F459929

General Info

Members Datasets Scaffolds Average Seq Length
530 312 1060 205

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10096965|Ga0075368_100969652
Length 244
Sequence MTRRNRHGHGRCLLCHERSFRGSLIGYDCGTRASAPAPHIGYSMDIEIIDRLAIRDLIENWVVWRDAGDWDRFRTVWFDDGRMVATWTQGTADEFIAMSKAGWAKGVSIMHFLGAQSIDLAGTRAVSQTKMTIAQRALVHGVNVDVMLTGRFYDFLEKREGKWGMVLRQPIYEKDRMDPVVPGTPLKLDADLLASFPEGYRHLAYLQSQIGYQIKPDMPGLRGAAVEALYASGKKWLNGEKLDR

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
279 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
283 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
289 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
290 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
291 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
292 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
295 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
296 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
297 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
300 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
301 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
304 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
309 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
310 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
311 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
312 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.19
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.96
Nodule 0
Rhizoplane 6.04
Rhizosphere 74.34
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10096965 3300006042 Bacteria 1209
2 JGI24738J21930_10014140 3300002075 Bacteria 1716
3 JGI25406J46586_10000042 3300003203 Bacteria 56211
4 rootL2_10026502 3300003322 Bacteria 7612
5 Ga0065165_1047738 3300005262 Bacteria 1234
6 Ga0070658_10037841 3300005327 Bacteria 3890
7 Ga0070690_100065970 3300005330 Bacteria 2342
8 Ga0070690_100352141 3300005330 Bacteria 1069
9 Ga0070670_100065535 3300005331 Bacteria 3116
10 Ga0068869_100113227 3300005334 Bacteria 2066
11 Ga0070666_10443361 3300005335 Bacteria 937
12 Ga0070680_100002084 3300005336 Bacteria 14768
13 Ga0070680_100958303 3300005336 Bacteria 739
14 Ga0070682_100001115 3300005337 Bacteria 15366
15 Ga0070682_100028793 3300005337 Bacteria 3343
16 Ga0068868_100010263 3300005338 Bacteria 6771
17 Ga0068868_100437049 3300005338 Bacteria 1136
18 Ga0070660_100098843 3300005339 Bacteria 2310
19 Ga0070689_100032644 3300005340 Bacteria 3961
20 Ga0070691_10006616 3300005341 Bacteria 5306
21 Ga0070687_100227430 3300005343 Bacteria 1146
22 Ga0070661_100041461 3300005344 Bacteria 3359
23 Ga0070661_100321006 3300005344 Bacteria 1210
24 Ga0070692_10013444 3300005345 Bacteria 3815
25 Ga0070692_10160609 3300005345 Bacteria 1287
26 Ga0070668_100142800 3300005347 Bacteria 1931
27 Ga0070669_100062966 3300005353 Bacteria 2729
28 Ga0070669_100076536 3300005353 Unclassified 2484
29 Ga0070675_100060354 3300005354 Bacteria 3131
30 Ga0070671_100160011 3300005355 Bacteria 1903
31 Ga0070674_100019024 3300005356 Bacteria 4356
32 Ga0070674_100411121 3300005356 Bacteria 1108
33 Ga0070673_100350325 3300005364 Bacteria 1310
34 Ga0070688_100004156 3300005365 Bacteria 7511
35 Ga0070659_100084801 3300005366 Bacteria 2533
36 Ga0070659_100225552 3300005366 Bacteria 1547
37 Ga0070667_100655186 3300005367 Bacteria 970
38 Ga0070703_10000891 3300005406 Bacteria 9516
39 Ga0070703_10022775 3300005406 Bacteria 1841
40 Ga0070701_10108938 3300005438 Bacteria 1545
41 Ga0070701_10140398 3300005438 Bacteria 1381
42 Ga0070701_10421068 3300005438 Bacteria 851
43 Ga0070705_100000402 3300005440 Bacteria 24952
44 Ga0070705_100009759 3300005440 Bacteria 4783
45 Ga0070700_100632387 3300005441 Bacteria 843
46 Ga0070694_100076349 3300005444 Bacteria 2319
47 Ga0070694_100124139 3300005444 Bacteria 1856
48 Ga0070708_100682894 3300005445 Bacteria 967
49 Ga0070663_100075432 3300005455 Bacteria 2464
50 Ga0070663_100256210 3300005455 Bacteria 1386
51 Ga0070663_100372088 3300005455 Bacteria 1162
52 Ga0070678_100017777 3300005456 Bacteria 4588
53 Ga0070678_100058342 3300005456 Bacteria 2832
54 Ga0070678_100322268 3300005456 Bacteria 1320
55 Ga0070662_100312020 3300005457 Bacteria 1280
56 Ga0070681_10028269 3300005458 Bacteria 5637
57 Ga0070681_10360364 3300005458 Bacteria 1364
58 Ga0068867_100473238 3300005459 Unclassified 1072
59 Ga0070685_10023152 3300005466 Bacteria 3398
60 Ga0070685_10087333 3300005466 Bacteria 1882
61 Ga0070707_100391264 3300005468 Bacteria 1350
62 Ga0070699_100000330 3300005518 Bacteria 45857
63 Ga0070679_100025790 3300005530 Bacteria 5769
64 Ga0070684_100182011 3300005535 Bacteria 1911
65 Ga0070684_100303366 3300005535 Bacteria 1466
66 Ga0070697_100002472 3300005536 Bacteria 14212
67 Ga0068853_100085795 3300005539 Bacteria 2760
68 Ga0068853_100312247 3300005539 Bacteria 1455
69 Ga0070672_100047939 3300005543 Bacteria 3317
70 Ga0070686_100006183 3300005544 Bacteria 6648
71 Ga0070686_100011232 3300005544 Bacteria 5074
72 Ga0070686_100670703 3300005544 Bacteria 824
73 Ga0070695_100001812 3300005545 Bacteria 12065
74 Ga0070696_100000069 3300005546 Bacteria 49879
75 Ga0070693_100052306 3300005547 Bacteria 2341
76 Ga0070693_100125988 3300005547 Bacteria 1595
77 Ga0070665_100053379 3300005548 Bacteria 4054
78 Ga0070665_100121249 3300005548 Bacteria 2616
79 Ga0070665_100356690 3300005548 Bacteria 1468
80 Ga0070665_101196806 3300005548 Bacteria 771
81 Ga0070704_100000106 3300005549 Bacteria 29134
82 Ga0070704_100209338 3300005549 Bacteria 1579
83 Ga0070704_100462286 3300005549 Bacteria 1095
84 Ga0070704_100585972 3300005549 Bacteria 978
85 Ga0070704_100848728 3300005549 Bacteria 819
86 Ga0070704_101103749 3300005549 Bacteria 721
87 Ga0068855_100035560 3300005563 Bacteria 5933
88 Ga0068855_100060592 3300005563 Bacteria 4425
89 Ga0070664_100054370 3300005564 Bacteria 3396
90 Ga0070664_100068298 3300005564 Bacteria 3038
91 Ga0070664_100439202 3300005564 Bacteria 1197
92 Ga0068857_100058663 3300005577 Bacteria 3418
93 Ga0068857_100115278 3300005577 Bacteria 2417
94 Ga0068854_100062404 3300005578 Bacteria 2702
95 Ga0068854_100119090 3300005578 Bacteria 2002
96 Ga0068856_100407386 3300005614 Bacteria 1379
97 Ga0070702_100019219 3300005615 Bacteria 3558
98 Ga0070702_100034465 3300005615 Bacteria 2790
99 Ga0068852_100068356 3300005616 Bacteria 3109
100 Ga0068852_100500272 3300005616 Bacteria 1210
101 Ga0068859_100065856 3300005617 Bacteria 3657
102 Ga0068859_100805747 3300005617 Unclassified 1027
103 Ga0068859_100931648 3300005617 Bacteria 953
104 Ga0068864_100026809 3300005618 Bacteria 4860
105 Ga0068864_100257872 3300005618 Bacteria 1621
106 Ga0068866_10039212 3300005718 Bacteria 2338
107 Ga0068866_10088334 3300005718 Bacteria 1682
108 Ga0068866_10146268 3300005718 Bacteria 1363
109 Ga0068861_100023412 3300005719 Bacteria 4454
110 Ga0068861_100137688 3300005719 Bacteria 1989
111 Ga0068851_10112842 3300005834 Bacteria 1453
112 Ga0068870_10088252 3300005840 Bacteria 1728
113 Ga0068870_10403824 3300005840 Unclassified 890
114 Ga0068858_100057689 3300005842 Bacteria 3588
115 Ga0068858_100163865 3300005842 Bacteria 2094
116 Ga0068860_100034859 3300005843 Bacteria 4828
117 Ga0068860_100037217 3300005843 Bacteria 4658
118 Ga0068860_100071088 3300005843 Bacteria 3308
119 Ga0068860_100072672 3300005843 Bacteria 3269
120 Ga0068860_100317377 3300005843 Bacteria 1529
121 Ga0068862_100008121 3300005844 Bacteria 8682
122 Ga0068862_100106532 3300005844 Bacteria 2458
123 Ga0068862_100344819 3300005844 Bacteria 1380
124 Ga0081538_10097558 3300005981 Bacteria 1493
125 Ga0081540_1000027 3300005983 Bacteria 151880
126 Ga0081539_10000099 3300005985 Bacteria 201018
127 Ga0075365_10062187 3300006038 Bacteria 2496
128 Ga0075365_10274721 3300006038 Bacteria 1185
129 Ga0075365_10407719 3300006038 Bacteria 959
130 Ga0075368_10002428 3300006042 Bacteria 6077
131 Ga0075368_10030355 3300006042 Bacteria 2093
132 Ga0075368_10041154 3300006042 Bacteria 1815
133 Ga0075368_10171674 3300006042 Bacteria 911
134 Ga0075363_100028298 3300006048 Bacteria 2881
135 Ga0075363_100109927 3300006048 Bacteria 1531
136 Ga0075363_100133317 3300006048 Bacteria 1394
137 Ga0075363_100270295 3300006048 Bacteria 982
138 Ga0075364_10574598 3300006051 Bacteria 770
139 Ga0070715_10139116 3300006163 Bacteria 1177
140 Ga0070712_100037069 3300006175 Bacteria 3321
141 Ga0075362_10014929 3300006177 Bacteria 3148
142 Ga0075367_10001240 3300006178 Bacteria 10744
143 Ga0075367_10268551 3300006178 Bacteria 1071
144 Ga0075369_10026586 3300006186 Bacteria 2413
145 Ga0075366_10342082 3300006195 Bacteria 917
146 Ga0068871_100078972 3300006358 Bacteria 2722
147 Ga0068871_100090812 3300006358 Bacteria 2544
148 Ga0075428_100011753 3300006844 Bacteria 9748
149 Ga0075428_100756679 3300006844 Unclassified 1034
150 Ga0075428_100758142 3300006844 Bacteria 1032
151 Ga0075430_100142832 3300006846 Bacteria 1993
152 Ga0075433_10550907 3300006852 Bacteria 1014
153 Ga0068865_100008922 3300006881 Bacteria 6203
154 Ga0068865_100090793 3300006881 Bacteria 2215
155 Ga0097620_100065856 3300006931 Bacteria 3657
156 Ga0097620_100805752 3300006931 Unclassified 1027
157 Ga0097620_100931614 3300006931 Bacteria 953
158 Ga0105240_10016188 3300009093 Bacteria 10105
159 Ga0111539_10002280 3300009094 Bacteria 25535
160 Ga0111539_10012281 3300009094 Bacteria 10737
161 Ga0111539_10023761 3300009094 Bacteria 7531
162 Ga0111539_10096984 3300009094 Plasmid 3463
163 Ga0111539_10403119 3300009094 Bacteria 1593
164 Ga0105245_10001051 3300009098 Bacteria 24993
165 Ga0105245_10067515 3300009098 Bacteria 3239
166 Ga0105245_10107964 3300009098 Bacteria 2584
167 Ga0105247_10012550 3300009101 Bacteria 5090
168 Ga0105247_10067862 3300009101 Bacteria 2223
169 Ga0105247_10069079 3300009101 Bacteria 2204
170 Ga0114129_10387394 3300009147 Bacteria 1845
171 Ga0114129_10394983 3300009147 Bacteria 1823
172 Ga0105243_10004296 3300009148 Bacteria 11280
173 Ga0105243_10088935 3300009148 Bacteria 2538
174 Ga0105243_10171289 3300009148 Bacteria 1880
175 Ga0105243_10517395 3300009148 Bacteria 1134
176 Ga0105243_10954614 3300009148 Bacteria 857
177 Ga0105241_10160638 3300009174 Bacteria 1847
178 Ga0105241_10207453 3300009174 Bacteria 1640
179 Ga0105241_10287555 3300009174 Bacteria 1406
180 Ga0105242_10001974 3300009176 Bacteria 16136
181 Ga0105242_10365928 3300009176 Bacteria 1336
182 Ga0105248_10021280 3300009177 Bacteria 7187
183 Ga0105248_10028182 3300009177 Bacteria 6255
184 Ga0105248_10298957 3300009177 Bacteria 1813
185 Ga0105237_10002886 3300009545 Bacteria 20856
186 Ga0105237_10124606 3300009545 Bacteria 2571
187 Ga0105238_10033853 3300009551 Bacteria 5199
188 Ga0105238_10328219 3300009551 Bacteria 1516
189 Ga0105249_10006176 3300009553 Bacteria 10393
190 Ga0105249_10381939 3300009553 Unclassified 1435
191 Ga0105249_10455938 3300009553 Bacteria 1318
192 Ga0105249_11138528 3300009553 Bacteria 851
193 Ga0105239_10003063 3300010375 Bacteria 20777
194 Ga0105239_10193324 3300010375 Bacteria 2278
195 Ga0105239_10219468 3300010375 Bacteria 2132
196 Ga0105239_10348692 3300010375 Bacteria 1671
197 Ga0105246_10008728 3300011119 Bacteria 6235
198 Ga0105246_10046725 3300011119 Bacteria 2954
199 Ga0105246_11043791 3300011119 Bacteria 743
200 Ga0157373_10083485 3300013100 Bacteria 2252
201 Ga0157371_10019036 3300013102 Bacteria 5068
202 Ga0157369_10305349 3300013105 Bacteria 1655
203 Ga0157374_10346564 3300013296 Bacteria 1475
204 Ga0157374_10761402 3300013296 Bacteria 983
205 Ga0157378_10211380 3300013297 Bacteria 1840
206 Ga0163162_10293071 3300013306 Bacteria 1759
207 Ga0157372_10338312 3300013307 Bacteria 1753
208 Ga0157375_10096335 3300013308 Bacteria 3031
209 Ga0157375_10377173 3300013308 Bacteria 1585
210 Ga0157375_10434395 3300013308 Bacteria 1479
211 Ga0157375_11438047 3300013308 Unclassified 813
212 Ga0157380_10004424 3300014326 Bacteria 9731
213 Ga0157380_10006251 3300014326 Bacteria 8363
214 Ga0157380_10800740 3300014326 Bacteria 959
215 Ga0157380_11060201 3300014326 Bacteria 847
216 Ga0157377_10033304 3300014745 Bacteria 2812
217 Ga0157377_10287225 3300014745 Bacteria 1081
218 Ga0157377_10428241 3300014745 Bacteria 908
219 Ga0157377_10711014 3300014745 Bacteria 731
220 Ga0157379_10004852 3300014968 Bacteria 11544
221 Ga0157379_10019655 3300014968 Bacteria 5968
222 Ga0157379_10446857 3300014968 Bacteria 1193
223 Ga0157379_10795150 3300014968 Bacteria 893
224 Ga0157376_10004922 3300014969 Bacteria 9311
225 Ga0157376_10116272 3300014969 Bacteria 2363
226 Ga0157376_10172676 3300014969 Bacteria 1970
227 Ga0206353_10300899 3300020082 Bacteria 928
228 Ga0213873_10054579 3300021358 Bacteria 1067
229 Ga0207653_10002674 3300025885 Bacteria 5657
230 Ga0207653_10006770 3300025885 Bacteria 3580
231 Ga0207642_10016828 3300025899 Bacteria 2765
232 Ga0207688_10010147 3300025901 Bacteria 5124
233 Ga0207688_10056241 3300025901 Bacteria 2210
234 Ga0207688_10076278 3300025901 Bacteria 1909
235 Ga0207680_10149594 3300025903 Bacteria 1555
236 Ga0207647_10388380 3300025904 Bacteria 787
237 Ga0207685_10182275 3300025905 Bacteria 974
238 Ga0207645_10014875 3300025907 Bacteria 5191
239 Ga0207643_10385570 3300025908 Bacteria 884
240 Ga0207705_10218023 3300025909 Bacteria 1448
241 Ga0207705_10357668 3300025909 Bacteria 1126
242 Ga0207654_10113603 3300025911 Bacteria 1689
243 Ga0207654_10214943 3300025911 Bacteria 1272
244 Ga0207707_10013215 3300025912 Bacteria 7195
245 Ga0207707_10300479 3300025912 Bacteria 1388
246 Ga0207695_10012502 3300025913 Bacteria 10183
247 Ga0207671_10001952 3300025914 Bacteria 22745
248 Ga0207671_10229119 3300025914 Bacteria 1457
249 Ga0207660_10001824 3300025917 Bacteria 14187
250 Ga0207662_10009635 3300025918 Bacteria 5322
251 Ga0207662_10088564 3300025918 Bacteria 1901
252 Ga0207657_10030575 3300025919 Bacteria 4887
253 Ga0207657_10059820 3300025919 Bacteria 3271
254 Ga0207646_10182391 3300025922 Bacteria 1896
255 Ga0207694_10063855 3300025924 Bacteria 2869
256 Ga0207694_10563499 3300025924 Bacteria 957
257 Ga0207650_10164646 3300025925 Bacteria 1759
258 Ga0207659_10094769 3300025926 Unclassified 2237
259 Ga0207659_10751996 3300025926 Bacteria 836
260 Ga0207687_10025784 3300025927 Bacteria 3935
261 Ga0207687_10048803 3300025927 Bacteria 2941
262 Ga0207687_10156613 3300025927 Bacteria 1744
263 Ga0207700_10011383 3300025928 Bacteria 5668
264 Ga0207690_10038480 3300025932 Bacteria 3113
265 Ga0207706_10005035 3300025933 Bacteria 12339
266 Ga0207706_10119994 3300025933 Bacteria 2312
267 Ga0207686_10066225 3300025934 Bacteria 2306
268 Ga0207686_10116340 3300025934 Bacteria 1812
269 Ga0207686_10120216 3300025934 Bacteria 1787
270 Ga0207709_10109356 3300025935 Bacteria 1845
271 Ga0207670_10041885 3300025936 Bacteria 3014
272 Ga0207669_10061852 3300025937 Bacteria 2303
273 Ga0207704_10619211 3300025938 Bacteria 888
274 Ga0207691_10005186 3300025940 Bacteria 12580
275 Ga0207691_10059132 3300025940 Bacteria 3485
276 Ga0207691_10109433 3300025940 Bacteria 2458
277 Ga0207711_10315303 3300025941 Bacteria 1444
278 Ga0207711_10348796 3300025941 Bacteria 1370
279 Ga0207711_10352078 3300025941 Bacteria 1364
280 Ga0207689_10023227 3300025942 Bacteria 5206
281 Ga0207679_10083602 3300025945 Bacteria 2447
282 Ga0207679_10439825 3300025945 Bacteria 1154
283 Ga0207679_10679263 3300025945 Bacteria 933
284 Ga0207667_10405964 3300025949 Bacteria 1387
285 Ga0207667_11228539 3300025949 Bacteria 728
286 Ga0207651_10370267 3300025960 Bacteria 1212
287 Ga0207651_10457960 3300025960 Bacteria 1095
288 Ga0207712_10010278 3300025961 Bacteria 5937
289 Ga0207712_10111775 3300025961 Bacteria 2050
290 Ga0207712_10139068 3300025961 Bacteria 1861
291 Ga0207640_10109056 3300025981 Bacteria 1958
292 Ga0207677_10447553 3300026023 Bacteria 1106
293 Ga0207703_10096086 3300026035 Bacteria 2501
294 Ga0207703_10650231 3300026035 Bacteria 1000
295 Ga0207639_10226570 3300026041 Bacteria 1617
296 Ga0207678_10007515 3300026067 Bacteria 9634
297 Ga0207678_10014722 3300026067 Bacteria 6881
298 Ga0207678_10022732 3300026067 Bacteria 5491
299 Ga0207678_10100075 3300026067 Bacteria 2476
300 Ga0207678_10220942 3300026067 Bacteria 1622
301 Ga0207708_10137585 3300026075 Bacteria 1914
302 Ga0207708_10691726 3300026075 Bacteria 871
303 Ga0207702_10567566 3300026078 Bacteria 1111
304 Ga0207648_10013309 3300026089 Bacteria 7662
305 Ga0207648_10090170 3300026089 Bacteria 2679
306 Ga0207648_10659558 3300026089 Unclassified 967
307 Ga0207676_10232001 3300026095 Bacteria 1650
308 Ga0207676_10256530 3300026095 Bacteria 1576
309 Ga0207676_10398482 3300026095 Bacteria 1286
310 Ga0207674_10005616 3300026116 Bacteria 14865
311 Ga0207674_10183232 3300026116 Bacteria 2045
312 Ga0207675_100027603 3300026118 Bacteria 5287
313 Ga0207675_100055910 3300026118 Bacteria 3682
314 Ga0207675_100171045 3300026118 Bacteria 2077
315 Ga0207683_10000286 3300026121 Bacteria 45296
316 Ga0207683_10175542 3300026121 Bacteria 1942
317 Ga0209813_10001193 3300027866 Bacteria 5799
318 Ga0209813_10046132 3300027866 Bacteria 1345
319 Ga0209813_10054473 3300027866 Bacteria 1260
320 Ga0209813_10194582 3300027866 Bacteria 748
321 Ga0207428_10010626 3300027907 Bacteria 8212
322 Ga0207428_10031855 3300027907 Bacteria 4343
323 Ga0207428_10076248 3300027907 Bacteria 2626
324 Ga0268266_10263818 3300028379 Bacteria 1597
325 Ga0268266_10686134 3300028379 Bacteria 987
326 Ga0268265_10001313 3300028380 Bacteria 21328
327 Ga0268265_10058002 3300028380 Bacteria 2954
328 Ga0268265_10063124 3300028380 Bacteria 2849
329 Ga0268264_10011729 3300028381 Bacteria 7226
330 Ga0268264_10018988 3300028381 Bacteria 5620
331 Ga0268264_10339017 3300028381 Bacteria 1427
332 Ga0268264_10397601 3300028381 Bacteria 1323
333 Ga0307515_10001531 3300028794 Bacteria 51712
334 Ga0265338_10015678 3300028800 Bacteria 8304
335 Ga0265338_10135707 3300028800 Bacteria 1935
336 Ga0265324_10066523 3300029957 Bacteria 1230
337 Ga0307512_10180564 3300030522 Bacteria 1187
338 Ga0265331_10141130 3300031250 Bacteria 1096
339 Ga0265327_10004553 3300031251 Bacteria 12222
340 Ga0307513_10013469 3300031456 Bacteria 10029
341 Ga0307514_10001288 3300031649 Bacteria 32569
342 Ga0265314_10142245 3300031711 Bacteria 1481
343 Ga0373958_0007240 3300034819 Bacteria 1760
344 Ga0373956_0138093 3300035119 Bacteria 1143
345 Ga0373960_0025156 3300035121 Bacteria 1616
346 Ga0373955_0006258 3300035172 Bacteria 5416
347 Ga0373961_0007853 3300035241 Bacteria 2587
348 Ga0373933_0000039 3300035724 Bacteria 80657
349 Ga0373937_0000072 3300036401 Bacteria 92459
350 Ga0436364_0617894 3300037853 Bacteria 14639
351 Ga0436365_0253532 3300039437 Bacteria 4093
352 Ga0436360_1341131 3300039438 Bacteria 2173
353 Ga0436362_0843084 3300039453 Bacteria 4474
354 Ga0495603_0029690 3300046455 Bacteria 3296
355 Ga0495629_0210448 3300046459 Bacteria 1343
356 Ga0495638_0013401 3300046460 Bacteria 5581
357 Ga0495638_0016235 3300046460 Bacteria 4991
358 Ga0495638_0046966 3300046460 Bacteria 2709
359 Ga0495651_0003592 3300046462 Bacteria 11901
360 Ga0495651_0648467 3300046462 Bacteria 662
361 Ga0495653_0136961 3300046463 Bacteria 1726
362 Ga0495606_0001165 3300046507 Bacteria 37175
363 Ga0495608_0115864 3300046511 Bacteria 1720
364 Ga0495610_0031337 3300046512 Bacteria 2775
365 Ga0495610_0043508 3300046512 Bacteria 2237
366 Ga0495616_0015799 3300046513 Bacteria 4190
367 Ga0495631_0036089 3300046518 Bacteria 2209
368 Ga0495643_0019982 3300046522 Bacteria 3869
369 Ga0495648_0069200 3300046524 Bacteria 2055
370 Ga0495648_0142070 3300046524 Bacteria 1262
371 Ga0495663_0226657 3300046525 Unclassified 658
372 Ga0495652_0036030 3300046529 Bacteria 4304
373 Ga0495654_0000563 3300046530 Bacteria 29888
374 Ga0495587_0000364 3300046536 Bacteria 32643
375 Ga0495597_0064601 3300046542 Bacteria 1589
376 Ga0495667_0360642 3300046559 Bacteria 918
377 Ga0495668_0097980 3300046616 Bacteria 1605
378 Ga0495635_0376738 3300046663 Bacteria 945
379 Ga0495661_0366585 3300046665 Bacteria 706
380 Ga0495657_0257503 3300046675 Bacteria 1049
381 Ga0495623_0082617 3300046679 Bacteria 1985
382 Ga0495624_0374060 3300046690 Bacteria 856
383 Ga0495670_0021972 3300046691 Bacteria 3149
384 Ga0495671_0245691 3300046692 Bacteria 864
385 Ga0495604_0097445 3300047317 Bacteria 2169
386 Ga0495674_0173185 3300047319 Bacteria 1800
387 Ga0495675_0001842 3300047444 Bacteria 12638
388 Ga0495686_0000232 3300047472 Bacteria 102044
389 Ga0495602_0000183 3300048088 Bacteria 58980
390 Ga0496100_0033392 3300048903 Bacteria 3220
391 Ga0496100_0049864 3300048903 Bacteria 2709
392 Ga0496101_0060298 3300048904 Bacteria 2752
393 Ga0496101_0133101 3300048904 Bacteria 1890
394 Ga0496102_0002709 3300048905 Bacteria 15066
395 Ga0496102_0248356 3300048905 Bacteria 1677
396 Ga0496103_0090940 3300048906 Bacteria 1926
397 Ga0496104_0104699 3300048907 Bacteria 2711
398 Ga0496104_0869679 3300048907 Bacteria 807
399 Ga0496105_0010670 3300048908 Bacteria 7227
400 Ga0496105_0064823 3300048908 Bacteria 3015
401 Ga0496106_0001137 3300048909 Bacteria 19705
402 Ga0496106_0042883 3300048909 Bacteria 3393
403 Ga0496106_0085782 3300048909 Bacteria 2424
404 Ga0496106_0342180 3300048909 Bacteria 1201
405 Ga0496107_0012410 3300048910 Bacteria 5947
406 Ga0496107_0022502 3300048910 Bacteria 4455
407 Ga0496107_0034184 3300048910 Bacteria 3640
408 Ga0496107_0191869 3300048910 Bacteria 1518
409 Ga0496108_0082297 3300048911 Bacteria 2729
410 Ga0496109_0111287 3300048912 Bacteria 2546
411 Ga0496110_0022238 3300048913 Bacteria 5381
412 Ga0496110_0090297 3300048913 Bacteria 2739
413 Ga0496110_0213698 3300048913 Bacteria 1754
414 Ga0496111_0006330 3300048914 Bacteria 7675
415 Ga0496112_0000092 3300048915 Bacteria 58800
416 Ga0496112_0808713 3300048915 Bacteria 862
417 Ga0496113_0087051 3300048916 Bacteria 2401
418 Ga0496114_0004795 3300048917 Bacteria 10531
419 Ga0496114_0274683 3300048917 Bacteria 1485
420 Ga0496115_0703440 3300048918 Bacteria 794
421 Ga0496116_0040840 3300048919 Bacteria 3189
422 Ga0496117_0039139 3300048920 Bacteria 3503
423 Ga0496117_0097278 3300048920 Bacteria 1875
424 Ga0496117_0097925 3300048920 Bacteria 1866
425 Ga0496118_0017438 3300048921 Bacteria 6536
426 Ga0496118_0059925 3300048921 Bacteria 2830
427 Ga0496118_0231310 3300048921 Bacteria 1066
428 Ga0496119_0168997 3300048922 Bacteria 1156
429 Ga0496120_0058069 3300048923 Bacteria 2175
430 Ga0496121_0014951 3300048924 Bacteria 8175
431 Ga0496121_0019265 3300048924 Bacteria 6832
432 Ga0496122_0036370 3300048925 Bacteria 3982
433 Ga0496123_0020516 3300048926 Bacteria 5166
434 Ga0496124_0152846 3300048927 Bacteria 1808
435 Ga0496124_0154686 3300048927 Bacteria 1795
436 Ga0496125_0000801 3300048928 Bacteria 51346
437 Ga0496125_0016431 3300048928 Bacteria 7106
438 Ga0496125_0018952 3300048928 Bacteria 6512
439 Ga0496126_0030247 3300048929 Bacteria 5132
440 Ga0496126_0309748 3300048929 Bacteria 1300
441 Ga0501033_0088132 3300049570 Bacteria 2271
442 Ga0501034_1052182 3300049571 Bacteria 696
443 Ga0501036_0175288 3300049572 Bacteria 1806
444 Ga0501037_0160113 3300049573 Bacteria 1605
445 Ga0501038_0344179 3300049574 Bacteria 1162
446 Ga0501039_0065939 3300049575 Bacteria 2810
447 Ga0501040_0349943 3300049576 Bacteria 1058
448 Ga0501042_0187459 3300049578 Bacteria 1492
449 Ga0501043_0041908 3300049579 Bacteria 3597
450 Ga0501047_0589018 3300049581 Bacteria 934
451 Ga0501048_0154786 3300049582 Bacteria 1621
452 Ga0501070_0019606 3300049586 Bacteria 5671
453 Ga0501070_0872393 3300049586 Bacteria 703
454 Ga0501073_0038594 3300049589 Bacteria 3386
455 Ga0501075_0072498 3300049591 Bacteria 2604
456 Ga0501076_0277479 3300049592 Bacteria 1373
457 Ga0501076_0400628 3300049592 Bacteria 1128
458 Ga0501079_0019622 3300049741 Bacteria 5163
459 Ga0501079_0538055 3300049741 Bacteria 918
460 Ga0501080_0222851 3300049742 Bacteria 1725
461 Ga0501035_0472562 3300049822 Bacteria 1035
462 nmdc:mga03n38_24856_c1 3300050490 Bacteria 2453
463 nmdc:mga03n38_68155_c1 3300050490 Bacteria 1640
464 nmdc:mga00v17_155796_c1 3300050491 Bacteria 1469
465 nmdc:mga00v17_164645_c1 3300050491 Bacteria 1429
466 nmdc:mga0yw44_18571_c1 3300050492 Bacteria 3813
467 nmdc:mga0yw44_249649_c1 3300050492 Bacteria 1181
468 nmdc:mga06z11_1628_c1 3300050494 Bacteria 8400
469 nmdc:mga06z11_419130_c1 3300050494 Bacteria 807
470 nmdc:mga06z11_47173_c1 3300050494 Bacteria 2187
471 nmdc:mga04h51_103344_c1 3300050495 Bacteria 1041
472 nmdc:mga04h51_122814_c1 3300050495 Bacteria 969
473 nmdc:mga04h51_1238_c1 3300050495 Bacteria 5906
474 nmdc:mga04h51_75175_c1 3300050495 Bacteria 1188
475 nmdc:mga07m45_210327_c1 3300050496 Bacteria 1132
476 nmdc:mga07m45_277583_c1 3300050496 Bacteria 975
477 nmdc:mga07m45_344588_c1 3300050496 Bacteria 866
478 nmdc:mga05p37_324182_c1 3300050507 Bacteria 1822
479 nmdc:mga09592_695457_c1 3300050508 Bacteria 866
480 nmdc:mga0qj67_37632_c1 3300050509 Bacteria 3792
481 nmdc:mga08y16_321518_c1 3300050511 Bacteria 1593
482 nmdc:mga08y16_37460_c1 3300050511 Bacteria 5093
483 nmdc:mga08y16_47920_c1 3300050511 Bacteria 4473
484 nmdc:mga08y16_52112_c1 3300050511 Bacteria 4282
485 nmdc:mga08y16_531282_c1 3300050511 Bacteria 1192
486 nmdc:mga08y16_6040_c1 3300050511 Bacteria 12694
487 nmdc:mga0a205_338889_c1 3300050515 Bacteria 1372
488 nmdc:mga0sz30_14457_c1 3300050516 Bacteria 2463
489 Ga0500643_043119 3300053087 Bacteria 1317
490 Ga0500581_035768 3300053089 Bacteria 2544
491 Ga0500646_0184691 3300053090 Bacteria 708
492 Ga0500651_0051419 3300053093 Bacteria 2584
493 Ga0500651_0052630 3300053093 Bacteria 2553
494 Ga0500566_0005803 3300053094 Bacteria 7339
495 Ga0500641_0100480 3300053096 Bacteria 1240
496 Ga0500650_0001150 3300053098 Bacteria 7707
497 Ga0500556_0000035 3300053104 Bacteria 145357
498 Ga0500562_012222 3300053108 Bacteria 2182
499 Ga0500562_063104 3300053108 Bacteria 996
500 Ga0500569_021183 3300053109 Bacteria 1715
501 Ga0500595_027787 3300053119 Bacteria 1934
502 Ga0500607_062702 3300053121 Bacteria 1942
503 Ga0500608_000642 3300053122 Bacteria 12868
504 Ga0500618_020715 3300053125 Bacteria 1609
505 Ga0500642_0000149 3300053130 Bacteria 29778
506 Ga0500652_000765 3300053131 Bacteria 10856
507 Ga0500559_0000511 3300053136 Bacteria 27308
508 Ga0500568_0001924 3300053139 Bacteria 12722
509 Ga0500577_0000898 3300053142 Bacteria 7692
510 Ga0500586_000270 3300053145 Bacteria 10387
511 Ga0500604_0004302 3300053151 Bacteria 3780
512 Ga0500604_0120878 3300053151 Bacteria 875
513 Ga0500616_0000054 3300053153 Bacteria 290186
514 Ga0500616_0018499 3300053153 Bacteria 3940
515 Ga0500622_0003362 3300053156 Bacteria 10774
516 Ga0500627_0050877 3300053158 Bacteria 1805
517 Ga0500627_0097038 3300053158 Bacteria 1321
518 Ga0500634_0090197 3300053161 Bacteria 1558
519 Ga0500636_0001348 3300053177 Bacteria 13310
520 Ga0500637_0230646 3300053178 Bacteria 1043
521 Ga0500570_103330 3300053724 Bacteria 1188
522 Ga0500645_028925 3300053730 Bacteria 1675
523 Ga0501084_0069702 3300054114 Bacteria 2944
524 Ga0501084_0233727 3300054114 Bacteria 1552
525 Ga0501082_0094945 3300060353 Bacteria 2577
526 Ga0530510_0315832 3300061734 Bacteria 1171
527 2603860585 2602042107 Bacteria 6226103
528 2857525542 2857524615 Bacteria 6615449
529 2893070737 2893066018 Bacteria 6158120
530 2919074650 2919073203 Bacteria 6531949
531 Ga0075368_10096965
532 JGI24738J21930_10014140
533 JGI25406J46586_10000042
534 rootL2_10026502
535 Ga0065165_1047738
536 Ga0070658_10037841
537 Ga0070690_100065970
538 Ga0070690_100352141
539 Ga0070670_100065535
540 Ga0068869_100113227
541 Ga0070666_10443361
542 Ga0070680_100002084
543 Ga0070680_100958303
544 Ga0070682_100001115
545 Ga0070682_100028793
546 Ga0068868_100010263
547 Ga0068868_100437049
548 Ga0070660_100098843
549 Ga0070689_100032644
550 Ga0070691_10006616
551 Ga0070687_100227430
552 Ga0070661_100041461
553 Ga0070661_100321006
554 Ga0070692_10013444
555 Ga0070692_10160609
556 Ga0070668_100142800
557 Ga0070669_100062966
558 Ga0070669_100076536
559 Ga0070675_100060354
560 Ga0070671_100160011
561 Ga0070674_100019024
562 Ga0070674_100411121
563 Ga0070673_100350325
564 Ga0070688_100004156
565 Ga0070659_100084801
566 Ga0070659_100225552
567 Ga0070667_100655186
568 Ga0070703_10000891
569 Ga0070703_10022775
570 Ga0070701_10108938
571 Ga0070701_10140398
572 Ga0070701_10421068
573 Ga0070705_100000402
574 Ga0070705_100009759
575 Ga0070700_100632387
576 Ga0070694_100076349
577 Ga0070694_100124139
578 Ga0070708_100682894
579 Ga0070663_100075432
580 Ga0070663_100256210
581 Ga0070663_100372088
582 Ga0070678_100017777
583 Ga0070678_100058342
584 Ga0070678_100322268
585 Ga0070662_100312020
586 Ga0070681_10028269
587 Ga0070681_10360364
588 Ga0068867_100473238
589 Ga0070685_10023152
590 Ga0070685_10087333
591 Ga0070707_100391264
592 Ga0070699_100000330
593 Ga0070679_100025790
594 Ga0070684_100182011
595 Ga0070684_100303366
596 Ga0070697_100002472
597 Ga0068853_100085795
598 Ga0068853_100312247
599 Ga0070672_100047939
600 Ga0070686_100006183
601 Ga0070686_100011232
602 Ga0070686_100670703
603 Ga0070695_100001812
604 Ga0070696_100000069
605 Ga0070693_100052306
606 Ga0070693_100125988
607 Ga0070665_100053379
608 Ga0070665_100121249
609 Ga0070665_100356690
610 Ga0070665_101196806
611 Ga0070704_100000106
612 Ga0070704_100209338
613 Ga0070704_100462286
614 Ga0070704_100585972
615 Ga0070704_100848728
616 Ga0070704_101103749
617 Ga0068855_100035560
618 Ga0068855_100060592
619 Ga0070664_100054370
620 Ga0070664_100068298
621 Ga0070664_100439202
622 Ga0068857_100058663
623 Ga0068857_100115278
624 Ga0068854_100062404
625 Ga0068854_100119090
626 Ga0068856_100407386
627 Ga0070702_100019219
628 Ga0070702_100034465
629 Ga0068852_100068356
630 Ga0068852_100500272
631 Ga0068859_100065856
632 Ga0068859_100805747
633 Ga0068859_100931648
634 Ga0068864_100026809
635 Ga0068864_100257872
636 Ga0068866_10039212
637 Ga0068866_10088334
638 Ga0068866_10146268
639 Ga0068861_100023412
640 Ga0068861_100137688
641 Ga0068851_10112842
642 Ga0068870_10088252
643 Ga0068870_10403824
644 Ga0068858_100057689
645 Ga0068858_100163865
646 Ga0068860_100034859
647 Ga0068860_100037217
648 Ga0068860_100071088
649 Ga0068860_100072672
650 Ga0068860_100317377
651 Ga0068862_100008121
652 Ga0068862_100106532
653 Ga0068862_100344819
654 Ga0081538_10097558
655 Ga0081540_1000027
656 Ga0081539_10000099
657 Ga0075365_10062187
658 Ga0075365_10274721
659 Ga0075365_10407719
660 Ga0075368_10002428
661 Ga0075368_10030355
662 Ga0075368_10041154
663 Ga0075368_10171674
664 Ga0075363_100028298
665 Ga0075363_100109927
666 Ga0075363_100133317
667 Ga0075363_100270295
668 Ga0075364_10574598
669 Ga0070715_10139116
670 Ga0070712_100037069
671 Ga0075362_10014929
672 Ga0075367_10001240
673 Ga0075367_10268551
674 Ga0075369_10026586
675 Ga0075366_10342082
676 Ga0068871_100078972
677 Ga0068871_100090812
678 Ga0075428_100011753
679 Ga0075428_100756679
680 Ga0075428_100758142
681 Ga0075430_100142832
682 Ga0075433_10550907
683 Ga0068865_100008922
684 Ga0068865_100090793
685 Ga0097620_100065856
686 Ga0097620_100805752
687 Ga0097620_100931614
688 Ga0105240_10016188
689 Ga0111539_10002280
690 Ga0111539_10012281
691 Ga0111539_10023761
692 Ga0111539_10096984
693 Ga0111539_10403119
694 Ga0105245_10001051
695 Ga0105245_10067515
696 Ga0105245_10107964
697 Ga0105247_10012550
698 Ga0105247_10067862
699 Ga0105247_10069079
700 Ga0114129_10387394
701 Ga0114129_10394983
702 Ga0105243_10004296
703 Ga0105243_10088935
704 Ga0105243_10171289
705 Ga0105243_10517395
706 Ga0105243_10954614
707 Ga0105241_10160638
708 Ga0105241_10207453
709 Ga0105241_10287555
710 Ga0105242_10001974
711 Ga0105242_10365928
712 Ga0105248_10021280
713 Ga0105248_10028182
714 Ga0105248_10298957
715 Ga0105237_10002886
716 Ga0105237_10124606
717 Ga0105238_10033853
718 Ga0105238_10328219
719 Ga0105249_10006176
720 Ga0105249_10381939
721 Ga0105249_10455938
722 Ga0105249_11138528
723 Ga0105239_10003063
724 Ga0105239_10193324
725 Ga0105239_10219468
726 Ga0105239_10348692
727 Ga0105246_10008728
728 Ga0105246_10046725
729 Ga0105246_11043791
730 Ga0157373_10083485
731 Ga0157371_10019036
732 Ga0157369_10305349
733 Ga0157374_10346564
734 Ga0157374_10761402
735 Ga0157378_10211380
736 Ga0163162_10293071
737 Ga0157372_10338312
738 Ga0157375_10096335
739 Ga0157375_10377173
740 Ga0157375_10434395
741 Ga0157375_11438047
742 Ga0157380_10004424
743 Ga0157380_10006251
744 Ga0157380_10800740
745 Ga0157380_11060201
746 Ga0157377_10033304
747 Ga0157377_10287225
748 Ga0157377_10428241
749 Ga0157377_10711014
750 Ga0157379_10004852
751 Ga0157379_10019655
752 Ga0157379_10446857
753 Ga0157379_10795150
754 Ga0157376_10004922
755 Ga0157376_10116272
756 Ga0157376_10172676
757 Ga0206353_10300899
758 Ga0213873_10054579
759 Ga0207653_10002674
760 Ga0207653_10006770
761 Ga0207642_10016828
762 Ga0207688_10010147
763 Ga0207688_10056241
764 Ga0207688_10076278
765 Ga0207680_10149594
766 Ga0207647_10388380
767 Ga0207685_10182275
768 Ga0207645_10014875
769 Ga0207643_10385570
770 Ga0207705_10218023
771 Ga0207705_10357668
772 Ga0207654_10113603
773 Ga0207654_10214943
774 Ga0207707_10013215
775 Ga0207707_10300479
776 Ga0207695_10012502
777 Ga0207671_10001952
778 Ga0207671_10229119
779 Ga0207660_10001824
780 Ga0207662_10009635
781 Ga0207662_10088564
782 Ga0207657_10030575
783 Ga0207657_10059820
784 Ga0207646_10182391
785 Ga0207694_10063855
786 Ga0207694_10563499
787 Ga0207650_10164646
788 Ga0207659_10094769
789 Ga0207659_10751996
790 Ga0207687_10025784
791 Ga0207687_10048803
792 Ga0207687_10156613
793 Ga0207700_10011383
794 Ga0207690_10038480
795 Ga0207706_10005035
796 Ga0207706_10119994
797 Ga0207686_10066225
798 Ga0207686_10116340
799 Ga0207686_10120216
800 Ga0207709_10109356
801 Ga0207670_10041885
802 Ga0207669_10061852
803 Ga0207704_10619211
804 Ga0207691_10005186
805 Ga0207691_10059132
806 Ga0207691_10109433
807 Ga0207711_10315303
808 Ga0207711_10348796
809 Ga0207711_10352078
810 Ga0207689_10023227
811 Ga0207679_10083602
812 Ga0207679_10439825
813 Ga0207679_10679263
814 Ga0207667_10405964
815 Ga0207667_11228539
816 Ga0207651_10370267
817 Ga0207651_10457960
818 Ga0207712_10010278
819 Ga0207712_10111775
820 Ga0207712_10139068
821 Ga0207640_10109056
822 Ga0207677_10447553
823 Ga0207703_10096086
824 Ga0207703_10650231
825 Ga0207639_10226570
826 Ga0207678_10007515
827 Ga0207678_10014722
828 Ga0207678_10022732
829 Ga0207678_10100075
830 Ga0207678_10220942
831 Ga0207708_10137585
832 Ga0207708_10691726
833 Ga0207702_10567566
834 Ga0207648_10013309
835 Ga0207648_10090170
836 Ga0207648_10659558
837 Ga0207676_10232001
838 Ga0207676_10256530
839 Ga0207676_10398482
840 Ga0207674_10005616
841 Ga0207674_10183232
842 Ga0207675_100027603
843 Ga0207675_100055910
844 Ga0207675_100171045
845 Ga0207683_10000286
846 Ga0207683_10175542
847 Ga0209813_10001193
848 Ga0209813_10046132
849 Ga0209813_10054473
850 Ga0209813_10194582
851 Ga0207428_10010626
852 Ga0207428_10031855
853 Ga0207428_10076248
854 Ga0268266_10263818
855 Ga0268266_10686134
856 Ga0268265_10001313
857 Ga0268265_10058002
858 Ga0268265_10063124
859 Ga0268264_10011729
860 Ga0268264_10018988
861 Ga0268264_10339017
862 Ga0268264_10397601
863 Ga0307515_10001531
864 Ga0265338_10015678
865 Ga0265338_10135707
866 Ga0265324_10066523
867 Ga0307512_10180564
868 Ga0265331_10141130
869 Ga0265327_10004553
870 Ga0307513_10013469
871 Ga0307514_10001288
872 Ga0265314_10142245
873 Ga0373958_0007240
874 Ga0373956_0138093
875 Ga0373960_0025156
876 Ga0373955_0006258
877 Ga0373961_0007853
878 Ga0373933_0000039
879 Ga0373937_0000072
880 Ga0436364_0617894
881 Ga0436365_0253532
882 Ga0436360_1341131
883 Ga0436362_0843084
884 Ga0495603_0029690
885 Ga0495629_0210448
886 Ga0495638_0013401
887 Ga0495638_0016235
888 Ga0495638_0046966
889 Ga0495651_0003592
890 Ga0495651_0648467
891 Ga0495653_0136961
892 Ga0495606_0001165
893 Ga0495608_0115864
894 Ga0495610_0031337
895 Ga0495610_0043508
896 Ga0495616_0015799
897 Ga0495631_0036089
898 Ga0495643_0019982
899 Ga0495648_0069200
900 Ga0495648_0142070
901 Ga0495663_0226657
902 Ga0495652_0036030
903 Ga0495654_0000563
904 Ga0495587_0000364
905 Ga0495597_0064601
906 Ga0495667_0360642
907 Ga0495668_0097980
908 Ga0495635_0376738
909 Ga0495661_0366585
910 Ga0495657_0257503
911 Ga0495623_0082617
912 Ga0495624_0374060
913 Ga0495670_0021972
914 Ga0495671_0245691
915 Ga0495604_0097445
916 Ga0495674_0173185
917 Ga0495675_0001842
918 Ga0495686_0000232
919 Ga0495602_0000183
920 Ga0496100_0033392
921 Ga0496100_0049864
922 Ga0496101_0060298
923 Ga0496101_0133101
924 Ga0496102_0002709
925 Ga0496102_0248356
926 Ga0496103_0090940
927 Ga0496104_0104699
928 Ga0496104_0869679
929 Ga0496105_0010670
930 Ga0496105_0064823
931 Ga0496106_0001137
932 Ga0496106_0042883
933 Ga0496106_0085782
934 Ga0496106_0342180
935 Ga0496107_0012410
936 Ga0496107_0022502
937 Ga0496107_0034184
938 Ga0496107_0191869
939 Ga0496108_0082297
940 Ga0496109_0111287
941 Ga0496110_0022238
942 Ga0496110_0090297
943 Ga0496110_0213698
944 Ga0496111_0006330
945 Ga0496112_0000092
946 Ga0496112_0808713
947 Ga0496113_0087051
948 Ga0496114_0004795
949 Ga0496114_0274683
950 Ga0496115_0703440
951 Ga0496116_0040840
952 Ga0496117_0039139
953 Ga0496117_0097278
954 Ga0496117_0097925
955 Ga0496118_0017438
956 Ga0496118_0059925
957 Ga0496118_0231310
958 Ga0496119_0168997
959 Ga0496120_0058069
960 Ga0496121_0014951
961 Ga0496121_0019265
962 Ga0496122_0036370
963 Ga0496123_0020516
964 Ga0496124_0152846
965 Ga0496124_0154686
966 Ga0496125_0000801
967 Ga0496125_0016431
968 Ga0496125_0018952
969 Ga0496126_0030247
970 Ga0496126_0309748
971 Ga0501033_0088132
972 Ga0501034_1052182
973 Ga0501036_0175288
974 Ga0501037_0160113
975 Ga0501038_0344179
976 Ga0501039_0065939
977 Ga0501040_0349943
978 Ga0501042_0187459
979 Ga0501043_0041908
980 Ga0501047_0589018
981 Ga0501048_0154786
982 Ga0501070_0019606
983 Ga0501070_0872393
984 Ga0501073_0038594
985 Ga0501075_0072498
986 Ga0501076_0277479
987 Ga0501076_0400628
988 Ga0501079_0019622
989 Ga0501079_0538055
990 Ga0501080_0222851
991 Ga0501035_0472562
992 nmdc:mga03n38_24856_c1
993 nmdc:mga03n38_68155_c1
994 nmdc:mga00v17_155796_c1
995 nmdc:mga00v17_164645_c1
996 nmdc:mga0yw44_18571_c1
997 nmdc:mga0yw44_249649_c1
998 nmdc:mga06z11_1628_c1
999 nmdc:mga06z11_419130_c1
1000 nmdc:mga06z11_47173_c1
1001 nmdc:mga04h51_103344_c1
1002 nmdc:mga04h51_122814_c1
1003 nmdc:mga04h51_1238_c1
1004 nmdc:mga04h51_75175_c1
1005 nmdc:mga07m45_210327_c1
1006 nmdc:mga07m45_277583_c1
1007 nmdc:mga07m45_344588_c1
1008 nmdc:mga05p37_324182_c1
1009 nmdc:mga09592_695457_c1
1010 nmdc:mga0qj67_37632_c1
1011 nmdc:mga08y16_321518_c1
1012 nmdc:mga08y16_37460_c1
1013 nmdc:mga08y16_47920_c1
1014 nmdc:mga08y16_52112_c1
1015 nmdc:mga08y16_531282_c1
1016 nmdc:mga08y16_6040_c1
1017 nmdc:mga0a205_338889_c1
1018 nmdc:mga0sz30_14457_c1
1019 Ga0500643_043119
1020 Ga0500581_035768
1021 Ga0500646_0184691
1022 Ga0500651_0051419
1023 Ga0500651_0052630
1024 Ga0500566_0005803
1025 Ga0500641_0100480
1026 Ga0500650_0001150
1027 Ga0500556_0000035
1028 Ga0500562_012222
1029 Ga0500562_063104
1030 Ga0500569_021183
1031 Ga0500595_027787
1032 Ga0500607_062702
1033 Ga0500608_000642
1034 Ga0500618_020715
1035 Ga0500642_0000149
1036 Ga0500652_000765
1037 Ga0500559_0000511
1038 Ga0500568_0001924
1039 Ga0500577_0000898
1040 Ga0500586_000270
1041 Ga0500604_0004302
1042 Ga0500604_0120878
1043 Ga0500616_0000054
1044 Ga0500616_0018499
1045 Ga0500622_0003362
1046 Ga0500627_0050877
1047 Ga0500627_0097038
1048 Ga0500634_0090197
1049 Ga0500636_0001348
1050 Ga0500637_0230646
1051 Ga0500570_103330
1052 Ga0500645_028925
1053 Ga0501084_0069702
1054 Ga0501084_0233727
1055 Ga0501082_0094945
1056 Ga0530510_0315832
1057 2603860585
1058 2857525542
1059 2893070737
1060 2919074650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

47

169

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jmv-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol 0.9596 1 200
7jmr-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis 0.9563 1 200
7jmv-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol 0.9504 1 200
7jmr-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis 0.9471 1 200
7kd9-assembly2.cif.gz_C crystal structure of gallic acid decarboxylase from arxula adeninivorans 0.9375 1 200
ID Description Score Start End Superfamily
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8674 4 127 3.10.450.50
4gb5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8615 3 127 3.10.450.50
3a76A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.821 3 137 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8191 6 138 3.10.450.50
4lehA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8155 6 143 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A6L5FHH4-F1-model_v4 Nuclear transport factor 2 family protein 0.9971 3 199
AF-A0A2P7B700-F1-model_v4 SnoaL-like domain-containing protein 0.9933 1 199
AF-A0A7W8V5X0-F1-model_v4 SnoaL-like domain-containing protein 0.9929 2 179
AF-A0A158K195-F1-model_v4 SnoaL-like domain-containing protein 0.99 1 201
AF-A0A1F9DU54-F1-model_v4 SnoaL-like domain-containing protein 0.9895 1 196

Map