F459962

General Info

Members Datasets Scaffolds Average Seq Length
530 323 1060 154

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10634828|Ga0207693_106348281
Length 167
Sequence MAEPLQVTIRRARCDDVSFIVAMLADDALGSARERLDDPLPESYFRAFETLDRDPNIELVVAQDGEGTVVGCLQLCILPGLSSQGASRGLIEDVRVAAHCRSRGIGEQLVQWALGQARAKGCKLVELLTHHTRLDAQRFYERLCPYPIRASGEIASDRAENPSFQLK

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
305 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
306 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
307 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
308 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
311 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
312 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
313 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
314 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
315 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
316 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
317 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
318 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
319 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
320 2791355199
321 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
322 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
323 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.19
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 0.57
Rhizoplane 7.74
Rhizosphere 75.47
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10634828 3300025915 Bacteria 830
2 JGI25406J46586_10003448 3300003203 Bacteria 7430
3 JGI25404J52841_10005083 3300003659 Bacteria 2706
4 JGI25404J52841_10015370 3300003659 Bacteria 1661
5 Ga0070683_100036236 3300005329 Bacteria 4513
6 Ga0070683_100102126 3300005329 Bacteria 2701
7 Ga0068869_100189496 3300005334 Bacteria 1617
8 Ga0068869_100871786 3300005334 Bacteria 778
9 Ga0068869_101256501 3300005334 Bacteria 652
10 Ga0070680_100145084 3300005336 Bacteria 1991
11 Ga0070682_100131477 3300005337 Bacteria 1694
12 Ga0068868_100067221 3300005338 Bacteria 2852
13 Ga0068868_100565444 3300005338 Bacteria 1004
14 Ga0068868_100611445 3300005338 Bacteria 967
15 Ga0070660_100017102 3300005339 Bacteria 5280
16 Ga0070691_10018438 3300005341 Bacteria 3218
17 Ga0070661_100185979 3300005344 Bacteria 1583
18 Ga0070668_100301243 3300005347 Bacteria 1344
19 Ga0070668_101552849 3300005347 Bacteria 606
20 Ga0070669_100088867 3300005353 Bacteria 2313
21 Ga0070671_100401534 3300005355 Bacteria 1172
22 Ga0070674_100698912 3300005356 Bacteria 867
23 Ga0070709_10381656 3300005434 Bacteria 1048
24 Ga0070709_10751148 3300005434 Bacteria 762
25 Ga0070714_100075438 3300005435 Bacteria 2926
26 Ga0070714_100147968 3300005435 Bacteria 2114
27 Ga0070713_100003057 3300005436 Bacteria 10992
28 Ga0070713_100037829 3300005436 Bacteria 3904
29 Ga0070713_100081084 3300005436 Bacteria 2768
30 Ga0070701_10225950 3300005438 Bacteria 1119
31 Ga0070711_100451871 3300005439 Bacteria 1052
32 Ga0070700_100623670 3300005441 Bacteria 848
33 Ga0070708_100028033 3300005445 Bacteria 4841
34 Ga0070663_100024184 3300005455 Bacteria 4084
35 Ga0070663_100033632 3300005455 Bacteria 3543
36 Ga0070663_100047835 3300005455 Bacteria 3030
37 Ga0070678_100079947 3300005456 Bacteria 2474
38 Ga0070662_100200667 3300005457 Bacteria 1582
39 Ga0070681_10389044 3300005458 Bacteria 1305
40 Ga0070707_100077426 3300005468 Bacteria 3209
41 Ga0070679_100156307 3300005530 Bacteria 2255
42 Ga0070684_100007277 3300005535 Bacteria 8604
43 Ga0070684_100525342 3300005535 Bacteria 1097
44 Ga0068853_100037144 3300005539 Bacteria 4143
45 Ga0070672_101439755 3300005543 Bacteria 617
46 Ga0070693_100341469 3300005547 Bacteria 1022
47 Ga0070665_100060902 3300005548 Bacteria 3784
48 Ga0070665_100304531 3300005548 Bacteria 1597
49 Ga0068855_100180697 3300005563 Bacteria 2385
50 Ga0068855_100264917 3300005563 Bacteria 1913
51 Ga0070664_100091093 3300005564 Bacteria 2639
52 Ga0070664_100250261 3300005564 Bacteria 1593
53 Ga0068857_100045554 3300005577 Bacteria 3892
54 Ga0068857_100345171 3300005577 Bacteria 1378
55 Ga0070702_100545197 3300005615 Bacteria 860
56 Ga0068852_100156398 3300005616 Bacteria 2124
57 Ga0068859_101144463 3300005617 Bacteria 856
58 Ga0068866_10409805 3300005718 Bacteria 876
59 Ga0068861_100160916 3300005719 Bacteria 1852
60 Ga0068861_100428963 3300005719 Bacteria 1179
61 Ga0068851_10021571 3300005834 Bacteria 3128
62 Ga0068870_10153454 3300005840 Bacteria 1359
63 Ga0068870_10558914 3300005840 Bacteria 772
64 Ga0068858_101037671 3300005842 Bacteria 804
65 Ga0068860_100002033 3300005843 Bacteria 21319
66 Ga0068860_100123326 3300005843 Bacteria 2482
67 Ga0068862_100187290 3300005844 Bacteria 1860
68 Ga0068862_100558638 3300005844 Bacteria 1094
69 Ga0068862_100921744 3300005844 Bacteria 860
70 Ga0081455_10041853 3300005937 Bacteria 4024
71 Ga0081455_10169311 3300005937 Bacteria 1666
72 Ga0081455_10199858 3300005937 Bacteria 1497
73 Ga0081538_10027777 3300005981 Bacteria 3911
74 Ga0081540_1004925 3300005983 Bacteria 10053
75 Ga0081540_1005189 3300005983 Bacteria 9753
76 Ga0081540_1006578 3300005983 Bacteria 8435
77 Ga0081540_1007118 3300005983 Bacteria 8028
78 Ga0081540_1007996 3300005983 Bacteria 7445
79 Ga0081540_1010046 3300005983 Bacteria 6443
80 Ga0081540_1023549 3300005983 Bacteria 3598
81 Ga0081540_1025241 3300005983 Bacteria 3426
82 Ga0081540_1059709 3300005983 Bacteria 1829
83 Ga0081540_1095976 3300005983 Bacteria 1290
84 Ga0081540_1146708 3300005983 Bacteria 938
85 Ga0081539_10000099 3300005985 Bacteria 201018
86 Ga0081539_10000958 3300005985 Bacteria 54105
87 Ga0081539_10187788 3300005985 Bacteria 964
88 Ga0070717_10027022 3300006028 Bacteria 4584
89 Ga0070717_10046146 3300006028 Bacteria 3564
90 Ga0070717_10056974 3300006028 Bacteria 3230
91 Ga0070717_10396860 3300006028 Bacteria 1239
92 Ga0075365_10007229 3300006038 Bacteria 6203
93 Ga0075365_10126332 3300006038 Bacteria 1767
94 Ga0075363_100001648 3300006048 Bacteria 8629
95 Ga0075363_100162581 3300006048 Bacteria 1265
96 Ga0075363_100275418 3300006048 Bacteria 973
97 Ga0075364_10163616 3300006051 Bacteria 1502
98 Ga0070715_10589746 3300006163 Bacteria 650
99 Ga0070716_100220590 3300006173 Bacteria 1274
100 Ga0070716_101419139 3300006173 Bacteria 565
101 Ga0070712_100396877 3300006175 Bacteria 1138
102 Ga0075362_10014625 3300006177 Bacteria 3171
103 Ga0075367_10096064 3300006178 Bacteria 1807
104 Ga0075369_10018911 3300006186 Bacteria 2809
105 Ga0075366_10030598 3300006195 Bacteria 3165
106 Ga0075366_10104330 3300006195 Bacteria 1703
107 Ga0097621_100164293 3300006237 Bacteria 1910
108 Ga0075370_10016446 3300006353 Bacteria 3980
109 Ga0075370_10256118 3300006353 Bacteria 1037
110 Ga0068871_100513251 3300006358 Bacteria 1082
111 Ga0075428_100038566 3300006844 Bacteria 5258
112 Ga0075428_100929862 3300006844 Bacteria 922
113 Ga0075431_100306072 3300006847 Bacteria 1605
114 Ga0068865_100042172 3300006881 Bacteria 3110
115 Ga0068865_100749272 3300006881 Bacteria 839
116 Ga0097620_101144406 3300006931 Bacteria 856
117 Ga0099794_10030844 3300007265 Bacteria 2505
118 Ga0099794_10220753 3300007265 Bacteria 974
119 Ga0099795_10048516 3300007788 Bacteria 1538
120 Ga0099795_10062047 3300007788 Bacteria 1390
121 Ga0099795_10402272 3300007788 Bacteria 622
122 Ga0105240_10051599 3300009093 Bacteria 5173
123 Ga0111539_10038005 3300009094 Bacteria 5807
124 Ga0105247_10143533 3300009101 Bacteria 1567
125 Ga0105247_10166758 3300009101 Bacteria 1462
126 Ga0105247_10316861 3300009101 Bacteria 1087
127 Ga0114129_10082314 3300009147 Bacteria 4473
128 Ga0105243_10188428 3300009148 Bacteria 1800
129 Ga0105241_10788245 3300009174 Bacteria 874
130 Ga0105242_10871336 3300009176 Bacteria 898
131 Ga0105237_10068461 3300009545 Bacteria 3543
132 Ga0105237_10099382 3300009545 Bacteria 2901
133 Ga0105237_10541286 3300009545 Bacteria 1171
134 Ga0105238_10003421 3300009551 Bacteria 15825
135 Ga0105249_10876630 3300009553 Bacteria 964
136 Ga0099796_10017646 3300010159 Bacteria 2129
137 Ga0105239_10187074 3300010375 Bacteria 2318
138 Ga0105239_11627656 3300010375 Bacteria 747
139 Ga0105246_10119046 3300011119 Bacteria 1953
140 Ga0105246_10178701 3300011119 Bacteria 1632
141 Ga0157370_10354611 3300013104 Bacteria 1352
142 Ga0157369_10088956 3300013105 Bacteria 3297
143 Ga0157374_10003262 3300013296 Bacteria 13625
144 Ga0157378_10998736 3300013297 Bacteria 871
145 Ga0163162_10474057 3300013306 Bacteria 1383
146 Ga0157375_10010326 3300013308 Bacteria 8218
147 Ga0163163_10187237 3300014325 Bacteria 2117
148 Ga0163163_10255846 3300014325 Bacteria 1802
149 Ga0163163_10758024 3300014325 Bacteria 1034
150 Ga0157380_10484004 3300014326 Bacteria 1198
151 Ga0157379_10662444 3300014968 Bacteria 978
152 Ga0157379_11749551 3300014968 Bacteria 610
153 Ga0157376_10231318 3300014969 Bacteria 1717
154 Ga0163161_10509481 3300017792 Bacteria 981
155 Ga0206353_10223217 3300020082 Bacteria 860
156 Ga0207656_10021899 3300025321 Bacteria 2559
157 Ga0207642_10338650 3300025899 Bacteria 884
158 Ga0207710_10126005 3300025900 Bacteria 1227
159 Ga0207710_10203897 3300025900 Bacteria 978
160 Ga0207688_10139393 3300025901 Bacteria 1427
161 Ga0207688_10175434 3300025901 Bacteria 1276
162 Ga0207699_10666406 3300025906 Bacteria 760
163 Ga0207705_10100727 3300025909 Bacteria 2125
164 Ga0207684_10211152 3300025910 Bacteria 1674
165 Ga0207654_10499953 3300025911 Bacteria 858
166 Ga0207707_10068358 3300025912 Bacteria 3095
167 Ga0207695_10027771 3300025913 Bacteria 6295
168 Ga0207671_10074564 3300025914 Bacteria 2536
169 Ga0207671_10129652 3300025914 Bacteria 1935
170 Ga0207671_11339085 3300025914 Bacteria 557
171 Ga0207693_10077989 3300025915 Bacteria 2593
172 Ga0207693_10109580 3300025915 Bacteria 2165
173 Ga0207663_10301334 3300025916 Bacteria 1198
174 Ga0207663_11181291 3300025916 Bacteria 616
175 Ga0207660_10035623 3300025917 Bacteria 3456
176 Ga0207657_10019736 3300025919 Bacteria 6390
177 Ga0207649_10370132 3300025920 Bacteria 1065
178 Ga0207652_10132093 3300025921 Bacteria 2227
179 Ga0207646_10068240 3300025922 Bacteria 3176
180 Ga0207681_10550753 3300025923 Bacteria 949
181 Ga0207694_10016147 3300025924 Bacteria 5635
182 Ga0207694_10278348 3300025924 Bacteria 1374
183 Ga0207650_10126864 3300025925 Bacteria 1993
184 Ga0207659_10385487 3300025926 Bacteria 1169
185 Ga0207700_10018806 3300025928 Bacteria 4653
186 Ga0207700_10335327 3300025928 Bacteria 1314
187 Ga0207700_11022247 3300025928 Bacteria 739
188 Ga0207664_10063782 3300025929 Bacteria 2945
189 Ga0207644_10659813 3300025931 Bacteria 871
190 Ga0207706_10270943 3300025933 Bacteria 1482
191 Ga0207709_10718363 3300025935 Bacteria 801
192 Ga0207669_10323814 3300025937 Bacteria 1181
193 Ga0207704_10108973 3300025938 Bacteria 1867
194 Ga0207665_10190070 3300025939 Bacteria 1491
195 Ga0207691_10146479 3300025940 Bacteria 2079
196 Ga0207689_10161686 3300025942 Bacteria 1845
197 Ga0207689_10163334 3300025942 Bacteria 1835
198 Ga0207689_10653048 3300025942 Bacteria 886
199 Ga0207689_10886862 3300025942 Bacteria 753
200 Ga0207661_10056483 3300025944 Bacteria 3151
201 Ga0207661_10129894 3300025944 Bacteria 2156
202 Ga0207679_10456881 3300025945 Bacteria 1133
203 Ga0207667_10048149 3300025949 Bacteria 4508
204 Ga0207667_10231160 3300025949 Bacteria 1894
205 Ga0207651_10559773 3300025960 Bacteria 995
206 Ga0207712_10865842 3300025961 Bacteria 797
207 Ga0207668_10234778 3300025972 Bacteria 1480
208 Ga0207677_10194657 3300026023 Bacteria 1606
209 Ga0207677_10544845 3300026023 Bacteria 1010
210 Ga0207639_10016989 3300026041 Bacteria 5156
211 Ga0207639_10245412 3300026041 Bacteria 1559
212 Ga0207639_10766765 3300026041 Bacteria 898
213 Ga0207678_10033631 3300026067 Bacteria 4465
214 Ga0207678_10044651 3300026067 Bacteria 3832
215 Ga0207678_10387636 3300026067 Bacteria 1208
216 Ga0207708_10260554 3300026075 Bacteria 1400
217 Ga0207702_10306716 3300026078 Bacteria 1508
218 Ga0207641_10155437 3300026088 Bacteria 2075
219 Ga0207674_10048335 3300026116 Bacteria 4355
220 Ga0207675_100567836 3300026118 Bacteria 1135
221 Ga0207683_10166792 3300026121 Bacteria 1993
222 Ga0207698_10142966 3300026142 Bacteria 2064
223 Ga0207698_10833761 3300026142 Bacteria 926
224 Ga0207428_10304488 3300027907 Bacteria 1179
225 Ga0207428_10974484 3300027907 Bacteria 597
226 Ga0268266_10017163 3300028379 Bacteria 6180
227 Ga0268266_10066514 3300028379 Bacteria 3117
228 Ga0268266_10449581 3300028379 Bacteria 1225
229 Ga0268266_10970420 3300028379 Bacteria 822
230 Ga0268265_10167295 3300028380 Bacteria 1875
231 Ga0268265_10588761 3300028380 Bacteria 1061
232 Ga0268265_10938801 3300028380 Bacteria 851
233 Ga0268264_10000174 3300028381 Bacteria 137254
234 Ga0307517_10109684 3300028786 Bacteria 2109
235 Ga0307515_10058848 3300028794 Bacteria 5523
236 Ga0307515_10232454 3300028794 Bacteria 1633
237 Ga0265330_10015054 3300031235 Bacteria 3582
238 Ga0265339_10131905 3300031249 Bacteria 1277
239 Ga0265331_10183586 3300031250 Bacteria 944
240 Ga0307509_10033214 3300031507 Bacteria 5679
241 Ga0307509_10054753 3300031507 Bacteria 4244
242 Ga0307509_10246441 3300031507 Bacteria 1574
243 Ga0307509_10388608 3300031507 Bacteria 1106
244 Ga0307408_100154718 3300031548 Bacteria 1814
245 Ga0307508_10377283 3300031616 Bacteria 1009
246 Ga0265314_10021935 3300031711 Bacteria 4899
247 Ga0307516_10018150 3300031730 Bacteria 7316
248 Ga0307516_10037411 3300031730 Bacteria 4852
249 Ga0307516_10108870 3300031730 Bacteria 2577
250 Ga0307516_10528533 3300031730 Bacteria 833
251 Ga0307405_10296631 3300031731 Bacteria 1224
252 Ga0307405_10581433 3300031731 Bacteria 911
253 Ga0307410_10731366 3300031852 Bacteria 836
254 Ga0307406_10733296 3300031901 Bacteria 828
255 Ga0307407_10445436 3300031903 Bacteria 939
256 Ga0307412_10068013 3300031911 Bacteria 2421
257 Ga0307409_100372868 3300031995 Bacteria 1354
258 Ga0307409_101210781 3300031995 Bacteria 779
259 Ga0307416_101033436 3300032002 Bacteria 925
260 Ga0307416_101073888 3300032002 Bacteria 909
261 Ga0307415_100053983 3300032126 Bacteria 2741
262 Ga0307415_101410016 3300032126 Bacteria 663
263 Ga0307507_10049804 3300033179 Bacteria 4053
264 Ga0307510_10086316 3300033180 Bacteria 3011
265 Ga0307510_10270436 3300033180 Bacteria 1176
266 Ga0316215_1007466 3300033544 Bacteria 1066
267 Ga0373926_0068721 3300035083 Bacteria 1299
268 Ga0373923_0001005 3300035111 Bacteria 7635
269 Ga0373932_0160158 3300035112 Bacteria 778
270 Ga0373936_0005640 3300035113 Bacteria 4721
271 Ga0373936_0068426 3300035113 Bacteria 1460
272 Ga0373936_0312860 3300035113 Bacteria 710
273 Ga0373945_0009712 3300035116 Bacteria 3157
274 Ga0373945_0108378 3300035116 Bacteria 1094
275 Ga0373953_0232134 3300035117 Bacteria 800
276 Ga0373954_0036286 3300035118 Bacteria 2288
277 Ga0373954_0141149 3300035118 Bacteria 1175
278 Ga0373956_0149981 3300035119 Bacteria 1097
279 Ga0373957_0062881 3300035120 Bacteria 1441
280 Ga0373943_0091207 3300035170 Bacteria 1578
281 Ga0373943_0859867 3300035170 Bacteria 541
282 Ga0373946_0003827 3300035171 Bacteria 5344
283 Ga0373955_0091790 3300035172 Bacteria 1732
284 Ga0373942_0356437 3300035207 Bacteria 518
285 Ga0373924_0025712 3300035410 Bacteria 2328
286 Ga0373935_0009027 3300035692 Bacteria 5964
287 Ga0373935_0011338 3300035692 Bacteria 5352
288 Ga0373927_0002111 3300035695 Bacteria 14657
289 Ga0373927_0022121 3300035695 Bacteria 4166
290 Ga0373927_0029370 3300035695 Bacteria 3583
291 Ga0373927_0143589 3300035695 Bacteria 1562
292 Ga0373927_0197748 3300035695 Bacteria 1319
293 Ga0373927_0372170 3300035695 Bacteria 942
294 Ga0373933_0000204 3300035724 Bacteria 39417
295 Ga0373933_0091983 3300035724 Bacteria 1873
296 Ga0373933_0097261 3300035724 Bacteria 1823
297 Ga0373933_0267888 3300035724 Bacteria 1102
298 Ga0373947_0000455 3300035725 Bacteria 23308
299 Ga0373947_0021658 3300035725 Bacteria 3722
300 Ga0373937_0009140 3300036401 Bacteria 8599
301 Ga0373937_0816622 3300036401 Bacteria 880
302 Ga0373925_0006046 3300037068 Bacteria 8955
303 Ga0373925_0061969 3300037068 Bacteria 2811
304 Ga0373925_0062303 3300037068 Bacteria 2804
305 Ga0373925_0308479 3300037068 Bacteria 1279
306 Ga0373925_0532332 3300037068 Bacteria 966
307 Ga0373925_1612665 3300037068 Bacteria 530
308 Ga0395900_0040946 3300037418 Bacteria 4776
309 Ga0395898_0218826 3300037466 Bacteria 1817
310 Ga0395905_0456442 3300037471 Bacteria 1176
311 Ga0395901_0854950 3300038443 Bacteria 895
312 Ga0436365_0491659 3300039437 Bacteria 597
313 Ga0439465_0242330 3300041413 Bacteria 665
314 Ga0451807_0225501 3300041486 Bacteria 1229
315 Ga0451807_0338103 3300041486 Bacteria 1091
316 Ga0451853_2368002 3300041512 Bacteria 853
317 Ga0439463_100772 3300042016 Bacteria 745
318 Ga0466967_0272119 3300045976 Bacteria 1623
319 Ga0495617_062874 3300046452 Bacteria 1226
320 Ga0495592_0017062 3300046454 Bacteria 5512
321 Ga0495603_0000239 3300046455 Bacteria 28578
322 Ga0495603_0018767 3300046455 Bacteria 4186
323 Ga0495603_0045839 3300046455 Bacteria 2606
324 Ga0495603_0153436 3300046455 Bacteria 1337
325 Ga0495590_0093317 3300046457 Bacteria 1066
326 Ga0495629_0000457 3300046459 Bacteria 34088
327 Ga0495629_0171850 3300046459 Bacteria 1504
328 Ga0495641_0020432 3300046461 Bacteria 3357
329 Ga0495650_0143767 3300046471 Bacteria 861
330 Ga0495580_0004703 3300046472 Bacteria 11445
331 Ga0495580_0262363 3300046472 Bacteria 1181
332 Ga0495580_0674429 3300046472 Bacteria 678
333 Ga0495582_0000077 3300046473 Bacteria 49112
334 Ga0495582_0809002 3300046473 Bacteria 542
335 Ga0495605_0075720 3300046474 Bacteria 1582
336 Ga0495639_0000101 3300046475 Bacteria 42348
337 Ga0495639_0021701 3300046475 Bacteria 2812
338 Ga0495639_0091375 3300046475 Bacteria 1429
339 Ga0495662_0005082 3300046476 Bacteria 6588
340 Ga0495664_0015872 3300046477 Bacteria 4285
341 Ga0495664_0157903 3300046477 Bacteria 1376
342 Ga0495584_0073166 3300046491 Bacteria 1722
343 Ga0495585_0023646 3300046492 Bacteria 3526
344 Ga0495585_0055260 3300046492 Bacteria 2194
345 Ga0495594_0000083 3300046499 Bacteria 42703
346 Ga0495594_0084465 3300046499 Bacteria 1775
347 Ga0495594_0152914 3300046499 Bacteria 1310
348 Ga0495610_0125463 3300046512 Bacteria 1120
349 Ga0495618_0045153 3300046514 Bacteria 2779
350 Ga0495620_0048675 3300046515 Bacteria 1818
351 Ga0495620_0190861 3300046515 Bacteria 790
352 Ga0495628_0044550 3300046516 Bacteria 3529
353 Ga0495630_0006606 3300046517 Bacteria 8266
354 Ga0495631_0074457 3300046518 Bacteria 1466
355 Ga0495632_0116169 3300046519 Bacteria 1253
356 Ga0495644_0095794 3300046523 Bacteria 1121
357 Ga0495648_0115370 3300046524 Bacteria 1453
358 Ga0495663_0025555 3300046525 Bacteria 1723
359 Ga0495666_0018992 3300046526 Bacteria 3415
360 Ga0495666_0392089 3300046526 Bacteria 624
361 Ga0495652_0061261 3300046529 Bacteria 3177
362 Ga0495652_0373547 3300046529 Bacteria 1016
363 Ga0495665_0000055 3300046531 Bacteria 45208
364 Ga0495640_0004679 3300046533 Bacteria 10908
365 Ga0495587_0395003 3300046536 Bacteria 769
366 Ga0495598_0003351 3300046537 Bacteria 3395
367 Ga0495609_0068296 3300046538 Bacteria 1564
368 Ga0495621_0086390 3300046539 Bacteria 1176
369 Ga0495622_0010443 3300046557 Bacteria 4289
370 Ga0495622_0018137 3300046557 Bacteria 3278
371 Ga0495622_0029937 3300046557 Bacteria 2543
372 Ga0495633_0026405 3300046558 Bacteria 2850
373 Ga0495633_0062300 3300046558 Bacteria 1746
374 Ga0495667_0035425 3300046559 Bacteria 3335
375 Ga0495656_0009295 3300046615 Bacteria 3530
376 Ga0495668_0502244 3300046616 Bacteria 668
377 Ga0495668_0529680 3300046616 Bacteria 650
378 Ga0495634_0000720 3300046642 Bacteria 32017
379 Ga0495611_0116825 3300046648 Bacteria 1243
380 Ga0495611_0214803 3300046648 Bacteria 895
381 Ga0495659_0003552 3300046664 Bacteria 4964
382 Ga0495661_0314932 3300046665 Bacteria 779
383 Ga0495588_0044612 3300046674 Bacteria 2271
384 Ga0495599_0189657 3300046678 Bacteria 1265
385 Ga0495599_0241566 3300046678 Bacteria 1101
386 Ga0495599_0289369 3300046678 Bacteria 991
387 Ga0495647_0002199 3300046681 Bacteria 6101
388 Ga0495647_0246610 3300046681 Bacteria 794
389 Ga0495647_0379067 3300046681 Bacteria 647
390 Ga0495658_0001572 3300046683 Bacteria 11910
391 Ga0495669_0017869 3300046684 Bacteria 3045
392 Ga0495669_0039887 3300046684 Bacteria 2080
393 Ga0495613_0071234 3300046689 Bacteria 2534
394 Ga0495613_0197950 3300046689 Bacteria 1418
395 Ga0495624_0000235 3300046690 Bacteria 43165
396 Ga0495624_0096417 3300046690 Bacteria 1822
397 Ga0495624_0422170 3300046690 Bacteria 800
398 Ga0495624_0638091 3300046690 Bacteria 634
399 Ga0495670_0023358 3300046691 Bacteria 3052
400 Ga0495671_0140162 3300046692 Bacteria 1178
401 Ga0495589_0033741 3300046794 Bacteria 2570
402 Ga0495589_0057944 3300046794 Bacteria 1905
403 Ga0495589_0257478 3300046794 Bacteria 814
404 Ga0495581_0000041 3300047315 Bacteria 46518
405 Ga0495581_0129804 3300047315 Bacteria 1468
406 Ga0495604_0126512 3300047317 Bacteria 1842
407 Ga0495636_0019171 3300047318 Bacteria 2748
408 Ga0495674_0010515 3300047319 Bacteria 8758
409 Ga0495672_0124212 3300047320 Bacteria 1367
410 Ga0495676_0065180 3300047321 Bacteria 2829
411 Ga0495676_0190576 3300047321 Bacteria 1430
412 Ga0495683_0168500 3300047323 Bacteria 1008
413 Ga0495673_0156441 3300047469 Bacteria 878
414 Ga0495681_0077087 3300047470 Bacteria 1497
415 Ga0495686_0259206 3300047472 Bacteria 974
416 Ga0495593_0000024 3300047673 Bacteria 65718
417 Ga0495593_0050903 3300047673 Bacteria 2193
418 Ga0495602_0823542 3300048088 Bacteria 622
419 Ga0495614_0016102 3300048089 Bacteria 3256
420 Ga0495614_0109063 3300048089 Bacteria 1215
421 Ga0495615_0017613 3300048090 Bacteria 1559
422 Ga0496100_0187083 3300048903 Bacteria 1501
423 Ga0496100_0445730 3300048903 Bacteria 992
424 Ga0496100_0795480 3300048903 Bacteria 741
425 Ga0496100_1185657 3300048903 Unclassified 602
426 Ga0496101_0497424 3300048904 Bacteria 963
427 Ga0496102_0026012 3300048905 Bacteria 5216
428 Ga0496102_0113788 3300048905 Bacteria 2525
429 Ga0496102_0250087 3300048905 Bacteria 1671
430 Ga0496104_0076966 3300048907 Bacteria 3178
431 Ga0496104_0150899 3300048907 Bacteria 2231
432 Ga0496104_0569055 3300048907 Bacteria 1044
433 Ga0496105_0009039 3300048908 Bacteria 7775
434 Ga0496105_0339354 3300048908 Bacteria 1202
435 Ga0496106_0023071 3300048909 Bacteria 4621
436 Ga0496106_0241443 3300048909 Bacteria 1443
437 Ga0496106_0290044 3300048909 Bacteria 1312
438 Ga0496106_0771917 3300048909 Bacteria 763
439 Ga0496107_0027545 3300048910 Bacteria 4035
440 Ga0496107_0635637 3300048910 Bacteria 787
441 Ga0496108_0034796 3300048911 Bacteria 4185
442 Ga0496108_0106238 3300048911 Bacteria 2397
443 Ga0496108_0430585 3300048911 Bacteria 1152
444 Ga0496108_0621026 3300048911 Bacteria 941
445 Ga0496108_1247592 3300048911 Bacteria 627
446 Ga0496109_0016491 3300048912 Bacteria 6459
447 Ga0496109_0422391 3300048912 Bacteria 1259
448 Ga0496110_0373937 3300048913 Bacteria 1298
449 Ga0496111_0262646 3300048914 Bacteria 1281
450 Ga0496112_0000052 3300048915 Bacteria 81285
451 Ga0496112_0639021 3300048915 Bacteria 994
452 Ga0496113_0169528 3300048916 Bacteria 1728
453 Ga0496113_0280496 3300048916 Bacteria 1332
454 Ga0496114_0029109 3300048917 Bacteria 4537
455 Ga0496115_0001250 3300048918 Bacteria 18240
456 Ga0496115_0010371 3300048918 Bacteria 6960
457 Ga0496115_0108504 3300048918 Bacteria 2279
458 Ga0496115_0122217 3300048918 Bacteria 2143
459 Ga0496115_0370520 3300048918 Bacteria 1166
460 Ga0496115_0442070 3300048918 Bacteria 1051
461 Ga0496117_0034870 3300048920 Bacteria 3785
462 Ga0496117_0074589 3300048920 Bacteria 2258
463 Ga0496119_0069983 3300048922 Bacteria 2060
464 Ga0496119_0166153 3300048922 Bacteria 1169
465 Ga0496121_0156082 3300048924 Bacteria 1674
466 Ga0496121_0202787 3300048924 Bacteria 1412
467 Ga0496121_0386338 3300048924 Bacteria 921
468 Ga0496124_0032735 3300048927 Bacteria 4585
469 Ga0496124_0033691 3300048927 Bacteria 4504
470 Ga0496124_0318759 3300048927 Bacteria 1114
471 Ga0496124_0700023 3300048927 Bacteria 642
472 Ga0496125_0037791 3300048928 Bacteria 4193
473 Ga0496125_0057242 3300048928 Bacteria 3159
474 Ga0496126_0023278 3300048929 Bacteria 6003
475 Ga0496126_0041612 3300048929 Bacteria 4250
476 Ga0496126_0086705 3300048929 Bacteria 2759
477 Ga0496126_0429162 3300048929 Bacteria 1067
478 Ga0496126_0462085 3300048929 Bacteria 1020
479 Ga0495682_0305872 3300049460 Bacteria 561
480 Ga0501043_0294052 3300049579 Bacteria 1243
481 Ga0501046_0062929 3300049580 Bacteria 2898
482 Ga0501073_0088200 3300049589 Bacteria 2157
483 Ga0501080_0002767 3300049742 Bacteria 15405
484 nmdc:mga03683_15974_c1 3300050489 Bacteria 2811
485 nmdc:mga03n38_509397_c1 3300050490 Bacteria 676
486 nmdc:mga03n38_80691_c1 3300050490 Bacteria 1528
487 nmdc:mga0yw44_13517_c1 3300050492 Bacteria 4303
488 nmdc:mga0yw44_448064_c1 3300050492 Bacteria 875
489 nmdc:mga0yw44_8041_c1 3300050492 Bacteria 5230
490 nmdc:mga0k408_181156_c1 3300050493 Bacteria 1256
491 nmdc:mga0k408_19643_c1 3300050493 Bacteria 3779
492 nmdc:mga06z11_23773_c1 3300050494 Bacteria 2883
493 nmdc:mga06z11_714_c1 3300050494 Bacteria 12097
494 nmdc:mga07m45_87405_c1 3300050496 Bacteria 1784
495 nmdc:mga06r32_290638_c1 3300050510 Bacteria 1621
496 nmdc:mga08y16_217538_c1 3300050511 Bacteria 1978
497 nmdc:mga08y16_458558_c1 3300050511 Bacteria 1299
498 nmdc:mga0sz30_52446_c1 3300050516 Bacteria 1732
499 Ga0500635_0015107 3300053080 Bacteria 2275
500 Ga0500635_0054150 3300053080 Bacteria 1382
501 Ga0495655_0100808 3300053083 Bacteria 855
502 Ga0495655_0162813 3300053083 Bacteria 709
503 Ga0495595_0434662 3300053084 Bacteria 666
504 Ga0495619_1020670 3300053085 Bacteria 553
505 Ga0500566_0033945 3300053094 Bacteria 2971
506 Ga0500648_069142 3300053097 Bacteria 1997
507 Ga0500554_027528 3300053102 Bacteria 1644
508 Ga0500595_012337 3300053119 Bacteria 3309
509 Ga0500595_014911 3300053119 Bacteria 2935
510 Ga0500608_185794 3300053122 Bacteria 875
511 Ga0500559_0022876 3300053136 Bacteria 2651
512 Ga0500559_0103898 3300053136 Bacteria 1311
513 Ga0500573_0016018 3300053140 Bacteria 4252
514 Ga0500590_063938 3300053148 Bacteria 1844
515 Ga0500603_000944 3300053150 Bacteria 6868
516 Ga0500603_023928 3300053150 Bacteria 1524
517 Ga0500638_000318 3300053162 Bacteria 10918
518 Ga0500638_170520 3300053162 Bacteria 948
519 Ga0500636_0094769 3300053177 Bacteria 1704
520 Ga0500636_0154228 3300053177 Bacteria 1258
521 Ga0500637_0000138 3300053178 Bacteria 26740
522 Ga0500637_0009480 3300053178 Bacteria 4957
523 Ga0500596_010312 3300053735 Bacteria 1445
524 Ga0500601_012910 3300053737 Bacteria 944
525 Ga0500661_001825 3300055283 Bacteria 4019
526 2723842819 2721755755 Bacteria 8322773
527 2793080280
528 2885392001 2885383462 Bacteria 9473874
529 8056675113 8056673599 Bacteria 7871253
530 8056684624 8056681323 Bacteria 8472857
531 Ga0207693_10634828
532 JGI25406J46586_10003448
533 JGI25404J52841_10005083
534 JGI25404J52841_10015370
535 Ga0070683_100036236
536 Ga0070683_100102126
537 Ga0068869_100189496
538 Ga0068869_100871786
539 Ga0068869_101256501
540 Ga0070680_100145084
541 Ga0070682_100131477
542 Ga0068868_100067221
543 Ga0068868_100565444
544 Ga0068868_100611445
545 Ga0070660_100017102
546 Ga0070691_10018438
547 Ga0070661_100185979
548 Ga0070668_100301243
549 Ga0070668_101552849
550 Ga0070669_100088867
551 Ga0070671_100401534
552 Ga0070674_100698912
553 Ga0070709_10381656
554 Ga0070709_10751148
555 Ga0070714_100075438
556 Ga0070714_100147968
557 Ga0070713_100003057
558 Ga0070713_100037829
559 Ga0070713_100081084
560 Ga0070701_10225950
561 Ga0070711_100451871
562 Ga0070700_100623670
563 Ga0070708_100028033
564 Ga0070663_100024184
565 Ga0070663_100033632
566 Ga0070663_100047835
567 Ga0070678_100079947
568 Ga0070662_100200667
569 Ga0070681_10389044
570 Ga0070707_100077426
571 Ga0070679_100156307
572 Ga0070684_100007277
573 Ga0070684_100525342
574 Ga0068853_100037144
575 Ga0070672_101439755
576 Ga0070693_100341469
577 Ga0070665_100060902
578 Ga0070665_100304531
579 Ga0068855_100180697
580 Ga0068855_100264917
581 Ga0070664_100091093
582 Ga0070664_100250261
583 Ga0068857_100045554
584 Ga0068857_100345171
585 Ga0070702_100545197
586 Ga0068852_100156398
587 Ga0068859_101144463
588 Ga0068866_10409805
589 Ga0068861_100160916
590 Ga0068861_100428963
591 Ga0068851_10021571
592 Ga0068870_10153454
593 Ga0068870_10558914
594 Ga0068858_101037671
595 Ga0068860_100002033
596 Ga0068860_100123326
597 Ga0068862_100187290
598 Ga0068862_100558638
599 Ga0068862_100921744
600 Ga0081455_10041853
601 Ga0081455_10169311
602 Ga0081455_10199858
603 Ga0081538_10027777
604 Ga0081540_1004925
605 Ga0081540_1005189
606 Ga0081540_1006578
607 Ga0081540_1007118
608 Ga0081540_1007996
609 Ga0081540_1010046
610 Ga0081540_1023549
611 Ga0081540_1025241
612 Ga0081540_1059709
613 Ga0081540_1095976
614 Ga0081540_1146708
615 Ga0081539_10000099
616 Ga0081539_10000958
617 Ga0081539_10187788
618 Ga0070717_10027022
619 Ga0070717_10046146
620 Ga0070717_10056974
621 Ga0070717_10396860
622 Ga0075365_10007229
623 Ga0075365_10126332
624 Ga0075363_100001648
625 Ga0075363_100162581
626 Ga0075363_100275418
627 Ga0075364_10163616
628 Ga0070715_10589746
629 Ga0070716_100220590
630 Ga0070716_101419139
631 Ga0070712_100396877
632 Ga0075362_10014625
633 Ga0075367_10096064
634 Ga0075369_10018911
635 Ga0075366_10030598
636 Ga0075366_10104330
637 Ga0097621_100164293
638 Ga0075370_10016446
639 Ga0075370_10256118
640 Ga0068871_100513251
641 Ga0075428_100038566
642 Ga0075428_100929862
643 Ga0075431_100306072
644 Ga0068865_100042172
645 Ga0068865_100749272
646 Ga0097620_101144406
647 Ga0099794_10030844
648 Ga0099794_10220753
649 Ga0099795_10048516
650 Ga0099795_10062047
651 Ga0099795_10402272
652 Ga0105240_10051599
653 Ga0111539_10038005
654 Ga0105247_10143533
655 Ga0105247_10166758
656 Ga0105247_10316861
657 Ga0114129_10082314
658 Ga0105243_10188428
659 Ga0105241_10788245
660 Ga0105242_10871336
661 Ga0105237_10068461
662 Ga0105237_10099382
663 Ga0105237_10541286
664 Ga0105238_10003421
665 Ga0105249_10876630
666 Ga0099796_10017646
667 Ga0105239_10187074
668 Ga0105239_11627656
669 Ga0105246_10119046
670 Ga0105246_10178701
671 Ga0157370_10354611
672 Ga0157369_10088956
673 Ga0157374_10003262
674 Ga0157378_10998736
675 Ga0163162_10474057
676 Ga0157375_10010326
677 Ga0163163_10187237
678 Ga0163163_10255846
679 Ga0163163_10758024
680 Ga0157380_10484004
681 Ga0157379_10662444
682 Ga0157379_11749551
683 Ga0157376_10231318
684 Ga0163161_10509481
685 Ga0206353_10223217
686 Ga0207656_10021899
687 Ga0207642_10338650
688 Ga0207710_10126005
689 Ga0207710_10203897
690 Ga0207688_10139393
691 Ga0207688_10175434
692 Ga0207699_10666406
693 Ga0207705_10100727
694 Ga0207684_10211152
695 Ga0207654_10499953
696 Ga0207707_10068358
697 Ga0207695_10027771
698 Ga0207671_10074564
699 Ga0207671_10129652
700 Ga0207671_11339085
701 Ga0207693_10077989
702 Ga0207693_10109580
703 Ga0207663_10301334
704 Ga0207663_11181291
705 Ga0207660_10035623
706 Ga0207657_10019736
707 Ga0207649_10370132
708 Ga0207652_10132093
709 Ga0207646_10068240
710 Ga0207681_10550753
711 Ga0207694_10016147
712 Ga0207694_10278348
713 Ga0207650_10126864
714 Ga0207659_10385487
715 Ga0207700_10018806
716 Ga0207700_10335327
717 Ga0207700_11022247
718 Ga0207664_10063782
719 Ga0207644_10659813
720 Ga0207706_10270943
721 Ga0207709_10718363
722 Ga0207669_10323814
723 Ga0207704_10108973
724 Ga0207665_10190070
725 Ga0207691_10146479
726 Ga0207689_10161686
727 Ga0207689_10163334
728 Ga0207689_10653048
729 Ga0207689_10886862
730 Ga0207661_10056483
731 Ga0207661_10129894
732 Ga0207679_10456881
733 Ga0207667_10048149
734 Ga0207667_10231160
735 Ga0207651_10559773
736 Ga0207712_10865842
737 Ga0207668_10234778
738 Ga0207677_10194657
739 Ga0207677_10544845
740 Ga0207639_10016989
741 Ga0207639_10245412
742 Ga0207639_10766765
743 Ga0207678_10033631
744 Ga0207678_10044651
745 Ga0207678_10387636
746 Ga0207708_10260554
747 Ga0207702_10306716
748 Ga0207641_10155437
749 Ga0207674_10048335
750 Ga0207675_100567836
751 Ga0207683_10166792
752 Ga0207698_10142966
753 Ga0207698_10833761
754 Ga0207428_10304488
755 Ga0207428_10974484
756 Ga0268266_10017163
757 Ga0268266_10066514
758 Ga0268266_10449581
759 Ga0268266_10970420
760 Ga0268265_10167295
761 Ga0268265_10588761
762 Ga0268265_10938801
763 Ga0268264_10000174
764 Ga0307517_10109684
765 Ga0307515_10058848
766 Ga0307515_10232454
767 Ga0265330_10015054
768 Ga0265339_10131905
769 Ga0265331_10183586
770 Ga0307509_10033214
771 Ga0307509_10054753
772 Ga0307509_10246441
773 Ga0307509_10388608
774 Ga0307408_100154718
775 Ga0307508_10377283
776 Ga0265314_10021935
777 Ga0307516_10018150
778 Ga0307516_10037411
779 Ga0307516_10108870
780 Ga0307516_10528533
781 Ga0307405_10296631
782 Ga0307405_10581433
783 Ga0307410_10731366
784 Ga0307406_10733296
785 Ga0307407_10445436
786 Ga0307412_10068013
787 Ga0307409_100372868
788 Ga0307409_101210781
789 Ga0307416_101033436
790 Ga0307416_101073888
791 Ga0307415_100053983
792 Ga0307415_101410016
793 Ga0307507_10049804
794 Ga0307510_10086316
795 Ga0307510_10270436
796 Ga0316215_1007466
797 Ga0373926_0068721
798 Ga0373923_0001005
799 Ga0373932_0160158
800 Ga0373936_0005640
801 Ga0373936_0068426
802 Ga0373936_0312860
803 Ga0373945_0009712
804 Ga0373945_0108378
805 Ga0373953_0232134
806 Ga0373954_0036286
807 Ga0373954_0141149
808 Ga0373956_0149981
809 Ga0373957_0062881
810 Ga0373943_0091207
811 Ga0373943_0859867
812 Ga0373946_0003827
813 Ga0373955_0091790
814 Ga0373942_0356437
815 Ga0373924_0025712
816 Ga0373935_0009027
817 Ga0373935_0011338
818 Ga0373927_0002111
819 Ga0373927_0022121
820 Ga0373927_0029370
821 Ga0373927_0143589
822 Ga0373927_0197748
823 Ga0373927_0372170
824 Ga0373933_0000204
825 Ga0373933_0091983
826 Ga0373933_0097261
827 Ga0373933_0267888
828 Ga0373947_0000455
829 Ga0373947_0021658
830 Ga0373937_0009140
831 Ga0373937_0816622
832 Ga0373925_0006046
833 Ga0373925_0061969
834 Ga0373925_0062303
835 Ga0373925_0308479
836 Ga0373925_0532332
837 Ga0373925_1612665
838 Ga0395900_0040946
839 Ga0395898_0218826
840 Ga0395905_0456442
841 Ga0395901_0854950
842 Ga0436365_0491659
843 Ga0439465_0242330
844 Ga0451807_0225501
845 Ga0451807_0338103
846 Ga0451853_2368002
847 Ga0439463_100772
848 Ga0466967_0272119
849 Ga0495617_062874
850 Ga0495592_0017062
851 Ga0495603_0000239
852 Ga0495603_0018767
853 Ga0495603_0045839
854 Ga0495603_0153436
855 Ga0495590_0093317
856 Ga0495629_0000457
857 Ga0495629_0171850
858 Ga0495641_0020432
859 Ga0495650_0143767
860 Ga0495580_0004703
861 Ga0495580_0262363
862 Ga0495580_0674429
863 Ga0495582_0000077
864 Ga0495582_0809002
865 Ga0495605_0075720
866 Ga0495639_0000101
867 Ga0495639_0021701
868 Ga0495639_0091375
869 Ga0495662_0005082
870 Ga0495664_0015872
871 Ga0495664_0157903
872 Ga0495584_0073166
873 Ga0495585_0023646
874 Ga0495585_0055260
875 Ga0495594_0000083
876 Ga0495594_0084465
877 Ga0495594_0152914
878 Ga0495610_0125463
879 Ga0495618_0045153
880 Ga0495620_0048675
881 Ga0495620_0190861
882 Ga0495628_0044550
883 Ga0495630_0006606
884 Ga0495631_0074457
885 Ga0495632_0116169
886 Ga0495644_0095794
887 Ga0495648_0115370
888 Ga0495663_0025555
889 Ga0495666_0018992
890 Ga0495666_0392089
891 Ga0495652_0061261
892 Ga0495652_0373547
893 Ga0495665_0000055
894 Ga0495640_0004679
895 Ga0495587_0395003
896 Ga0495598_0003351
897 Ga0495609_0068296
898 Ga0495621_0086390
899 Ga0495622_0010443
900 Ga0495622_0018137
901 Ga0495622_0029937
902 Ga0495633_0026405
903 Ga0495633_0062300
904 Ga0495667_0035425
905 Ga0495656_0009295
906 Ga0495668_0502244
907 Ga0495668_0529680
908 Ga0495634_0000720
909 Ga0495611_0116825
910 Ga0495611_0214803
911 Ga0495659_0003552
912 Ga0495661_0314932
913 Ga0495588_0044612
914 Ga0495599_0189657
915 Ga0495599_0241566
916 Ga0495599_0289369
917 Ga0495647_0002199
918 Ga0495647_0246610
919 Ga0495647_0379067
920 Ga0495658_0001572
921 Ga0495669_0017869
922 Ga0495669_0039887
923 Ga0495613_0071234
924 Ga0495613_0197950
925 Ga0495624_0000235
926 Ga0495624_0096417
927 Ga0495624_0422170
928 Ga0495624_0638091
929 Ga0495670_0023358
930 Ga0495671_0140162
931 Ga0495589_0033741
932 Ga0495589_0057944
933 Ga0495589_0257478
934 Ga0495581_0000041
935 Ga0495581_0129804
936 Ga0495604_0126512
937 Ga0495636_0019171
938 Ga0495674_0010515
939 Ga0495672_0124212
940 Ga0495676_0065180
941 Ga0495676_0190576
942 Ga0495683_0168500
943 Ga0495673_0156441
944 Ga0495681_0077087
945 Ga0495686_0259206
946 Ga0495593_0000024
947 Ga0495593_0050903
948 Ga0495602_0823542
949 Ga0495614_0016102
950 Ga0495614_0109063
951 Ga0495615_0017613
952 Ga0496100_0187083
953 Ga0496100_0445730
954 Ga0496100_0795480
955 Ga0496100_1185657
956 Ga0496101_0497424
957 Ga0496102_0026012
958 Ga0496102_0113788
959 Ga0496102_0250087
960 Ga0496104_0076966
961 Ga0496104_0150899
962 Ga0496104_0569055
963 Ga0496105_0009039
964 Ga0496105_0339354
965 Ga0496106_0023071
966 Ga0496106_0241443
967 Ga0496106_0290044
968 Ga0496106_0771917
969 Ga0496107_0027545
970 Ga0496107_0635637
971 Ga0496108_0034796
972 Ga0496108_0106238
973 Ga0496108_0430585
974 Ga0496108_0621026
975 Ga0496108_1247592
976 Ga0496109_0016491
977 Ga0496109_0422391
978 Ga0496110_0373937
979 Ga0496111_0262646
980 Ga0496112_0000052
981 Ga0496112_0639021
982 Ga0496113_0169528
983 Ga0496113_0280496
984 Ga0496114_0029109
985 Ga0496115_0001250
986 Ga0496115_0010371
987 Ga0496115_0108504
988 Ga0496115_0122217
989 Ga0496115_0370520
990 Ga0496115_0442070
991 Ga0496117_0034870
992 Ga0496117_0074589
993 Ga0496119_0069983
994 Ga0496119_0166153
995 Ga0496121_0156082
996 Ga0496121_0202787
997 Ga0496121_0386338
998 Ga0496124_0032735
999 Ga0496124_0033691
1000 Ga0496124_0318759
1001 Ga0496124_0700023
1002 Ga0496125_0037791
1003 Ga0496125_0057242
1004 Ga0496126_0023278
1005 Ga0496126_0041612
1006 Ga0496126_0086705
1007 Ga0496126_0429162
1008 Ga0496126_0462085
1009 Ga0495682_0305872
1010 Ga0501043_0294052
1011 Ga0501046_0062929
1012 Ga0501073_0088200
1013 Ga0501080_0002767
1014 nmdc:mga03683_15974_c1
1015 nmdc:mga03n38_509397_c1
1016 nmdc:mga03n38_80691_c1
1017 nmdc:mga0yw44_13517_c1
1018 nmdc:mga0yw44_448064_c1
1019 nmdc:mga0yw44_8041_c1
1020 nmdc:mga0k408_181156_c1
1021 nmdc:mga0k408_19643_c1
1022 nmdc:mga06z11_23773_c1
1023 nmdc:mga06z11_714_c1
1024 nmdc:mga07m45_87405_c1
1025 nmdc:mga06r32_290638_c1
1026 nmdc:mga08y16_217538_c1
1027 nmdc:mga08y16_458558_c1
1028 nmdc:mga0sz30_52446_c1
1029 Ga0500635_0015107
1030 Ga0500635_0054150
1031 Ga0495655_0100808
1032 Ga0495655_0162813
1033 Ga0495595_0434662
1034 Ga0495619_1020670
1035 Ga0500566_0033945
1036 Ga0500648_069142
1037 Ga0500554_027528
1038 Ga0500595_012337
1039 Ga0500595_014911
1040 Ga0500608_185794
1041 Ga0500559_0022876
1042 Ga0500559_0103898
1043 Ga0500573_0016018
1044 Ga0500590_063938
1045 Ga0500603_000944
1046 Ga0500603_023928
1047 Ga0500638_000318
1048 Ga0500638_170520
1049 Ga0500636_0094769
1050 Ga0500636_0154228
1051 Ga0500637_0000138
1052 Ga0500637_0009480
1053 Ga0500596_010312
1054 Ga0500601_012910
1055 Ga0500661_001825
1056 2723842819
1057 2793080280
1058 2885392001
1059 8056675113
1060 8056684624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

19

144

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

55

143

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z4e-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus halodurans c-125 0.9308 4 154
1z4e-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus halodurans c-125 0.9248 4 154
2dxq-assembly1.cif.gz_B putative acetyltransferase from agrobacterium tumefaciens str. c58 0.8625 5 154
8a9n-assembly1.cif.gz_B structure of dpa polyamine acetyltransferase in complex with 1,3-dap 0.8623 5 146
8a9o-assembly1.cif.gz_B structure of the polyamine acetyltransferase dpa 0.8611 5 146
ID Description Score Start End Superfamily
1z4eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9308 4 154 3.40.630.30
1z4eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9248 4 154 3.40.630.30
af_Q8IP78_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9016 57 144 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8993 4 154 3.40.630.30
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8914 54 140 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4R6UKP1-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9732 4 146 GO:0005840
GO:0016747
AF-A0A6B1NUG2-F1-model_v4 deleted 0.9692 5 149
AF-A0A2G8MDS7-F1-model_v4 deleted 0.966 46 145
AF-A0A4S2TKR2-F1-model_v4 GNAT family N-acetyltransferase 0.9659 5 149 GO:0016747
AF-A0A3S8VRA7-F1-model_v4 GNAT family N-acetyltransferase 0.9649 4 149 GO:0016747

Map