523 | 3300005844 | Bacteria | 2423 |
| 139 | Ga0068862_100312772 | 3300005844 | Bacteria | 1448 |
| 140 | Ga0081538_10000049 | 3300005981 | Bacteria | 110906 |
| 141 | Ga0081538_10038364 | 3300005981 | Bacteria | 3091 |
| 142 | Ga0081540_1003473 | 3300005983 | Bacteria | 12437 |
| 143 | Ga0081539_10038831 | 3300005985 | Bacteria | 2816 |
| 144 | Ga0070717_10079799 | 3300006028 | Bacteria | 2744 |
| 145 | Ga0075365_10185883 | 3300006038 | Bacteria | 1453 |
| 146 | Ga0070716_100011674 | 3300006173 | Bacteria | 4427 |
| 147 | Ga0070712_100025640 | 3300006175 | Bacteria | 3921 |
| 148 | Ga0075367_10036937 | 3300006178 | Bacteria | 2835 |
| 149 | Ga0097621_100013980 | 3300006237 | Bacteria | 5996 |
| 150 | Ga0097621_100015174 | 3300006237 | Bacteria | 5788 |
| 151 | Ga0097621_100048732 | 3300006237 | Bacteria | 3439 |
| 152 | Ga0068871_100006377 | 3300006358 | Bacteria | 8339 |
| 153 | Ga0068871_100014424 | 3300006358 | Bacteria | 5893 |
| 154 | Ga0068871_100041942 | 3300006358 | Bacteria | 3671 |
| 155 | Ga0075428_100062002 | 3300006844 | Bacteria | 4095 |
| 156 | Ga0075428_100090538 | 3300006844 | Bacteria | 3337 |
| 157 | Ga0075430_100003484 | 3300006846 | Bacteria | 13164 |
| 158 | Ga0075430_100085669 | 3300006846 | Bacteria | 2638 |
| 159 | Ga0075430_100136720 | 3300006846 | Bacteria | 2041 |
| 160 | Ga0075431_100012225 | 3300006847 | Bacteria | 8666 |
| 161 | Ga0075431_100235015 | 3300006847 | Bacteria | 1866 |
| 162 | Ga0075433_10425664 | 3300006852 | Bacteria | 1171 |
| 163 | Ga0075429_100013032 | 3300006880 | Bacteria | 7215 |
| 164 | Ga0068865_100004949 | 3300006881 | Bacteria | 8056 |
| 165 | Ga0068865_100014446 | 3300006881 | Bacteria | 5017 |
| 166 | Ga0075436_100005573 | 3300006914 | Bacteria | 8645 |
| 167 | Ga0075436_100058529 | 3300006914 | Bacteria | 2661 |
| 168 | Ga0097620_100075631 | 3300006931 | Bacteria | 3408 |
| 169 | Ga0075435_100014980 | 3300007076 | Bacteria | 5816 |
| 170 | Ga0075435_100020196 | 3300007076 | Bacteria | 5099 |
| 171 | Ga0105240_10093724 | 3300009093 | Bacteria | 3665 |
| 172 | Ga0105240_10118923 | 3300009093 | Bacteria | 3184 |
| 173 | Ga0111539_10045488 | 3300009094 | Bacteria | 5254 |
| 174 | Ga0105245_10044961 | 3300009098 | Bacteria | 3942 |
| 175 | Ga0105245_10046722 | 3300009098 | Bacteria | 3869 |
| 176 | Ga0105245_10322263 | 3300009098 | Bacteria | 1523 |
| 177 | Ga0105247_10005243 | 3300009101 | Bacteria | 8180 |
| 178 | Ga0105247_10033774 | 3300009101 | Bacteria | 3114 |
| 179 | Ga0114129_10000031 | 3300009147 | Bacteria | 111827 |
| 180 | Ga0114129_10004129 | 3300009147 | Bacteria | 20516 |
| 181 | Ga0105243_10030792 | 3300009148 | Bacteria | 4134 |
| 182 | Ga0105243_10038471 | 3300009148 | Bacteria | 3725 |
| 183 | Ga0105243_10067972 | 3300009148 | Bacteria | 2871 |
| 184 | Ga0105241_10033100 | 3300009174 | Bacteria | 3879 |
| 185 | Ga0105242_10014129 | 3300009176 | Bacteria | 6182 |
| 186 | Ga0105242_10181238 | 3300009176 | Bacteria | 1858 |
| 187 | Ga0105248_10026459 | 3300009177 | Bacteria | 6454 |
| 188 | Ga0105248_10045083 | 3300009177 | Bacteria | 4945 |
| 189 | Ga0105248_10047870 | 3300009177 | Bacteria | 4795 |
| 190 | Ga0105248_10166209 | 3300009177 | Bacteria | 2487 |
| 191 | Ga0105237_10164035 | 3300009545 | Bacteria | 2221 |
| 192 | Ga0105238_10041390 | 3300009551 | Bacteria | 4666 |
| 193 | Ga0105238_10086054 | 3300009551 | Bacteria | 3130 |
| 194 | Ga0105249_10001347 | 3300009553 | Bacteria | 21460 |
| 195 | Ga0105249_10024591 | 3300009553 | Bacteria | 5414 |
| 196 | Ga0105249_10576702 | 3300009553 | Bacteria | 1178 |
| 197 | Ga0105239_10009547 | 3300010375 | Bacteria | 10917 |
| 198 | Ga0105239_10057810 | 3300010375 | Bacteria | 4255 |
| 199 | Ga0105246_10398628 | 3300011119 | Bacteria | 1142 |
| 200 | Ga0157371_10010959 | 3300013102 | Bacteria | 7027 |
| 201 | Ga0157370_10034064 | 3300013104 | Bacteria | 4962 |
| 202 | Ga0157370_10070116 | 3300013104 | Bacteria | 3310 |
| 203 | Ga0157370_10109761 | 3300013104 | Bacteria | 2579 |
| 204 | Ga0157369_10009918 | 3300013105 | Bacteria | 10883 |
| 205 | Ga0157369_10027326 | 3300013105 | Bacteria | 6327 |
| 206 | Ga0157369_10254116 | 3300013105 | Bacteria | 1834 |
| 207 | Ga0157374_10015577 | 3300013296 | Bacteria | 6672 |
| 208 | Ga0157378_10006940 | 3300013297 | Bacteria | 9880 |
| 209 | Ga0157378_10223309 | 3300013297 | Bacteria | 1792 |
| 210 | Ga0163162_10013364 | 3300013306 | Bacteria | 8017 |
| 211 | Ga0163162_10027647 | 3300013306 | Bacteria | 5610 |
| 212 | Ga0157372_10211441 | 3300013307 | Bacteria | 2248 |
| 213 | Ga0157372_10696458 | 3300013307 | Bacteria | 1182 |
| 214 | Ga0157375_10024586 | 3300013308 | Bacteria | 5578 |
| 215 | Ga0157375_10034939 | 3300013308 | Bacteria | 4794 |
| 216 | Ga0157375_10064065 | 3300013308 | Bacteria | 3659 |
| 217 | Ga0157375_10083117 | 3300013308 | Bacteria | 3246 |
| 218 | Ga0163163_10029525 | 3300014325 | Bacteria | 5276 |
| 219 | Ga0163163_10033950 | 3300014325 | Bacteria | 4939 |
| 220 | Ga0163163_10182291 | 3300014325 | Bacteria | 2147 |
| 221 | Ga0157380_10008097 | 3300014326 | Bacteria | 7490 |
| 222 | Ga0157377_10005998 | 3300014745 | Bacteria | 5756 |
| 223 | Ga0157377_10022170 | 3300014745 | Bacteria | 3350 |
| 224 | Ga0157379_10505087 | 3300014968 | Bacteria | 1121 |
| 225 | Ga0157376_10020185 | 3300014969 | Bacteria | 5150 |
| 226 | Ga0157376_10036577 | 3300014969 | Bacteria | 3978 |
| 227 | Ga0163161_10010508 | 3300017792 | Bacteria | 6411 |
| 228 | Ga0206356_10427959 | 3300020070 | Bacteria | 3837 |
| 229 | Ga0206354_10719510 | 3300020081 | Bacteria | 2404 |
| 230 | Ga0206354_10843100 | 3300020081 | Bacteria | 2342 |
| 231 | Ga0206353_11193225 | 3300020082 | Bacteria | 4331 |
| 232 | Ga0213871_10066000 | 3300021441 | Bacteria | 1015 |
| 233 | Ga0207692_10004373 | 3300025898 | Bacteria | 5595 |
| 234 | Ga0207642_10004902 | 3300025899 | Bacteria | 4336 |
| 235 | Ga0207710_10130136 | 3300025900 | Bacteria | 1208 |
| 236 | Ga0207688_10023993 | 3300025901 | Bacteria | 3344 |
| 237 | Ga0207688_10036365 | 3300025901 | Bacteria | 2729 |
| 238 | Ga0207688_10044967 | 3300025901 | Bacteria | 2462 |
| 239 | Ga0207680_10026642 | 3300025903 | Bacteria | 3207 |
| 240 | Ga0207680_10056408 | 3300025903 | Bacteria | 2372 |
| 241 | Ga0207647_10008509 | 3300025904 | Bacteria | 7351 |
| 242 | Ga0207647_10033696 | 3300025904 | Bacteria | 3276 |
| 243 | Ga0207699_10041704 | 3300025906 | Bacteria | 2653 |
| 244 | Ga0207645_10067108 | 3300025907 | Bacteria | 2293 |
| 245 | Ga0207645_10090760 | 3300025907 | Bacteria | 1964 |
| 246 | Ga0207643_10000112 | 3300025908 | Bacteria | 55805 |
| 247 | Ga0207643_10058599 | 3300025908 | Bacteria | 2195 |
| 248 | Ga0207705_10094338 | 3300025909 | Bacteria | 2194 |
| 249 | Ga0207705_10171805 | 3300025909 | Bacteria | 1632 |
| 250 | Ga0207684_10091589 | 3300025910 | Bacteria | 2591 |
| 251 | Ga0207654_10096048 | 3300025911 | Bacteria | 1817 |
| 252 | Ga0207707_10056943 | 3300025912 | Bacteria | 3402 |
| 253 | Ga0207671_10052335 | 3300025914 | Bacteria | 3026 |
| 254 | Ga0207671_10127655 | 3300025914 | Bacteria | 1950 |
| 255 | Ga0207693_10000409 | 3300025915 | Bacteria | 39089 |
| 256 | Ga0207693_10001176 | 3300025915 | Bacteria | 23358 |
| 257 | Ga0207663_10060209 | 3300025916 | Bacteria | 2405 |
| 258 | Ga0207660_10007499 | 3300025917 | Bacteria | 7060 |
| 259 | Ga0207660_10222278 | 3300025917 | Bacteria | 1482 |
| 260 | Ga0207662_10052854 | 3300025918 | Bacteria | 2418 |
| 261 | Ga0207657_10003179 | 3300025919 | Bacteria | 17568 |
| 262 | Ga0207657_10005213 | 3300025919 | Bacteria | 13615 |
| 263 | Ga0207657_10065016 | 3300025919 | Bacteria | 3111 |
| 264 | Ga0207657_10119832 | 3300025919 | Bacteria | 2165 |
| 265 | Ga0207652_10012926 | 3300025921 | Bacteria | 6754 |
| 266 | Ga0207652_10045951 | 3300025921 | Bacteria | 3724 |
| 267 | Ga0207652_10053775 | 3300025921 | Bacteria | 3459 |
| 268 | Ga0207646_10002084 | 3300025922 | Bacteria | 24000 |
| 269 | Ga0207646_10007636 | 3300025922 | Bacteria | 10947 |
| 270 | Ga0207694_10047309 | 3300025924 | Bacteria | 3328 |
| 271 | Ga0207650_10004590 | 3300025925 | Bacteria | 9446 |
| 272 | Ga0207659_10005948 | 3300025926 | Bacteria | 7445 |
| 273 | Ga0207687_10003050 | 3300025927 | Bacteria | 11358 |
| 274 | Ga0207687_10056798 | 3300025927 | Bacteria | 2747 |
| 275 | Ga0207700_10123007 | 3300025928 | Bacteria | 2107 |
| 276 | Ga0207664_10025967 | 3300025929 | Bacteria | 4421 |
| 277 | Ga0207664_10032082 | 3300025929 | Bacteria | 4024 |
| 278 | Ga0207664_10042739 | 3300025929 | Bacteria | 3540 |
| 279 | Ga0207644_10081838 | 3300025931 | Bacteria | 2387 |
| 280 | Ga0207644_10100121 | 3300025931 | Bacteria | 2176 |
| 281 | Ga0207690_10027965 | 3300025932 | Bacteria | 3569 |
| 282 | Ga0207690_10090892 | 3300025932 | Bacteria | 2156 |
| 283 | Ga0207690_10108327 | 3300025932 | Bacteria | 1996 |
| 284 | Ga0207690_10352944 | 3300025932 | Bacteria | 1163 |
| 285 | Ga0207706_10003043 | 3300025933 | Bacteria | 16167 |
| 286 | Ga0207706_10024684 | 3300025933 | Bacteria | 5387 |
| 287 | Ga0207706_10113924 | 3300025933 | Bacteria | 2378 |
| 288 | Ga0207686_10003864 | 3300025934 | Bacteria | 8034 |
| 289 | Ga0207686_10026043 | 3300025934 | Bacteria | 3410 |
| 290 | Ga0207709_10012187 | 3300025935 | Bacteria | 4739 |
| 291 | Ga0207709_10062374 | 3300025935 | Bacteria | 2333 |
| 292 | Ga0207669_10021389 | 3300025937 | Bacteria | 3414 |
| 293 | Ga0207669_10072106 | 3300025937 | Bacteria | 2173 |
| 294 | Ga0207704_10005166 | 3300025938 | Bacteria | 6012 |
| 295 | Ga0207704_10079420 | 3300025938 | Bacteria | 2114 |
| 296 | Ga0207665_10006099 | 3300025939 | Bacteria | 8005 |
| 297 | Ga0207665_10181263 | 3300025939 | Bacteria | 1525 |
| 298 | Ga0207691_10022722 | 3300025940 | Bacteria | 5913 |
| 299 | Ga0207691_10142454 | 3300025940 | Bacteria | 2111 |
| 300 | Ga0207689_10000247 | 3300025942 | Bacteria | 48421 |
| 301 | Ga0207689_10057931 | 3300025942 | Bacteria | 3186 |
| 302 | Ga0207661_10021608 | 3300025944 | Bacteria | 4824 |
| 303 | Ga0207661_10025730 | 3300025944 | Bacteria | 4477 |
| 304 | Ga0207661_10079054 | 3300025944 | Bacteria | 2710 |
| 305 | Ga0207679_10187512 | 3300025945 | Bacteria | 1716 |
| 306 | Ga0207667_10019931 | 3300025949 | Bacteria | 7473 |
| 307 | Ga0207667_10030735 | 3300025949 | Bacteria | 5805 |
| 308 | Ga0207667_10273780 | 3300025949 | Bacteria | 1726 |
| 309 | Ga0207651_10041567 | 3300025960 | Bacteria | 3053 |
| 310 | Ga0207668_10008002 | 3300025972 | Bacteria | 6291 |
| 311 | Ga0207668_10127140 | 3300025972 | Bacteria | 1940 |
| 312 | Ga0207640_10061985 | 3300025981 | Bacteria | 2479 |
| 313 | Ga0207677_10009652 | 3300026023 | Bacteria | 5434 |
| 314 | Ga0207703_10185058 | 3300026035 | Bacteria | 1840 |
| 315 | Ga0207703_10201433 | 3300026035 | Bacteria | 1769 |
| 316 | Ga0207678_10002660 | 3300026067 | Bacteria | 16232 |
| 317 | Ga0207678_10004730 | 3300026067 | Bacteria | 12226 |
| 318 | Ga0207678_10006233 | 3300026067 | Bacteria | 10593 |
| 319 | Ga0207678_10007527 | 3300026067 | Bacteria | 9627 |
| 320 | Ga0207708_10001288 | 3300026075 | Bacteria | 18839 |
| 321 | Ga0207708_10010392 | 3300026075 | Bacteria | 6909 |
| 322 | Ga0207708_10168519 | 3300026075 | Bacteria | 1733 |
| 323 | Ga0207702_10003223 | 3300026078 | Bacteria | 15072 |
| 324 | Ga0207702_10012065 | 3300026078 | Bacteria | 7187 |
| 325 | Ga0207702_10025530 | 3300026078 | Bacteria | 4904 |
| 326 | Ga0207702_10065017 | 3300026078 | Bacteria | 3123 |
| 327 | Ga0207702_10159160 | 3300026078 | Bacteria | 2061 |
| 328 | Ga0207641_10201328 | 3300026088 | Bacteria | 1836 |
| 329 | Ga0207641_10205724 | 3300026088 | Bacteria | 1817 |
| 330 | Ga0207648_10000136 | 3300026089 | Bacteria | 73368 |
| 331 | Ga0207676_10001377 | 3300026095 | Bacteria | 18083 |
| 332 | Ga0207674_10023525 | 3300026116 | Bacteria | 6596 |
| 333 | Ga0207675_100053991 | 3300026118 | Bacteria | 3748 |
| 334 | Ga0207675_100102502 | 3300026118 | Bacteria | 2697 |
| 335 | Ga0207675_100117780 | 3300026118 | Bacteria | 2511 |
| 336 | Ga0207683_10000371 | 3300026121 | Bacteria | 41225 |
| 337 | Ga0207683_10001767 | 3300026121 | Bacteria | 19129 |
| 338 | Ga0207683_10005450 | 3300026121 | Bacteria | 10898 |
| 339 | Ga0207428_10017252 | 3300027907 | Bacteria | 6199 |
| 340 | Ga0207428_10028153 | 3300027907 | Bacteria | 4671 |
| 341 | Ga0268266_10017670 | 3300028379 | Bacteria | 6082 |
| 342 | Ga0268265_10075331 | 3300028380 | Bacteria | 2643 |
| 343 | Ga0268265_10251362 | 3300028380 | Bacteria | 1566 |
| 344 | Ga0268264_10027520 | 3300028381 | Bacteria | 4647 |
| 345 | Ga0268264_10143485 | 3300028381 | Bacteria | 2132 |
| 346 | Ga0268264_10526121 | 3300028381 | Bacteria | 1157 |
| 347 | Ga0307513_10235564 | 3300031456 | Bacteria | 1640 |
| 348 | Ga0316577_10001679 | 3300031733 | Bacteria | 10609 |
| 349 | Ga0316577_10153117 | 3300031733 | Bacteria | 1300 |
| 350 | Ga0307410_10256611 | 3300031852 | Bacteria | 1362 |
| 351 | Ga0307406_10008721 | 3300031901 | Bacteria | 5667 |
| 352 | Ga0307406_10072018 | 3300031901 | Bacteria | 2267 |
| 353 | Ga0307407_10232777 | 3300031903 | Bacteria | 1252 |
| 354 | Ga0307507_10000090 | 3300033179 | Bacteria | 142457 |
| 355 | Ga0373938_0007430 | 3300034957 | Bacteria | 1927 |
| 356 | Ga0373938_0018038 | 3300034957 | Bacteria | 1396 |
| 357 | Ga0373951_0021390 | 3300035091 | Bacteria | 1486 |
| 358 | Ga0373943_0143582 | 3300035170 | Bacteria | 1288 |
| 359 | Ga0373931_0063704 | 3300035691 | Bacteria | 1993 |
| 360 | Ga0395899_0007122 | 3300037312 | Bacteria | 8651 |
| 361 | Ga0395899_0013580 | 3300037312 | Bacteria | 6226 |
| 362 | Ga0395899_0088251 | 3300037312 | Bacteria | 2250 |
| 363 | Ga0395900_0001036 | 3300037418 | Bacteria | 35631 |
| 364 | Ga0395900_0093344 | 3300037418 | Bacteria | 3091 |
| 365 | Ga0395898_0001318 | 3300037466 | Bacteria | 36063 |
| 366 | Ga0395898_0010178 | 3300037466 | Bacteria | 9845 |
| 367 | Ga0395898_0059579 | 3300037466 | Bacteria | 3713 |
| 368 | Ga0395898_0244177 | 3300037466 | Bacteria | 1712 |
| 369 | Ga0395905_0007007 | 3300037471 | Bacteria | 11268 |
| 370 | Ga0395905_0304086 | 3300037471 | Bacteria | 1482 |
| 371 | Ga0436364_1475170 | 3300037853 | Bacteria | 3888 |
| 372 | Ga0395901_0040462 | 3300038443 | Bacteria | 4828 |
| 373 | Ga0395901_0442324 | 3300038443 | Bacteria | 1330 |
| 374 | Ga0400485_15906 | 3300038735 | Bacteria | 2673 |
| 375 | Ga0436360_0802153 | 3300039438 | Bacteria | 5012 |
| 376 | Ga0436360_1224020 | 3300039438 | Bacteria | 1815 |
| 377 | Ga0451795_1479959 | 3300041456 | Bacteria | 2088 |
| 378 | Ga0451800_0130591 | 3300041459 | Bacteria | 1286 |
| 379 | Ga0451833_0174647 | 3300041491 | Bacteria | 3665 |
| 380 | Ga0451839_1186836 | 3300041496 | Bacteria | 2734 |
| 381 | Ga0451853_1398733 | 3300041512 | Bacteria | 5192 |
| 382 | Ga0439450_025599 | 3300042008 | Bacteria | 1295 |
| 383 | Ga0439458_0021472 | 3300042157 | Bacteria | 1495 |
| 384 | Ga0439459_0004658 | 3300042438 | Bacteria | 2217 |
| 385 | Ga0466969_0046218 | 3300044656 | Bacteria | 2159 |
| 386 | Ga0466966_0016415 | 3300044684 | Bacteria | 4893 |
| 387 | Ga0466963_0015316 | 3300044694 | Bacteria | 4744 |
| 388 | Ga0466963_0067077 | 3300044694 | Bacteria | 2407 |
| 389 | Ga0466963_0138280 | 3300044694 | Bacteria | 1686 |
| 390 | Ga0466970_0017951 | 3300044765 | Bacteria | 3660 |
| 391 | Ga0466957_0023206 | 3300044842 | Bacteria | 3666 |
| 392 | Ga0466957_0122923 | 3300044842 | Bacteria | 1656 |
| 393 | Ga0466957_0210089 | 3300044842 | Bacteria | 1281 |
| 394 | Ga0466960_0006554 | 3300044901 | Bacteria | 4675 |
| 395 | Ga0466960_0008279 | 3300044901 | Bacteria | 4253 |
| 396 | Ga0466960_0020471 | 3300044901 | Bacteria | 2931 |
| 397 | Ga0466958_0010057 | 3300045836 | Bacteria | 5288 |
| 398 | Ga0466958_0065680 | 3300045836 | Bacteria | 2214 |
| 399 | Ga0466967_0070336 | 3300045976 | Bacteria | 3131 |
| 400 | Ga0466967_0608088 | 3300045976 | Bacteria | 1079 |
| 401 | Ga0495603_0163354 | 3300046455 | Bacteria | 1291 |
| 402 | Ga0495629_0321513 | 3300046459 | Bacteria | 1058 |
| 403 | Ga0495641_0046397 | 3300046461 | Bacteria | 1998 |
| 404 | Ga0495582_0019253 | 3300046473 | Bacteria | 3733 |
| 405 | Ga0495582_0051079 | 3300046473 | Bacteria | 2279 |
| 406 | Ga0495596_0081277 | 3300046500 | Bacteria | 1258 |
| 407 | Ga0495607_0071824 | 3300046501 | Bacteria | 1929 |
| 408 | Ga0495628_0233265 | 3300046516 | Bacteria | 1379 |
| 409 | Ga0495663_0022204 | 3300046525 | Bacteria | 1832 |
| 410 | Ga0495586_0036394 | 3300046535 | Bacteria | 2642 |
| 411 | Ga0495609_0072193 | 3300046538 | Bacteria | 1516 |
| 412 | Ga0495656_0062822 | 3300046615 | Bacteria | 1626 |
| 413 | Ga0495668_0075739 | 3300046616 | Bacteria | 1848 |
| 414 | Ga0495634_0033804 | 3300046642 | Bacteria | 3511 |
| 415 | Ga0495625_0006148 | 3300046660 | Bacteria | 10750 |
| 416 | Ga0495588_0206037 | 3300046674 | Bacteria | 1039 |
| 417 | Ga0495647_0045356 | 3300046681 | Bacteria | 1688 |
| 418 | Ga0495589_0089684 | 3300046794 | Bacteria | 1493 |
| 419 | Ga0495676_0104132 | 3300047321 | Bacteria | 2094 |
| 420 | Ga0495683_0033576 | 3300047323 | Bacteria | 2610 |
| 421 | Ga0495677_0067882 | 3300047445 | Bacteria | 1327 |
| 422 | Ga0495684_0050774 | 3300047471 | Bacteria | 3166 |
| 423 | Ga0495614_0060465 | 3300048089 | Bacteria | 1628 |
| 424 | Ga0495626_0000784 | 3300048091 | Bacteria | 28861 |
| 425 | Ga0496100_0234149 | 3300048903 | Bacteria | 1352 |
| 426 | Ga0496101_0001995 | 3300048904 | Bacteria | 12381 |
| 427 | Ga0496101_0321973 | 3300048904 | Bacteria | 1213 |
| 428 | Ga0496102_0015059 | 3300048905 | Bacteria | 6731 |
| 429 | Ga0496102_0105287 | 3300048905 | Bacteria | 2624 |
| 430 | Ga0496103_0004353 | 3300048906 | Bacteria | 8595 |
| 431 | Ga0496104_0054633 | 3300048907 | Bacteria | 3775 |
| 432 | Ga0496104_0139194 | 3300048907 | Bacteria | 2332 |
| 433 | Ga0496105_0013282 | 3300048908 | Bacteria | 6535 |
| 434 | Ga0496105_0045250 | 3300048908 | Bacteria | 3631 |
| 435 | Ga0496105_0071739 | 3300048908 | Bacteria | 2862 |
| 436 | Ga0496105_0178068 | 3300048908 | Bacteria | 1741 |
| 437 | Ga0496105_0211082 | 3300048908 | Bacteria | 1582 |
| 438 | Ga0496106_0003272 | 3300048909 | Bacteria | 12106 |
| 439 | Ga0496106_0003308 | 3300048909 | Bacteria | 12017 |
| 440 | Ga0496107_0014241 | 3300048910 | Bacteria | 5569 |
| 441 | Ga0496108_0009239 | 3300048911 | Bacteria | 7977 |
| 442 | Ga0496108_0112864 | 3300048911 | Bacteria | 2325 |
| 443 | Ga0496108_0175768 | 3300048911 | Bacteria | 1853 |
| 444 | Ga0496108_0265716 | 3300048911 | Bacteria | 1493 |
| 445 | Ga0496109_0004612 | 3300048912 | Bacteria | 11501 |
| 446 | Ga0496109_0008315 | 3300048912 | Bacteria | 8812 |
| 447 | Ga0496109_0020626 | 3300048912 | Bacteria | 5822 |
| 448 | Ga0496109_0032504 | 3300048912 | Bacteria | 4690 |
| 449 | Ga0496109_0037431 | 3300048912 | Bacteria | 4382 |
| 450 | Ga0496109_0482993 | 3300048912 | Bacteria | 1170 |
| 451 | Ga0496110_0007957 | 3300048913 | Bacteria | 8490 |
| 452 | Ga0496110_0058833 | 3300048913 | Bacteria | 3385 |
| 453 | Ga0496110_0090814 | 3300048913 | Bacteria | 2731 |
| 454 | Ga0496110_0146853 | 3300048913 | Bacteria | 2133 |
| 455 | Ga0496111_0004766 | 3300048914 | Bacteria | 8604 |
| 456 | Ga0496111_0011523 | 3300048914 | Bacteria | 5961 |
| 457 | Ga0496112_0001031 | 3300048915 | Bacteria | 20495 |
| 458 | Ga0496112_0016365 | 3300048915 | Bacteria | 6945 |
| 459 | Ga0496112_0020727 | 3300048915 | Bacteria | 6236 |
| 460 | Ga0496112_0051384 | 3300048915 | Bacteria | 4043 |
| 461 | Ga0496112_0081851 | 3300048915 | Bacteria | 3193 |
| 462 | Ga0496114_0039819 | 3300048917 | Bacteria | 3889 |
| 463 | Ga0496114_0396632 | 3300048917 | Bacteria | 1222 |
| 464 | Ga0496115_0003007 | 3300048918 | Bacteria | 12105 |
| 465 | Ga0496115_0003930 | 3300048918 | Bacteria | 10708 |
| 466 | Ga0501032_0014627 | 3300049569 | Bacteria | 5559 |
| 467 | Ga0501034_0042176 | 3300049571 | Bacteria | 4619 |
| 468 | Ga0501034_0223019 | 3300049571 | Bacteria | 1837 |
| 469 | Ga0501036_0105172 | 3300049572 | Bacteria | 2387 |
| 470 | Ga0501036_0158258 | 3300049572 | Bacteria | 1910 |
| 471 | Ga0501036_0236158 | 3300049572 | Bacteria | 1533 |
| 472 | Ga0501036_0532618 | 3300049572 | Bacteria | 976 |
| 473 | Ga0501037_0048648 | 3300049573 | Bacteria | 3106 |
| 474 | Ga0501038_0003462 | 3300049574 | Bacteria | 14721 |
| 475 | Ga0501039_0043255 | 3300049575 | Bacteria | 3480 |
| 476 | Ga0501040_0010511 | 3300049576 | Bacteria | 6054 |
| 477 | Ga0501046_0161631 | 3300049580 | Bacteria | 1684 |
| 478 | Ga0501046_0163438 | 3300049580 | Bacteria | 1673 |
| 479 | Ga0501047_0003842 | 3300049581 | Bacteria | 14123 |
| 480 | Ga0501048_0001586 | 3300049582 | Bacteria | 17266 |
| 481 | Ga0501048_0079127 | 3300049582 | Bacteria | 2320 |
| 482 | Ga0501069_0000015 | 3300049585 | Bacteria | 144828 |
| 483 | Ga0501070_0000005 | 3300049586 | Bacteria | 250033 |
| 484 | Ga0501072_0048035 | 3300049588 | Bacteria | 3361 |
| 485 | Ga0501072_0120312 | 3300049588 | Bacteria | 2092 |
| 486 | Ga0501073_0252634 | 3300049589 | Bacteria | 1217 |
| 487 | Ga0501075_0265262 | 3300049591 | Bacteria | 1309 |
| 488 | Ga0501079_0357495 | 3300049741 | Bacteria | 1144 |
| 489 | Ga0501080_0113700 | 3300049742 | Bacteria | 2510 |
| 490 | Ga0501081_0059112 | 3300049743 | Bacteria | 2653 |
| 491 | Ga0501081_0243136 | 3300049743 | Bacteria | 1313 |
| 492 | Ga0501035_0021169 | 3300049822 | Bacteria | 5977 |
| 493 | Ga0501044_0028149 | 3300049823 | Bacteria | 5932 |
| 494 | Ga0501044_0197182 | 3300049823 | Bacteria | 1973 |
| 495 | nmdc:mga06z11_103606_c1 | 3300050494 | Bacteria | 1565 |
| 496 | nmdc:mga05p37_18065_c1 | 3300050507 | Bacteria | 8519 |
| 497 | nmdc:mga05p37_988_c1 | 3300050507 | Bacteria | 32390 |
| 498 | nmdc:mga09592_11_c2 | 3300050508 | Bacteria | 31986 |
| 499 | nmdc:mga09592_15716_c1 | 3300050508 | Bacteria | 6185 |
| 500 | nmdc:mga0qj67_122711_c1 | 3300050509 | Bacteria | 2102 |
| 501 | nmdc:mga0qj67_2886_c1 | 3300050509 | Bacteria | 10551 |
| 502 | nmdc:mga0qj67_95_c1 | 3300050509 | Bacteria | 59712 |
| 503 | nmdc:mga06r32_31796_c1 | 3300050510 | Bacteria | 4960 |
| 504 | nmdc:mga06r32_73821_c1 | 3300050510 | Bacteria | 3306 |
| 505 | nmdc:mga08y16_23821_c1 | 3300050511 | Bacteria | 6465 |
| 506 | nmdc:mga0n895_147901_c1 | 3300050512 | Bacteria | 2379 |
| 507 | nmdc:mga0n895_53044_c1 | 3300050512 | Bacteria | 3982 |
| 508 | nmdc:mga0n895_56284_c1 | 3300050512 | Bacteria | 3874 |
| 509 | nmdc:mga0rr50_2965_c1 | 3300050513 | Bacteria | 9710 |
| 510 | nmdc:mga0rr50_32652_c1 | 3300050513 | Bacteria | 3712 |
| 511 | nmdc:mga0a205_22916_c1 | 3300050515 | Bacteria | 5921 |
| 512 | nmdc:mga0a205_30741_c1 | 3300050515 | Bacteria | 5144 |
| 513 | Ga0495619_0054362 | 3300053085 | Bacteria | 2650 |
| 514 | Ga0500556_0000873 | 3300053104 | Bacteria | 17059 |
| 515 | Ga0500593_000011 | 3300053117 | Bacteria | 62847 |
| 516 | Ga0501084_0000039 | 3300054114 | Bacteria | 107409 |
| 517 | Ga0501084_0219145 | 3300054114 | Bacteria | 1606 |
| 518 | Ga0501082_0109127 | 3300060353 | Bacteria | 2395 |
| 519 | Ga0530510_0172938 | 3300061734 | Bacteria | 1600 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025908 | Ga0207643_10058599 | Ga0207643_100585992 | 264 |
| 2 | 3300049571 | Ga0501034_0223019 | Ga0501034_0223019_641_1525 | 271 |
| 3 | 3300031733 | Ga0316577_10001679 | Ga0316577_100016794 | 282 |
| 4 | 3300003373 | JGI25407J50210_10004461 | JGI25407J50210_100044611 | 285 |
| 5 | 3300005981 | Ga0081538_10000049 | Ga0081538_1000004940 | 285 |
| 6 | 3300048917 | Ga0496114_0396632 | Ga0496114_0396632_54_980 | 286 |
| 7 | 3300005614 | Ga0068856_100016290 | Ga0068856_1000162907 | 288 |
| 8 | 3300026078 | Ga0207702_10012065 | Ga0207702_100120653 | 288 |
| 9 | 3300049572 | Ga0501036_0532618 | Ga0501036_0532618_17_886 | 288 |
| 10 | 3300013307 | Ga0157372_10696458 | Ga0157372_106964581 | 289 |
| 11 | 3300049580 | Ga0501046_0161631 | Ga0501046_0161631_113_982 | 289 |
| 12 | 3300013308 | Ga0157375_10034939 | Ga0157375_100349394 | 290 |
| 13 | 3300037466 | Ga0395898_0010178 | Ga0395898_0010178_862_1776 | 290 |
| 14 | 3300038443 | Ga0395901_0040462 | Ga0395901_0040462_3060_3974 | 290 |
| 15 | 3300044656 | Ga0466969_0046218 | Ga0466969_0046218_356_1270 | 290 |
| 16 | 3300044684 | Ga0466966_0016415 | Ga0466966_0016415_2086_3000 | 290 |
| 17 | 3300044694 | Ga0466963_0015316 | Ga0466963_0015316_1296_2210 | 290 |
| 18 | 3300044842 | Ga0466957_0210089 | Ga0466957_0210089_321_1235 | 290 |
| 19 | 3300045836 | Ga0466958_0065680 | Ga0466958_0065680_1146_2060 | 290 |
| 20 | 3300050515 | nmdc:mga0a205_22916_c1 | nmdc:mga0a205_22916_c1_1385_2284 | 290 |
| 21 | 3300049823 | Ga0501044_0197182 | Ga0501044_0197182_980_1918 | 291 |
| 22 | 3300049572 | Ga0501036_0236158 | Ga0501036_0236158_562_1455 | 296 |
| 23 | 3300060353 | Ga0501082_0109127 | Ga0501082_0109127_1098_1991 | 296 |
| 24 | 3300037418 | Ga0395900_0001036 | Ga0395900_0001036_24530_25441 | 297 |
| 25 | 3300037466 | Ga0395898_0001318 | Ga0395898_0001318_9584_10495 | 297 |
| 26 | 3300037466 | Ga0395898_0244177 | Ga0395898_0244177_285_1196 | 297 |
| 27 | 3300037471 | Ga0395905_0007007 | Ga0395905_0007007_6264_7175 | 297 |
| 28 | 3300048908 | Ga0496105_0071739 | Ga0496105_0071739_655_1599 | 297 |
| 29 | 3300050509 | nmdc:mga0qj67_122711_c1 | nmdc:mga0qj67_122711_c1_736_1629 | 297 |
| 30 | 3300009147 | Ga0114129_10004129 | Ga0114129_100041296 | 298 |
| 31 | 3300050507 | nmdc:mga05p37_18065_c1 | nmdc:mga05p37_18065_c1_1498_2394 | 298 |
| 32 | 3300050508 | nmdc:mga09592_15716_c1 | nmdc:mga09592_15716_c1_3328_4224 | 298 |
| 33 | 3300050510 | nmdc:mga06r32_31796_c1 | nmdc:mga06r32_31796_c1_305_1201 | 298 |
| 34 | 3300014325 | Ga0163163_10182291 | Ga0163163_101822912 | 300 |
| 35 | 3300046459 | Ga0495629_0321513 | Ga0495629_0321513_87_1016 | 300 |
| 36 | 3300046535 | Ga0495586_0036394 | Ga0495586_0036394_1440_2357 | 300 |
| 37 | 3300046642 | Ga0495634_0033804 | Ga0495634_0033804_2147_3064 | 300 |
| 38 | 3300049585 | Ga0501069_0000015 | Ga0501069_0000015_38744_39658 | 300 |
| 39 | 3300049586 | Ga0501070_0000005 | Ga0501070_0000005_194159_195073 | 300 |
| 40 | 3300049591 | Ga0501075_0265262 | Ga0501075_0265262_182_1105 | 300 |
| 41 | 3300049742 | Ga0501080_0113700 | Ga0501080_0113700_577_1503 | 300 |
| 42 | 3300050512 | nmdc:mga0n895_53044_c1 | nmdc:mga0n895_53044_c1_2267_3256 | 300 |
| 43 | iso_pu_bacteria | 2739367898 | 2740169179 | 300 |
| 44 | iso_pu_bacteria | 2773857762 | 2774392054 | 300 |
| 45 | iso_pu_bacteria | 2808606439 | 2809195843 | 300 |
| 46 | iso_pu_bacteria | 2811994878 | 2812352012 | 300 |
| 47 | 3300025933 | Ga0207706_10113924 | Ga0207706_101139242 | 301 |
| 48 | 3300049743 | Ga0501081_0243136 | Ga0501081_0243136_187_1095 | 301 |
| 49 | 3300061734 | Ga0530510_0172938 | Ga0530510_0172938_501_1409 | 301 |
| 50 | 3300005327 | Ga0070658_10026555 | Ga0070658_100265556 | 302 |
| 51 | 3300005336 | Ga0070680_100019850 | Ga0070680_1000198505 | 302 |
| 52 | 3300005337 | Ga0070682_100036541 | Ga0070682_1000365412 | 302 |
| 53 | 3300005339 | Ga0070660_100039585 | Ga0070660_1000395851 | 302 |
| 54 | 3300005339 | Ga0070660_100044493 | Ga0070660_1000444932 | 302 |
| 55 | 3300005435 | Ga0070714_100019745 | Ga0070714_1000197457 | 302 |
| 56 | 3300005530 | Ga0070679_100039850 | Ga0070679_1000398505 | 302 |
| 57 | 3300005563 | Ga0068855_100087187 | Ga0068855_1000871877 | 302 |
| 58 | 3300005563 | Ga0068855_100249612 | Ga0068855_1002496122 | 302 |
| 59 | 3300005981 | Ga0081538_10038364 | Ga0081538_100383643 | 302 |
| 60 | 3300006844 | Ga0075428_100090538 | Ga0075428_1000905382 | 302 |
| 61 | 3300006846 | Ga0075430_100085669 | Ga0075430_1000856693 | 302 |
| 62 | 3300006847 | Ga0075431_100235015 | Ga0075431_1002350153 | 302 |
| 63 | 3300009093 | Ga0105240_10093724 | Ga0105240_100937246 | 302 |
| 64 | 3300009147 | Ga0114129_10000031 | Ga0114129_10000031101 | 302 |
| 65 | 3300013104 | Ga0157370_10034064 | Ga0157370_100340643 | 302 |
| 66 | 3300013104 | Ga0157370_10070116 | Ga0157370_100701163 | 302 |
| 67 | 3300013105 | Ga0157369_10009918 | Ga0157369_1000991812 | 302 |
| 68 | 3300013105 | Ga0157369_10027326 | Ga0157369_100273265 | 302 |
| 69 | 3300013307 | Ga0157372_10211441 | Ga0157372_102114413 | 302 |
| 70 | 3300020070 | Ga0206356_10427959 | Ga0206356_104279594 | 302 |
| 71 | 3300020082 | Ga0206353_11193225 | Ga0206353_111932253 | 302 |
| 72 | 3300021441 | Ga0213871_10066000 | Ga0213871_100660001 | 302 |
| 73 | 3300025912 | Ga0207707_10056943 | Ga0207707_100569433 | 302 |
| 74 | 3300025917 | Ga0207660_10007499 | Ga0207660_1000749910 | 302 |
| 75 | 3300025919 | Ga0207657_10003179 | Ga0207657_1000317917 | 302 |
| 76 | 3300025921 | Ga0207652_10053775 | Ga0207652_100537752 | 302 |
| 77 | 3300025929 | Ga0207664_10032082 | Ga0207664_100320825 | 302 |
| 78 | 3300025949 | Ga0207667_10030735 | Ga0207667_100307352 | 302 |
| 79 | 3300037466 | Ga0395898_0059579 | Ga0395898_0059579_931_1869 | 302 |
| 80 | 3300039438 | Ga0436360_0802153 | Ga0436360_0802153_3287_4216 | 302 |
| 81 | 3300039438 | Ga0436360_1224020 | Ga0436360_1224020_102_1031 | 302 |
| 82 | 3300045976 | Ga0466967_0608088 | Ga0466967_0608088_104_1033 | 302 |
| 83 | 3300046660 | Ga0495625_0006148 | Ga0495625_0006148_4977_5921 | 302 |
| 84 | 3300047323 | Ga0495683_0033576 | Ga0495683_0033576_941_1885 | 302 |
| 85 | 3300048091 | Ga0495626_0000784 | Ga0495626_0000784_22724_23668 | 302 |
| 86 | 3300048915 | Ga0496112_0051384 | Ga0496112_0051384_2685_3614 | 302 |
| 87 | 3300049573 | Ga0501037_0048648 | Ga0501037_0048648_2080_3018 | 302 |
| 88 | 3300049589 | Ga0501073_0252634 | Ga0501073_0252634_264_1202 | 302 |
| 89 | 3300049741 | Ga0501079_0357495 | Ga0501079_0357495_144_1082 | 302 |
| 90 | 3300049743 | Ga0501081_0059112 | Ga0501081_0059112_1549_2487 | 302 |
| 91 | 3300050507 | nmdc:mga05p37_988_c1 | nmdc:mga05p37_988_c1_28879_29808 | 302 |
| 92 | 3300050508 | nmdc:mga09592_11_c2 | nmdc:mga09592_11_c2_28694_29623 | 302 |
| 93 | 3300050509 | nmdc:mga0qj67_95_c1 | nmdc:mga0qj67_95_c1_2364_3293 | 302 |
| 94 | 3300050510 | nmdc:mga06r32_73821_c1 | nmdc:mga06r32_73821_c1_14_943 | 302 |
| 95 | 3300054114 | Ga0501084_0219145 | Ga0501084_0219145_508_1446 | 302 |
| 96 | iso_pu_bacteria | 2675903059 | 2676482800 | 302 |
| 97 | iso_pu_bacteria | 8055066027 | 8055069151 | 302 |
| 98 | 3300002077 | JGI24744J21845_10000545 | JGI24744J21845_100005452 | 303 |
| 99 | 3300005327 | Ga0070658_10040098 | Ga0070658_100400983 | 303 |
| 100 | 3300005327 | Ga0070658_10085736 | Ga0070658_100857362 | 303 |
| 101 | 3300005328 | Ga0070676_10036155 | Ga0070676_100361552 | 303 |
| 102 | 3300005329 | Ga0070683_100099023 | Ga0070683_1000990233 | 303 |
| 103 | 3300005329 | Ga0070683_100225704 | Ga0070683_1002257041 | 303 |
| 104 | 3300005329 | Ga0070683_100463737 | Ga0070683_1004637372 | 303 |
| 105 | 3300005330 | Ga0070690_100040037 | Ga0070690_1000400372 | 303 |
| 106 | 3300005334 | Ga0068869_100031104 | Ga0068869_1000311044 | 303 |
| 107 | 3300005334 | Ga0068869_100039413 | Ga0068869_1000394133 | 303 |
| 108 | 3300005334 | Ga0068869_100220673 | Ga0068869_1002206732 | 303 |
| 109 | 3300005335 | Ga0070666_10006718 | Ga0070666_100067185 | 303 |
| 110 | 3300005335 | Ga0070666_10086441 | Ga0070666_100864412 | 303 |
| 111 | 3300005336 | Ga0070680_100045197 | Ga0070680_1000451974 | 303 |
| 112 | 3300005336 | Ga0070680_100056004 | Ga0070680_1000560043 | 303 |
| 113 | 3300005337 | Ga0070682_100005590 | Ga0070682_1000055903 | 303 |
| 114 | 3300005337 | Ga0070682_100017200 | Ga0070682_1000172004 | 303 |
| 115 | 3300005337 | Ga0070682_100051246 | Ga0070682_1000512462 | 303 |
| 116 | 3300005338 | Ga0068868_100015311 | Ga0068868_1000153115 | 303 |
| 117 | 3300005338 | Ga0068868_100059582 | Ga0068868_1000595823 | 303 |
| 118 | 3300005338 | Ga0068868_100073754 | Ga0068868_1000737544 | 303 |
| 119 | 3300005339 | Ga0070660_100010729 | Ga0070660_1000107295 | 303 |
| 120 | 3300005339 | Ga0070660_100036062 | Ga0070660_1000360623 | 303 |
| 121 | 3300005339 | Ga0070660_100038745 | Ga0070660_1000387453 | 303 |
| 122 | 3300005340 | Ga0070689_100031570 | Ga0070689_1000315702 | 303 |
| 123 | 3300005340 | Ga0070689_100034973 | Ga0070689_1000349732 | 303 |
| 124 | 3300005340 | Ga0070689_100069027 | Ga0070689_1000690273 | 303 |
| 125 | 3300005341 | Ga0070691_10061776 | Ga0070691_100617762 | 303 |
| 126 | 3300005343 | Ga0070687_100051835 | Ga0070687_1000518353 | 303 |
| 127 | 3300005344 | Ga0070661_100125786 | Ga0070661_1001257862 | 303 |
| 128 | 3300005345 | Ga0070692_10005129 | Ga0070692_100051291 | 303 |
| 129 | 3300005345 | Ga0070692_10006244 | Ga0070692_100062443 | 303 |
| 130 | 3300005345 | Ga0070692_10077594 | Ga0070692_100775942 | 303 |
| 131 | 3300005347 | Ga0070668_100004474 | Ga0070668_1000044748 | 303 |
| 132 | 3300005347 | Ga0070668_100026766 | Ga0070668_1000267662 | 303 |
| 133 | 3300005354 | Ga0070675_100001736 | Ga0070675_10000173610 | 303 |
| 134 | 3300005355 | Ga0070671_100089434 | Ga0070671_1000894342 | 303 |
| 135 | 3300005356 | Ga0070674_100046836 | Ga0070674_1000468362 | 303 |
| 136 | 3300005364 | Ga0070673_100011571 | Ga0070673_1000115712 | 303 |
| 137 | 3300005365 | Ga0070688_100014703 | Ga0070688_1000147034 | 303 |
| 138 | 3300005366 | Ga0070659_100009691 | Ga0070659_1000096914 | 303 |
| 139 | 3300005366 | Ga0070659_100015288 | Ga0070659_1000152882 | 303 |
| 140 | 3300005366 | Ga0070659_100103578 | Ga0070659_1001035783 | 303 |
| 141 | 3300005367 | Ga0070667_100061539 | Ga0070667_1000615392 | 303 |
| 142 | 3300005406 | Ga0070703_10018689 | Ga0070703_100186892 | 303 |
| 143 | 3300005406 | Ga0070703_10027438 | Ga0070703_100274382 | 303 |
| 144 | 3300005434 | Ga0070709_10030733 | Ga0070709_100307331 | 303 |
| 145 | 3300005435 | Ga0070714_100024226 | Ga0070714_1000242265 | 303 |
| 146 | 3300005436 | Ga0070713_100225978 | Ga0070713_1002259781 | 303 |
| 147 | 3300005438 | Ga0070701_10004503 | Ga0070701_100045034 | 303 |
| 148 | 3300005438 | Ga0070701_10024991 | Ga0070701_100249912 | 303 |
| 149 | 3300005439 | Ga0070711_100001075 | Ga0070711_1000010755 | 303 |
| 150 | 3300005439 | Ga0070711_100018634 | Ga0070711_1000186344 | 303 |
| 151 | 3300005440 | Ga0070705_100012689 | Ga0070705_1000126893 | 303 |
| 152 | 3300005441 | Ga0070700_100007469 | Ga0070700_1000074697 | 303 |
| 153 | 3300005441 | Ga0070700_100018475 | Ga0070700_1000184753 | 303 |
| 154 | 3300005441 | Ga0070700_100271409 | Ga0070700_1002714092 | 303 |
| 155 | 3300005444 | Ga0070694_100021359 | Ga0070694_1000213594 | 303 |
| 156 | 3300005445 | Ga0070708_100245364 | Ga0070708_1002453642 | 303 |
| 157 | 3300005455 | Ga0070663_100004470 | Ga0070663_1000044705 | 303 |
| 158 | 3300005455 | Ga0070663_100007874 | Ga0070663_1000078744 | 303 |
| 159 | 3300005455 | Ga0070663_100030501 | Ga0070663_1000305013 | 303 |
| 160 | 3300005456 | Ga0070678_100019929 | Ga0070678_1000199293 | 303 |
| 161 | 3300005456 | Ga0070678_100261392 | Ga0070678_1002613922 | 303 |
| 162 | 3300005457 | Ga0070662_100015307 | Ga0070662_1000153075 | 303 |
| 163 | 3300005457 | Ga0070662_100037828 | Ga0070662_1000378284 | 303 |
| 164 | 3300005459 | Ga0068867_100010996 | Ga0068867_1000109968 | 303 |
| 165 | 3300005466 | Ga0070685_10006574 | Ga0070685_100065743 | 303 |
| 166 | 3300005466 | Ga0070685_10075681 | Ga0070685_100756811 | 303 |
| 167 | 3300005467 | Ga0070706_100010936 | Ga0070706_10001093610 | 303 |
| 168 | 3300005467 | Ga0070706_100033206 | Ga0070706_1000332061 | 303 |
| 169 | 3300005467 | Ga0070706_100123628 | Ga0070706_1001236283 | 303 |
| 170 | 3300005468 | Ga0070707_100000635 | Ga0070707_10000063537 | 303 |
| 171 | 3300005468 | Ga0070707_100012722 | Ga0070707_1000127223 | 303 |
| 172 | 3300005468 | Ga0070707_100031619 | Ga0070707_1000316198 | 303 |
| 173 | 3300005471 | Ga0070698_100001447 | Ga0070698_10000144712 | 303 |
| 174 | 3300005471 | Ga0070698_100121812 | Ga0070698_1001218122 | 303 |
| 175 | 3300005518 | Ga0070699_100004137 | Ga0070699_10000413712 | 303 |
| 176 | 3300005518 | Ga0070699_100345317 | Ga0070699_1003453172 | 303 |
| 177 | 3300005530 | Ga0070679_100130014 | Ga0070679_1001300142 | 303 |
| 178 | 3300005535 | Ga0070684_100007429 | Ga0070684_1000074298 | 303 |
| 179 | 3300005536 | Ga0070697_100039791 | Ga0070697_1000397912 | 303 |
| 180 | 3300005539 | Ga0068853_100024124 | Ga0068853_1000241246 | 303 |
| 181 | 3300005539 | Ga0068853_100128707 | Ga0068853_1001287073 | 303 |
| 182 | 3300005543 | Ga0070672_100016444 | Ga0070672_1000164445 | 303 |
| 183 | 3300005543 | Ga0070672_100228061 | Ga0070672_1002280612 | 303 |
| 184 | 3300005544 | Ga0070686_100009810 | Ga0070686_1000098105 | 303 |
| 185 | 3300005545 | Ga0070695_100077633 | Ga0070695_1000776332 | 303 |
| 186 | 3300005546 | Ga0070696_100070710 | Ga0070696_1000707101 | 303 |
| 187 | 3300005546 | Ga0070696_100084546 | Ga0070696_1000845463 | 303 |
| 188 | 3300005547 | Ga0070693_100017250 | Ga0070693_1000172505 | 303 |
| 189 | 3300005547 | Ga0070693_100033717 | Ga0070693_1000337172 | 303 |
| 190 | 3300005548 | Ga0070665_100003419 | Ga0070665_10000341913 | 303 |
| 191 | 3300005548 | Ga0070665_100032592 | Ga0070665_1000325925 | 303 |
| 192 | 3300005548 | Ga0070665_100072829 | Ga0070665_1000728293 | 303 |
| 193 | 3300005549 | Ga0070704_100223077 | Ga0070704_1002230772 | 303 |
| 194 | 3300005563 | Ga0068855_100033888 | Ga0068855_1000338884 | 303 |
| 195 | 3300005563 | Ga0068855_100086601 | Ga0068855_1000866013 | 303 |
| 196 | 3300005563 | Ga0068855_100089581 | Ga0068855_1000895814 | 303 |
| 197 | 3300005563 | Ga0068855_100105730 | Ga0068855_1001057303 | 303 |
| 198 | 3300005564 | Ga0070664_100101896 | Ga0070664_1001018962 | 303 |
| 199 | 3300005577 | Ga0068857_100008769 | Ga0068857_1000087696 | 303 |
| 200 | 3300005578 | Ga0068854_100082572 | Ga0068854_1000825722 | 303 |
| 201 | 3300005614 | Ga0068856_100039021 | Ga0068856_1000390213 | 303 |
| 202 | 3300005614 | Ga0068856_100046948 | Ga0068856_1000469482 | 303 |
| 203 | 3300005614 | Ga0068856_100335295 | Ga0068856_1003352952 | 303 |
| 204 | 3300005615 | Ga0070702_100001788 | Ga0070702_1000017883 | 303 |
| 205 | 3300005615 | Ga0070702_100012528 | Ga0070702_1000125282 | 303 |
| 206 | 3300005615 | Ga0070702_100043982 | Ga0070702_1000439822 | 303 |
| 207 | 3300005616 | Ga0068852_100002353 | Ga0068852_10000235310 | 303 |
| 208 | 3300005616 | Ga0068852_100009242 | Ga0068852_1000092426 | 303 |
| 209 | 3300005616 | Ga0068852_100054285 | Ga0068852_1000542852 | 303 |
| 210 | 3300005616 | Ga0068852_100218138 | Ga0068852_1002181381 | 303 |
| 211 | 3300005617 | Ga0068859_100075629 | Ga0068859_1000756292 | 303 |
| 212 | 3300005618 | Ga0068864_100035439 | Ga0068864_1000354393 | 303 |
| 213 | 3300005718 | Ga0068866_10007635 | Ga0068866_100076355 | 303 |
| 214 | 3300005718 | Ga0068866_10210285 | Ga0068866_102102852 | 303 |
| 215 | 3300005719 | Ga0068861_100011898 | Ga0068861_1000118982 | 303 |
| 216 | 3300005719 | Ga0068861_100090326 | Ga0068861_1000903262 | 303 |
| 217 | 3300005834 | Ga0068851_10006785 | Ga0068851_100067854 | 303 |
| 218 | 3300005841 | Ga0068863_100060043 | Ga0068863_1000600434 | 303 |
| 219 | 3300005841 | Ga0068863_100222824 | Ga0068863_1002228242 | 303 |
| 220 | 3300005842 | Ga0068858_100140183 | Ga0068858_1001401832 | 303 |
| 221 | 3300005843 | Ga0068860_100111399 | Ga0068860_1001113992 | 303 |
| 222 | 3300005844 | Ga0068862_100109523 | Ga0068862_1001095232 | 303 |
| 223 | 3300005844 | Ga0068862_100312772 | Ga0068862_1003127722 | 303 |
| 224 | 3300005983 | Ga0081540_1003473 | Ga0081540_10034739 | 303 |
| 225 | 3300005985 | Ga0081539_10038831 | Ga0081539_100388312 | 303 |
| 226 | 3300006028 | Ga0070717_10079799 | Ga0070717_100797992 | 303 |
| 227 | 3300006038 | Ga0075365_10185883 | Ga0075365_101858832 | 303 |
| 228 | 3300006173 | Ga0070716_100011674 | Ga0070716_1000116744 | 303 |
| 229 | 3300006175 | Ga0070712_100025640 | Ga0070712_1000256403 | 303 |
| 230 | 3300006178 | Ga0075367_10036937 | Ga0075367_100369373 | 303 |
| 231 | 3300006237 | Ga0097621_100013980 | Ga0097621_1000139802 | 303 |
| 232 | 3300006237 | Ga0097621_100015174 | Ga0097621_1000151742 | 303 |
| 233 | 3300006237 | Ga0097621_100048732 | Ga0097621_1000487324 | 303 |
| 234 | 3300006358 | Ga0068871_100006377 | Ga0068871_1000063777 | 303 |
| 235 | 3300006358 | Ga0068871_100014424 | Ga0068871_1000144246 | 303 |
| 236 | 3300006358 | Ga0068871_100041942 | Ga0068871_1000419423 | 303 |
| 237 | 3300006844 | Ga0075428_100062002 | Ga0075428_1000620024 | 303 |
| 238 | 3300006846 | Ga0075430_100003484 | Ga0075430_1000034842 | 303 |
| 239 | 3300006846 | Ga0075430_100136720 | Ga0075430_1001367202 | 303 |
| 240 | 3300006847 | Ga0075431_100012225 | Ga0075431_1000122256 | 303 |
| 241 | 3300006852 | Ga0075433_10425664 | Ga0075433_104256642 | 303 |
| 242 | 3300006880 | Ga0075429_100013032 | Ga0075429_1000130328 | 303 |
| 243 | 3300006881 | Ga0068865_100004949 | Ga0068865_1000049492 | 303 |
| 244 | 3300006881 | Ga0068865_100014446 | Ga0068865_1000144463 | 303 |
| 245 | 3300006914 | Ga0075436_100005573 | Ga0075436_1000055731 | 303 |
| 246 | 3300006914 | Ga0075436_100058529 | Ga0075436_1000585292 | 303 |
| 247 | 3300006931 | Ga0097620_100075631 | Ga0097620_1000756312 | 303 |
| 248 | 3300007076 | Ga0075435_100014980 | Ga0075435_1000149806 | 303 |
| 249 | 3300007076 | Ga0075435_100020196 | Ga0075435_1000201964 | 303 |
| 250 | 3300009093 | Ga0105240_10118923 | Ga0105240_101189234 | 303 |
| 251 | 3300009094 | Ga0111539_10045488 | Ga0111539_100454884 | 303 |
| 252 | 3300009098 | Ga0105245_10044961 | Ga0105245_100449613 | 303 |
| 253 | 3300009098 | Ga0105245_10046722 | Ga0105245_100467222 | 303 |
| 254 | 3300009101 | Ga0105247_10005243 | Ga0105247_100052435 | 303 |
| 255 | 3300009101 | Ga0105247_10033774 | Ga0105247_100337742 | 303 |
| 256 | 3300009148 | Ga0105243_10030792 | Ga0105243_100307924 | 303 |
| 257 | 3300009148 | Ga0105243_10038471 | Ga0105243_100384713 | 303 |
| 258 | 3300009148 | Ga0105243_10067972 | Ga0105243_100679722 | 303 |
| 259 | 3300009174 | Ga0105241_10033100 | Ga0105241_100331003 | 303 |
| 260 | 3300009176 | Ga0105242_10014129 | Ga0105242_100141294 | 303 |
| 261 | 3300009176 | Ga0105242_10181238 | Ga0105242_101812382 | 303 |
| 262 | 3300009177 | Ga0105248_10026459 | Ga0105248_100264595 | 303 |
| 263 | 3300009177 | Ga0105248_10045083 | Ga0105248_100450832 | 303 |
| 264 | 3300009177 | Ga0105248_10047870 | Ga0105248_100478702 | 303 |
| 265 | 3300009177 | Ga0105248_10166209 | Ga0105248_101662092 | 303 |
| 266 | 3300009545 | Ga0105237_10164035 | Ga0105237_101640352 | 303 |
| 267 | 3300009551 | Ga0105238_10041390 | Ga0105238_100413902 | 303 |
| 268 | 3300009551 | Ga0105238_10086054 | Ga0105238_100860542 | 303 |
| 269 | 3300009553 | Ga0105249_10001347 | Ga0105249_1000134714 | 303 |
| 270 | 3300009553 | Ga0105249_10024591 | Ga0105249_100245916 | 303 |
| 271 | 3300009553 | Ga0105249_10576702 | Ga0105249_105767021 | 303 |
| 272 | 3300010375 | Ga0105239_10009547 | Ga0105239_100095477 | 303 |
| 273 | 3300010375 | Ga0105239_10057810 | Ga0105239_100578104 | 303 |
| 274 | 3300011119 | Ga0105246_10398628 | Ga0105246_103986282 | 303 |
| 275 | 3300013102 | Ga0157371_10010959 | Ga0157371_100109596 | 303 |
| 276 | 3300013104 | Ga0157370_10109761 | Ga0157370_101097613 | 303 |
| 277 | 3300013105 | Ga0157369_10254116 | Ga0157369_102541162 | 303 |
| 278 | 3300013296 | Ga0157374_10015577 | Ga0157374_100155776 | 303 |
| 279 | 3300013297 | Ga0157378_10006940 | Ga0157378_100069405 | 303 |
| 280 | 3300013297 | Ga0157378_10223309 | Ga0157378_102233092 | 303 |
| 281 | 3300013306 | Ga0163162_10013364 | Ga0163162_100133644 | 303 |
| 282 | 3300013306 | Ga0163162_10027647 | Ga0163162_100276474 | 303 |
| 283 | 3300013308 | Ga0157375_10024586 | Ga0157375_100245862 | 303 |
| 284 | 3300013308 | Ga0157375_10064065 | Ga0157375_100640652 | 303 |
| 285 | 3300013308 | Ga0157375_10083117 | Ga0157375_100831173 | 303 |
| 286 | 3300014325 | Ga0163163_10029525 | Ga0163163_100295255 | 303 |
| 287 | 3300014325 | Ga0163163_10033950 | Ga0163163_100339502 | 303 |
| 288 | 3300014326 | Ga0157380_10008097 | Ga0157380_100080975 | 303 |
| 289 | 3300014745 | Ga0157377_10005998 | Ga0157377_100059985 | 303 |
| 290 | 3300014745 | Ga0157377_10022170 | Ga0157377_100221704 | 303 |
| 291 | 3300014968 | Ga0157379_10505087 | Ga0157379_105050871 | 303 |
| 292 | 3300014969 | Ga0157376_10020185 | Ga0157376_100201855 | 303 |
| 293 | 3300014969 | Ga0157376_10036577 | Ga0157376_100365774 | 303 |
| 294 | 3300017792 | Ga0163161_10010508 | Ga0163161_100105085 | 303 |
| 295 | 3300020081 | Ga0206354_10719510 | Ga0206354_107195103 | 303 |
| 296 | 3300020081 | Ga0206354_10843100 | Ga0206354_108431002 | 303 |
| 297 | 3300025898 | Ga0207692_10004373 | Ga0207692_100043732 | 303 |
| 298 | 3300025899 | Ga0207642_10004902 | Ga0207642_100049025 | 303 |
| 299 | 3300025900 | Ga0207710_10130136 | Ga0207710_101301361 | 303 |
| 300 | 3300025901 | Ga0207688_10023993 | Ga0207688_100239932 | 303 |
| 301 | 3300025901 | Ga0207688_10036365 | Ga0207688_100363651 | 303 |
| 302 | 3300025901 | Ga0207688_10044967 | Ga0207688_100449672 | 303 |
| 303 | 3300025903 | Ga0207680_10026642 | Ga0207680_100266423 | 303 |
| 304 | 3300025903 | Ga0207680_10056408 | Ga0207680_100564083 | 303 |
| 305 | 3300025904 | Ga0207647_10008509 | Ga0207647_100085096 | 303 |
| 306 | 3300025904 | Ga0207647_10033696 | Ga0207647_100336963 | 303 |
| 307 | 3300025906 | Ga0207699_10041704 | Ga0207699_100417043 | 303 |
| 308 | 3300025907 | Ga0207645_10067108 | Ga0207645_100671083 | 303 |
| 309 | 3300025907 | Ga0207645_10090760 | Ga0207645_100907603 | 303 |
| 310 | 3300025908 | Ga0207643_10000112 | Ga0207643_1000011211 | 303 |
| 311 | 3300025909 | Ga0207705_10094338 | Ga0207705_100943382 | 303 |
| 312 | 3300025909 | Ga0207705_10171805 | Ga0207705_101718052 | 303 |
| 313 | 3300025910 | Ga0207684_10091589 | Ga0207684_100915892 | 303 |
| 314 | 3300025911 | Ga0207654_10096048 | Ga0207654_100960481 | 303 |
| 315 | 3300025914 | Ga0207671_10052335 | Ga0207671_100523352 | 303 |
| 316 | 3300025914 | Ga0207671_10127655 | Ga0207671_101276552 | 303 |
| 317 | 3300025915 | Ga0207693_10000409 | Ga0207693_1000040915 | 303 |
| 318 | 3300025915 | Ga0207693_10001176 | Ga0207693_1000117613 | 303 |
| 319 | 3300025916 | Ga0207663_10060209 | Ga0207663_100602092 | 303 |
| 320 | 3300025917 | Ga0207660_10222278 | Ga0207660_102222782 | 303 |
| 321 | 3300025918 | Ga0207662_10052854 | Ga0207662_100528542 | 303 |
| 322 | 3300025919 | Ga0207657_10005213 | Ga0207657_100052138 | 303 |
| 323 | 3300025919 | Ga0207657_10065016 | Ga0207657_100650162 | 303 |
| 324 | 3300025919 | Ga0207657_10119832 | Ga0207657_101198322 | 303 |
| 325 | 3300025921 | Ga0207652_10012926 | Ga0207652_100129265 | 303 |
| 326 | 3300025921 | Ga0207652_10045951 | Ga0207652_100459514 | 303 |
| 327 | 3300025922 | Ga0207646_10002084 | Ga0207646_1000208424 | 303 |
| 328 | 3300025922 | Ga0207646_10007636 | Ga0207646_1000763611 | 303 |
| 329 | 3300025924 | Ga0207694_10047309 | Ga0207694_100473092 | 303 |
| 330 | 3300025925 | Ga0207650_10004590 | Ga0207650_100045905 | 303 |
| 331 | 3300025926 | Ga0207659_10005948 | Ga0207659_100059484 | 303 |
| 332 | 3300025927 | Ga0207687_10003050 | Ga0207687_100030503 | 303 |
| 333 | 3300025927 | Ga0207687_10056798 | Ga0207687_100567981 | 303 |
| 334 | 3300025928 | Ga0207700_10123007 | Ga0207700_101230072 | 303 |
| 335 | 3300025929 | Ga0207664_10025967 | Ga0207664_100259675 | 303 |
| 336 | 3300025929 | Ga0207664_10042739 | Ga0207664_100427392 | 303 |
| 337 | 3300025931 | Ga0207644_10081838 | Ga0207644_100818383 | 303 |
| 338 | 3300025931 | Ga0207644_10100121 | Ga0207644_101001213 | 303 |
| 339 | 3300025932 | Ga0207690_10027965 | Ga0207690_100279653 | 303 |
| 340 | 3300025932 | Ga0207690_10090892 | Ga0207690_100908922 | 303 |
| 341 | 3300025932 | Ga0207690_10108327 | Ga0207690_101083272 | 303 |
| 342 | 3300025932 | Ga0207690_10352944 | Ga0207690_103529441 | 303 |
| 343 | 3300025933 | Ga0207706_10003043 | Ga0207706_100030437 | 303 |
| 344 | 3300025933 | Ga0207706_10024684 | Ga0207706_100246845 | 303 |
| 345 | 3300025934 | Ga0207686_10003864 | Ga0207686_100038645 | 303 |
| 346 | 3300025934 | Ga0207686_10026043 | Ga0207686_100260434 | 303 |
| 347 | 3300025935 | Ga0207709_10012187 | Ga0207709_100121874 | 303 |
| 348 | 3300025935 | Ga0207709_10062374 | Ga0207709_100623742 | 303 |
| 349 | 3300025937 | Ga0207669_10021389 | Ga0207669_100213894 | 303 |
| 350 | 3300025937 | Ga0207669_10072106 | Ga0207669_100721063 | 303 |
| 351 | 3300025938 | Ga0207704_10005166 | Ga0207704_100051667 | 303 |
| 352 | 3300025938 | Ga0207704_10079420 | Ga0207704_100794202 | 303 |
| 353 | 3300025939 | Ga0207665_10006099 | Ga0207665_100060994 | 303 |
| 354 | 3300025939 | Ga0207665_10181263 | Ga0207665_101812632 | 303 |
| 355 | 3300025940 | Ga0207691_10022722 | Ga0207691_100227225 | 303 |
| 356 | 3300025940 | Ga0207691_10142454 | Ga0207691_101424543 | 303 |
| 357 | 3300025942 | Ga0207689_10000247 | Ga0207689_1000024739 | 303 |
| 358 | 3300025942 | Ga0207689_10057931 | Ga0207689_100579313 | 303 |
| 359 | 3300025944 | Ga0207661_10021608 | Ga0207661_100216085 | 303 |
| 360 | 3300025944 | Ga0207661_10025730 | Ga0207661_100257304 | 303 |
| 361 | 3300025944 | Ga0207661_10079054 | Ga0207661_100790542 | 303 |
| 362 | 3300025945 | Ga0207679_10187512 | Ga0207679_101875121 | 303 |
| 363 | 3300025949 | Ga0207667_10019931 | Ga0207667_100199318 | 303 |
| 364 | 3300025949 | Ga0207667_10273780 | Ga0207667_102737802 | 303 |
| 365 | 3300025960 | Ga0207651_10041567 | Ga0207651_100415672 | 303 |
| 366 | 3300025972 | Ga0207668_10008002 | Ga0207668_100080025 | 303 |
| 367 | 3300025972 | Ga0207668_10127140 | Ga0207668_101271401 | 303 |
| 368 | 3300025981 | Ga0207640_10061985 | Ga0207640_100619852 | 303 |
| 369 | 3300026023 | Ga0207677_10009652 | Ga0207677_100096522 | 303 |
| 370 | 3300026035 | Ga0207703_10185058 | Ga0207703_101850582 | 303 |
| 371 | 3300026035 | Ga0207703_10201433 | Ga0207703_102014332 | 303 |
| 372 | 3300026067 | Ga0207678_10002660 | Ga0207678_1000266011 | 303 |
| 373 | 3300026067 | Ga0207678_10004730 | Ga0207678_100047305 | 303 |
| 374 | 3300026067 | Ga0207678_10006233 | Ga0207678_100062334 | 303 |
| 375 | 3300026067 | Ga0207678_10007527 | Ga0207678_100075273 | 303 |
| 376 | 3300026075 | Ga0207708_10001288 | Ga0207708_1000128818 | 303 |
| 377 | 3300026075 | Ga0207708_10010392 | Ga0207708_100103925 | 303 |
| 378 | 3300026075 | Ga0207708_10168519 | Ga0207708_101685192 | 303 |
| 379 | 3300026078 | Ga0207702_10003223 | Ga0207702_100032235 | 303 |
| 380 | 3300026078 | Ga0207702_10025530 | Ga0207702_100255303 | 303 |
| 381 | 3300026078 | Ga0207702_10065017 | Ga0207702_100650172 | 303 |
| 382 | 3300026078 | Ga0207702_10159160 | Ga0207702_101591602 | 303 |
| 383 | 3300026088 | Ga0207641_10201328 | Ga0207641_102013282 | 303 |
| 384 | 3300026088 | Ga0207641_10205724 | Ga0207641_102057241 | 303 |
| 385 | 3300026089 | Ga0207648_10000136 | Ga0207648_1000013661 | 303 |
| 386 | 3300026095 | Ga0207676_10001377 | Ga0207676_1000137711 | 303 |
| 387 | 3300026116 | Ga0207674_10023525 | Ga0207674_100235254 | 303 |
| 388 | 3300026118 | Ga0207675_100053991 | Ga0207675_1000539912 | 303 |
| 389 | 3300026118 | Ga0207675_100102502 | Ga0207675_1001025022 | 303 |
| 390 | 3300026118 | Ga0207675_100117780 | Ga0207675_1001177802 | 303 |
| 391 | 3300026121 | Ga0207683_10000371 | Ga0207683_1000037132 | 303 |
| 392 | 3300026121 | Ga0207683_10001767 | Ga0207683_1000176712 | 303 |
| 393 | 3300026121 | Ga0207683_10005450 | Ga0207683_1000545010 | 303 |
| 394 | 3300027907 | Ga0207428_10017252 | Ga0207428_100172524 | 303 |
| 395 | 3300027907 | Ga0207428_10028153 | Ga0207428_100281531 | 303 |
| 396 | 3300028379 | Ga0268266_10017670 | Ga0268266_100176705 | 303 |
| 397 | 3300028380 | Ga0268265_10075331 | Ga0268265_100753312 | 303 |
| 398 | 3300028380 | Ga0268265_10251362 | Ga0268265_102513622 | 303 |
| 399 | 3300028381 | Ga0268264_10027520 | Ga0268264_100275205 | 303 |
| 400 | 3300028381 | Ga0268264_10143485 | Ga0268264_101434852 | 303 |
| 401 | 3300028381 | Ga0268264_10526121 | Ga0268264_105261212 | 303 |
| 402 | 3300031733 | Ga0316577_10153117 | Ga0316577_101531171 | 303 |
| 403 | 3300031852 | Ga0307410_10256611 | Ga0307410_102566112 | 303 |
| 404 | 3300031901 | Ga0307406_10008721 | Ga0307406_100087214 | 303 |
| 405 | 3300031901 | Ga0307406_10072018 | Ga0307406_100720182 | 303 |
| 406 | 3300031903 | Ga0307407_10232777 | Ga0307407_102327772 | 303 |
| 407 | 3300033179 | Ga0307507_10000090 | Ga0307507_10000090106 | 303 |
| 408 | 3300034957 | Ga0373938_0007430 | Ga0373938_0007430_824_1762 | 303 |
| 409 | 3300034957 | Ga0373938_0018038 | Ga0373938_0018038_411_1325 | 303 |
| 410 | 3300035091 | Ga0373951_0021390 | Ga0373951_0021390_312_1250 | 303 |
| 411 | 3300035170 | Ga0373943_0143582 | Ga0373943_0143582_166_1095 | 303 |
| 412 | 3300035691 | Ga0373931_0063704 | Ga0373931_0063704_814_1752 | 303 |
| 413 | 3300037312 | Ga0395899_0007122 | Ga0395899_0007122_280_1236 | 303 |
| 414 | 3300037312 | Ga0395899_0013580 | Ga0395899_0013580_2837_3772 | 303 |
| 415 | 3300037312 | Ga0395899_0088251 | Ga0395899_0088251_496_1425 | 303 |
| 416 | 3300037418 | Ga0395900_0093344 | Ga0395900_0093344_95_1051 | 303 |
| 417 | 3300037471 | Ga0395905_0304086 | Ga0395905_0304086_432_1388 | 303 |
| 418 | 3300037853 | Ga0436364_1475170 | Ga0436364_1475170_2469_3431 | 303 |
| 419 | 3300038443 | Ga0395901_0442324 | Ga0395901_0442324_280_1236 | 303 |
| 420 | 3300038735 | Ga0400485_15906 | Ga0400485_15906_1082_2020 | 303 |
| 421 | 3300041456 | Ga0451795_1479959 | Ga0451795_1479959_953_1882 | 303 |
| 422 | 3300041459 | Ga0451800_0130591 | Ga0451800_0130591_177_1106 | 303 |
| 423 | 3300041491 | Ga0451833_0174647 | Ga0451833_0174647_1200_2129 | 303 |
| 424 | 3300041496 | Ga0451839_1186836 | Ga0451839_1186836_1250_2179 | 303 |
| 425 | 3300041512 | Ga0451853_1398733 | Ga0451853_1398733_1118_2047 | 303 |
| 426 | 3300042008 | Ga0439450_025599 | Ga0439450_025599_121_1038 | 303 |
| 427 | 3300042157 | Ga0439458_0021472 | Ga0439458_0021472_399_1337 | 303 |
| 428 | 3300042438 | Ga0439459_0004658 | Ga0439459_0004658_356_1294 | 303 |
| 429 | 3300044694 | Ga0466963_0067077 | Ga0466963_0067077_1209_2252 | 303 |
| 430 | 3300044694 | Ga0466963_0138280 | Ga0466963_0138280_441_1484 | 303 |
| 431 | 3300044765 | Ga0466970_0017951 | Ga0466970_0017951_2649_3590 | 303 |
| 432 | 3300044842 | Ga0466957_0023206 | Ga0466957_0023206_1971_3002 | 303 |
| 433 | 3300044842 | Ga0466957_0122923 | Ga0466957_0122923_357_1400 | 303 |
| 434 | 3300044901 | Ga0466960_0006554 | Ga0466960_0006554_2923_3915 | 303 |
| 435 | 3300044901 | Ga0466960_0008279 | Ga0466960_0008279_3171_4163 | 303 |
| 436 | 3300044901 | Ga0466960_0020471 | Ga0466960_0020471_1819_2850 | 303 |
| 437 | 3300045836 | Ga0466958_0010057 | Ga0466958_0010057_3010_4119 | 303 |
| 438 | 3300045976 | Ga0466967_0070336 | Ga0466967_0070336_1090_2121 | 303 |
| 439 | 3300046455 | Ga0495603_0163354 | Ga0495603_0163354_130_1089 | 303 |
| 440 | 3300046461 | Ga0495641_0046397 | Ga0495641_0046397_781_1740 | 303 |
| 441 | 3300046473 | Ga0495582_0019253 | Ga0495582_0019253_1043_2002 | 303 |
| 442 | 3300046473 | Ga0495582_0051079 | Ga0495582_0051079_151_1110 | 303 |
| 443 | 3300046500 | Ga0495596_0081277 | Ga0495596_0081277_91_1020 | 303 |
| 444 | 3300046501 | Ga0495607_0071824 | Ga0495607_0071824_543_1502 | 303 |
| 445 | 3300046516 | Ga0495628_0233265 | Ga0495628_0233265_391_1305 | 303 |
| 446 | 3300046525 | Ga0495663_0022204 | Ga0495663_0022204_388_1317 | 303 |
| 447 | 3300046538 | Ga0495609_0072193 | Ga0495609_0072193_57_1004 | 303 |
| 448 | 3300046615 | Ga0495656_0062822 | Ga0495656_0062822_320_1279 | 303 |
| 449 | 3300046616 | Ga0495668_0075739 | Ga0495668_0075739_533_1462 | 303 |
| 450 | 3300046674 | Ga0495588_0206037 | Ga0495588_0206037_38_982 | 303 |
| 451 | 3300046681 | Ga0495647_0045356 | Ga0495647_0045356_60_1019 | 303 |
| 452 | 3300046794 | Ga0495589_0089684 | Ga0495589_0089684_178_1107 | 303 |
| 453 | 3300047321 | Ga0495676_0104132 | Ga0495676_0104132_260_1219 | 303 |
| 454 | 3300047445 | Ga0495677_0067882 | Ga0495677_0067882_245_1204 | 303 |
| 455 | 3300047471 | Ga0495684_0050774 | Ga0495684_0050774_1395_2309 | 303 |
| 456 | 3300048089 | Ga0495614_0060465 | Ga0495614_0060465_432_1391 | 303 |
| 457 | 3300048903 | Ga0496100_0234149 | Ga0496100_0234149_301_1239 | 303 |
| 458 | 3300048904 | Ga0496101_0001995 | Ga0496101_0001995_8299_9258 | 303 |
| 459 | 3300048904 | Ga0496101_0321973 | Ga0496101_0321973_144_1082 | 303 |
| 460 | 3300048905 | Ga0496102_0015059 | Ga0496102_0015059_2474_3433 | 303 |
| 461 | 3300048905 | Ga0496102_0105287 | Ga0496102_0105287_1014_1952 | 303 |
| 462 | 3300048906 | Ga0496103_0004353 | Ga0496103_0004353_4744_5703 | 303 |
| 463 | 3300048907 | Ga0496104_0054633 | Ga0496104_0054633_715_1752 | 303 |
| 464 | 3300048907 | Ga0496104_0139194 | Ga0496104_0139194_41_979 | 303 |
| 465 | 3300048908 | Ga0496105_0013282 | Ga0496105_0013282_4170_5108 | 303 |
| 466 | 3300048908 | Ga0496105_0045250 | Ga0496105_0045250_54_983 | 303 |
| 467 | 3300048908 | Ga0496105_0178068 | Ga0496105_0178068_147_1085 | 303 |
| 468 | 3300048908 | Ga0496105_0211082 | Ga0496105_0211082_551_1510 | 303 |
| 469 | 3300048909 | Ga0496106_0003272 | Ga0496106_0003272_3648_4586 | 303 |
| 470 | 3300048909 | Ga0496106_0003308 | Ga0496106_0003308_7316_8275 | 303 |
| 471 | 3300048910 | Ga0496107_0014241 | Ga0496107_0014241_2456_3415 | 303 |
| 472 | 3300048911 | Ga0496108_0009239 | Ga0496108_0009239_1071_2108 | 303 |
| 473 | 3300048911 | Ga0496108_0112864 | Ga0496108_0112864_10_948 | 303 |
| 474 | 3300048911 | Ga0496108_0175768 | Ga0496108_0175768_746_1684 | 303 |
| 475 | 3300048911 | Ga0496108_0265716 | Ga0496108_0265716_260_1273 | 303 |
| 476 | 3300048912 | Ga0496109_0004612 | Ga0496109_0004612_7022_8059 | 303 |
| 477 | 3300048912 | Ga0496109_0020626 | Ga0496109_0020626_1205_2164 | 303 |
| 478 | 3300048912 | Ga0496109_0032504 | Ga0496109_0032504_174_1112 | 303 |
| 479 | 3300048912 | Ga0496109_0037431 | Ga0496109_0037431_1333_2271 | 303 |
| 480 | 3300048912 | Ga0496109_0482993 | Ga0496109_0482993_73_1086 | 303 |
| 481 | 3300048913 | Ga0496110_0007957 | Ga0496110_0007957_4520_5557 | 303 |
| 482 | 3300048913 | Ga0496110_0058833 | Ga0496110_0058833_1979_2917 | 303 |
| 483 | 3300048913 | Ga0496110_0090814 | Ga0496110_0090814_283_1212 | 303 |
| 484 | 3300048913 | Ga0496110_0146853 | Ga0496110_0146853_1070_2008 | 303 |
| 485 | 3300048914 | Ga0496111_0004766 | Ga0496111_0004766_7516_8454 | 303 |
| 486 | 3300048914 | Ga0496111_0011523 | Ga0496111_0011523_516_1553 | 303 |
| 487 | 3300048915 | Ga0496112_0016365 | Ga0496112_0016365_1177_2106 | 303 |
| 488 | 3300048915 | Ga0496112_0020727 | Ga0496112_0020727_397_1356 | 303 |
| 489 | 3300048915 | Ga0496112_0081851 | Ga0496112_0081851_1338_2276 | 303 |
| 490 | 3300048917 | Ga0496114_0039819 | Ga0496114_0039819_450_1388 | 303 |
| 491 | 3300048918 | Ga0496115_0003007 | Ga0496115_0003007_6702_7661 | 303 |
| 492 | 3300048918 | Ga0496115_0003930 | Ga0496115_0003930_7734_8672 | 303 |
| 493 | 3300049569 | Ga0501032_0014627 | Ga0501032_0014627_1239_2276 | 303 |
| 494 | 3300049571 | Ga0501034_0042176 | Ga0501034_0042176_2171_3208 | 303 |
| 495 | 3300049572 | Ga0501036_0105172 | Ga0501036_0105172_362_1399 | 303 |
| 496 | 3300049572 | Ga0501036_0158258 | Ga0501036_0158258_957_1871 | 303 |
| 497 | 3300049574 | Ga0501038_0003462 | Ga0501038_0003462_5482_6519 | 303 |
| 498 | 3300049575 | Ga0501039_0043255 | Ga0501039_0043255_467_1381 | 303 |
| 499 | 3300049576 | Ga0501040_0010511 | Ga0501040_0010511_3546_4460 | 303 |
| 500 | 3300049580 | Ga0501046_0163438 | Ga0501046_0163438_605_1642 | 303 |
| 501 | 3300049581 | Ga0501047_0003842 | Ga0501047_0003842_8415_9452 | 303 |
| 502 | 3300049582 | Ga0501048_0001586 | Ga0501048_0001586_14389_15426 | 303 |
| 503 | 3300049582 | Ga0501048_0079127 | Ga0501048_0079127_425_1339 | 303 |
| 504 | 3300049588 | Ga0501072_0120312 | Ga0501072_0120312_1059_2057 | 303 |
| 505 | 3300049822 | Ga0501035_0021169 | Ga0501035_0021169_3180_4217 | 303 |
| 506 | 3300049823 | Ga0501044_0028149 | Ga0501044_0028149_3248_4285 | 303 |
| 507 | 3300050494 | nmdc:mga06z11_103606_c1 | nmdc:mga06z11_103606_c1_132_1046 | 303 |
| 508 | 3300050509 | nmdc:mga0qj67_2886_c1 | nmdc:mga0qj67_2886_c1_624_1556 | 303 |
| 509 | 3300050511 | nmdc:mga08y16_23821_c1 | nmdc:mga08y16_23821_c1_3714_4652 | 303 |
| 510 | 3300050512 | nmdc:mga0n895_147901_c1 | nmdc:mga0n895_147901_c1_10_948 | 303 |
| 511 | 3300050512 | nmdc:mga0n895_56284_c1 | nmdc:mga0n895_56284_c1_194_1132 | 303 |
| 512 | 3300050513 | nmdc:mga0rr50_2965_c1 | nmdc:mga0rr50_2965_c1_1085_2023 | 303 |
| 513 | 3300050513 | nmdc:mga0rr50_32652_c1 | nmdc:mga0rr50_32652_c1_958_1896 | 303 |
| 514 | 3300050515 | nmdc:mga0a205_30741_c1 | nmdc:mga0a205_30741_c1_2037_2975 | 303 |
| 515 | 3300053085 | Ga0495619_0054362 | Ga0495619_0054362_120_1034 | 303 |
| 516 | 3300053104 | Ga0500556_0000873 | Ga0500556_0000873_180_1094 | 303 |
| 517 | 3300053117 | Ga0500593_000011 | Ga0500593_000011_45682_46596 | 303 |
| 518 | iso_pu_bacteria | 2515154155 | 2515855055 | 303 |
| 519 | iso_pu_bacteria | 2837268691 | 2837273106 | 303 |
| 520 | iso_pu_bacteria | 2868088558 | 2868091040 | 303 |
| 521 | iso_pu_bacteria | 2891968417 | 2891970333 | 303 |
| 522 | 3300005436 | Ga0070713_100265278 | Ga0070713_1002652782 | 304 |
| 523 | 3300048912 | Ga0496109_0008315 | Ga0496109_0008315_1692_2618 | 304 |
| 524 | 3300048915 | Ga0496112_0001031 | Ga0496112_0001031_13010_13936 | 304 |
| 525 | 3300049588 | Ga0501072_0048035 | Ga0501072_0048035_1006_1953 | 304 |
| 526 | 3300054114 | Ga0501084_0000039 | Ga0501084_0000039_49365_50312 | 304 |
| 527 | 3300001990 | JGI24737J22298_10030121 | JGI24737J22298_100301212 | 307 |
| 528 | 3300009098 | Ga0105245_10322263 | Ga0105245_103222632 | 307 |
| 529 | 3300031456 | Ga0307513_10235564 | Ga0307513_102355642 | 307 |
| 530 | iso_pu_bacteria | 2816332119 | 2816427906 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9401 | 2 | 222 |
| 7ahd-assembly1.cif.gz_D | opua (e190q) occluded | 0.9367 | 14 | 219 |
| 5lil-assembly1.cif.gz_B | structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) | 0.9301 | 2 | 214 |
| 7cha-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with amppnp | 0.9296 | 2 | 221 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.9292 | 3 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33189_10_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9673 | 2 | 222 | 3.40.50.300 |
| af_Q58429_1_224_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9673 | 2 | 214 | 3.40.50.300 |
| af_P36879_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9669 | 2 | 214 | 3.40.50.300 |
| af_A4I2P8_1496_1744_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9668 | 2 | 224 | 3.40.50.300 |
| af_P0A9U1_321_563_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9667 | 2 | 224 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R0D0B4-F1-model_v4 | ABC transporter domain-containing protein | 0.9716 | 2 | 219 |
GO:0005524
GO:0016887 |
| AF-A0A1V5YM67-F1-model_v4 | Daunorubicin/doxorubicin resistance ATP-binding protein DrrA (EC 3.6.3.-) | 0.9699 | 2 | 215 |
GO:0005524
GO:0016887 GO:0017004 GO:0022857 |
| AF-A0A535F3M6-F1-model_v4 | ABC transporter ATP-binding protein | 0.969 | 2 | 221 |
GO:0005524
GO:0016887 |
| AF-A0A381GRC3-F1-model_v4 | deleted | 0.9688 | 2 | 214 |
|
| AF-A0A3D2KNM8-F1-model_v4 | ABC transporter | 0.9687 | 1 | 221 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar