F459860

General Info

Members Datasets Scaffolds Average Seq Length
529 338 514 174

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0059942|Ga0496102_0059942_131_766
Length 211
Sequence MRGWPKRPIEPNGRSISLQRYALTPAAQAYRRAPSPQGHFMLTRRTFVVASLLAGTSPAFAVVPAPSDPVAVLTAIYTRAAKGKGDGGGAFVIENKAAKAKYLSKALVALWARADAHTPKGDVGPVDFDPVTNSQEPDVKSFKVDAEKMEADKATLAVTIAGHRNDRKPADLIVRYDFVREAGSWRIDDIKGSSDGEAWSIRKMLTDSLKS

Samples

Sample ID Description Type Environment
1 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
2 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
3 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
4 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
5 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
6 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
7 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
8 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
9 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
10 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
11 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
296 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
297 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
302 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
303 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
306 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
307 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
310 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
311 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
321 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
322 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
323 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
328 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
329 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
330 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
335 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
336 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
337 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
338 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.39
Nodule 2.84
Rhizoplane 5.29
Rhizosphere 67.49
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10023618 3300003215 Bacteria 2236
2 JGI25153J46596_10025855 3300003215 Bacteria 2089
3 rootL2_10097589 3300003322 Bacteria 1151
4 rootH1_10027936 3300003323 Bacteria 2972
5 Ga0065165_1009387 3300005262 Bacteria 4393
6 Ga0065165_1047408 3300005262 Bacteria 1241
7 Ga0070670_100209930 3300005331 Bacteria 1693
8 Ga0068869_100149478 3300005334 Bacteria 1810
9 Ga0070666_10069776 3300005335 Bacteria 2390
10 Ga0070680_100430953 3300005336 Bacteria 1125
11 Ga0068868_100358053 3300005338 Bacteria 1251
12 Ga0068868_100998243 3300005338 Bacteria 766
13 Ga0070668_100040420 3300005347 Bacteria 3568
14 Ga0070668_100428482 3300005347 Bacteria 1133
15 Ga0070668_100639909 3300005347 Bacteria 933
16 Ga0070675_100226787 3300005354 Bacteria 1629
17 Ga0070671_100249779 3300005355 Bacteria 1507
18 Ga0070667_100507490 3300005367 Bacteria 1106
19 Ga0070667_100574971 3300005367 Bacteria 1037
20 Ga0070709_10568020 3300005434 Bacteria 870
21 Ga0070713_100740724 3300005436 Bacteria 940
22 Ga0070708_100433906 3300005445 Bacteria 1239
23 Ga0070663_100091642 3300005455 Bacteria 2252
24 Ga0070662_100158312 3300005457 Bacteria 1769
25 Ga0070685_10619924 3300005466 Bacteria 781
26 Ga0070707_100324803 3300005468 Bacteria 1495
27 Ga0070698_100085336 3300005471 Bacteria 3145
28 Ga0070679_100739886 3300005530 Bacteria 926
29 Ga0070697_100213085 3300005536 Bacteria 1645
30 Ga0068853_100348531 3300005539 Bacteria 1377
31 Ga0068853_100967380 3300005539 Bacteria 819
32 Ga0070696_100074055 3300005546 Bacteria 2400
33 Ga0070696_100507653 3300005546 Bacteria 960
34 Ga0070693_100739646 3300005547 Bacteria 724
35 Ga0070665_100070981 3300005548 Bacteria 3489
36 Ga0070665_100144836 3300005548 Bacteria 2379
37 Ga0070665_100635498 3300005548 Bacteria 1080
38 Ga0070665_100786374 3300005548 Bacteria 965
39 Ga0068855_100657564 3300005563 Bacteria 1125
40 Ga0068855_101455801 3300005563 Unclassified 704
41 Ga0070664_100616868 3300005564 Bacteria 1007
42 Ga0068857_100110928 3300005577 Bacteria 2465
43 Ga0068854_100242225 3300005578 Bacteria 1437
44 Ga0068856_100000919 3300005614 Bacteria 31534
45 Ga0070702_100348159 3300005615 Bacteria 1042
46 Ga0068852_101287002 3300005616 Bacteria 753
47 Ga0068859_100224943 3300005617 Bacteria 1964
48 Ga0068863_100810650 3300005841 Bacteria 934
49 Ga0068863_102245725 3300005841 Bacteria 556
50 Ga0068858_100154566 3300005842 Bacteria 2158
51 Ga0068860_100862141 3300005843 Bacteria 921
52 Ga0068862_101367870 3300005844 Bacteria 711
53 Ga0081540_1006213 3300005983 Bacteria 8758
54 Ga0081540_1014958 3300005983 Bacteria 4935
55 Ga0070717_10020204 3300006028 Bacteria 5234
56 Ga0070717_10430299 3300006028 Bacteria 1188
57 Ga0075365_10047264 3300006038 Bacteria 2828
58 Ga0075368_10003302 3300006042 Bacteria 5372
59 Ga0075368_10009924 3300006042 Bacteria 3434
60 Ga0075363_100056159 3300006048 Bacteria 2110
61 Ga0075364_10019540 3300006051 Bacteria 4252
62 Ga0070712_100473653 3300006175 Bacteria 1046
63 Ga0075362_10111203 3300006177 Bacteria 1289
64 Ga0075367_10040446 3300006178 Bacteria 2722
65 Ga0075369_10021722 3300006186 Bacteria 2641
66 Ga0075369_10265439 3300006186 Bacteria 798
67 Ga0075370_10068087 3300006353 Bacteria 2033
68 Ga0068871_100079454 3300006358 Bacteria 2714
69 Ga0068865_100166388 3300006881 Bacteria 1686
70 Ga0097620_100224942 3300006931 Bacteria 1964
71 Ga0105240_10153056 3300009093 Bacteria 2745
72 Ga0105240_10172526 3300009093 Bacteria 2560
73 Ga0105240_10775999 3300009093 Bacteria 1040
74 Ga0105240_11160997 3300009093 Bacteria 819
75 Ga0105247_10038756 3300009101 Bacteria 2910
76 Ga0105247_10137489 3300009101 Bacteria 1598
77 Ga0105247_10215034 3300009101 Bacteria 1298
78 Ga0105248_10565739 3300009177 Bacteria 1282
79 Ga0105248_10775796 3300009177 Bacteria 1082
80 Ga0105237_10053970 3300009545 Bacteria 4028
81 Ga0105237_10121328 3300009545 Bacteria 2608
82 Ga0105237_10601188 3300009545 Bacteria 1107
83 Ga0105237_11455634 3300009545 Bacteria 691
84 Ga0105238_10333454 3300009551 Bacteria 1504
85 Ga0105238_10479829 3300009551 Bacteria 1242
86 Ga0105249_10344315 3300009553 Bacteria 1508
87 Ga0105239_10156417 3300010375 Bacteria 2546
88 Ga0105239_10754936 3300010375 Bacteria 1113
89 Ga0105239_10987239 3300010375 Bacteria 968
90 Ga0105246_10012729 3300011119 Bacteria 5257
91 Ga0157371_10309862 3300013102 Bacteria 1144
92 Ga0157370_10180463 3300013104 Bacteria 1962
93 Ga0157370_10211757 3300013104 Bacteria 1796
94 Ga0157369_10005972 3300013105 Bacteria 14140
95 Ga0163162_11059044 3300013306 Bacteria 918
96 Ga0157372_10185231 3300013307 Bacteria 2411
97 Ga0157375_10248577 3300013308 Bacteria 1939
98 Ga0157375_10279496 3300013308 Bacteria 1832
99 Ga0163163_10018720 3300014325 Bacteria 6490
100 Ga0163163_10153884 3300014325 Bacteria 2343
101 Ga0163163_10259460 3300014325 Bacteria 1789
102 Ga0182008_10107029 3300014497 Bacteria 1384
103 Ga0157377_10497228 3300014745 Bacteria 851
104 Ga0157379_10235908 3300014968 Bacteria 1659
105 Ga0213876_10124548 3300021384 Bacteria 1369
106 Ga0213875_10198375 3300021388 Bacteria 944
107 Ga0209563_103371 3300025230 Bacteria 3326
108 Ga0209677_106255 3300025253 Bacteria 2866
109 Ga0209148_1000258 3300025254 Bacteria 83390
110 Ga0209148_1047697 3300025254 Bacteria 565
111 Ga0209233_1003783 3300025261 Bacteria 5281
112 Ga0209233_1008098 3300025261 Bacteria 3281
113 Ga0209455_1004545 3300025272 Bacteria 4504
114 Ga0209455_1007471 3300025272 Bacteria 3081
115 Ga0209455_1031803 3300025272 Bacteria 882
116 Ga0209564_1002963 3300025295 Bacteria 12237
117 Ga0209758_1000775 3300025297 Bacteria 45897
118 Ga0209758_1005565 3300025297 Bacteria 9595
119 Ga0209256_1056840 3300025299 Bacteria 924
120 Ga0207426_1000661 3300025302 Bacteria 42239
121 Ga0209257_1010306 3300025304 Bacteria 4756
122 Ga0207697_10029821 3300025315 Bacteria 2233
123 Ga0207697_10131838 3300025315 Bacteria 1080
124 Ga0207656_10395183 3300025321 Bacteria 694
125 Ga0207688_10122945 3300025901 Bacteria 1516
126 Ga0207699_10185362 3300025906 Bacteria 1401
127 Ga0207695_10220511 3300025913 Bacteria 1804
128 Ga0207695_10545112 3300025913 Bacteria 1041
129 Ga0207671_10165762 3300025914 Bacteria 1713
130 Ga0207671_10907025 3300025914 Bacteria 697
131 Ga0207693_10257709 3300025915 Bacteria 1368
132 Ga0207660_10381730 3300025917 Bacteria 1133
133 Ga0207652_10672795 3300025921 Bacteria 925
134 Ga0207694_10224526 3300025924 Bacteria 1533
135 Ga0207650_10055612 3300025925 Bacteria 2938
136 Ga0207650_10138421 3300025925 Bacteria 1912
137 Ga0207659_10476852 3300025926 Bacteria 1054
138 Ga0207700_10627712 3300025928 Bacteria 957
139 Ga0207664_10108916 3300025929 Bacteria 2301
140 Ga0207644_10333958 3300025931 Bacteria 1228
141 Ga0207706_10070933 3300025933 Bacteria 3064
142 Ga0207669_10225490 3300025937 Bacteria 1379
143 Ga0207704_10523644 3300025938 Bacteria 959
144 Ga0207711_10845387 3300025941 Bacteria 852
145 Ga0207667_10763277 3300025949 Bacteria 966
146 Ga0207651_10514851 3300025960 Bacteria 1036
147 Ga0207668_10329701 3300025972 Bacteria 1269
148 Ga0207668_10521461 3300025972 Bacteria 1025
149 Ga0207640_10289010 3300025981 Bacteria 1292
150 Ga0207658_10279774 3300025986 Bacteria 1430
151 Ga0207658_10396621 3300025986 Bacteria 1212
152 Ga0207677_10177885 3300026023 Bacteria 1671
153 Ga0207703_10184668 3300026035 Bacteria 1842
154 Ga0207639_10243516 3300026041 Bacteria 1565
155 Ga0207639_10270299 3300026041 Bacteria 1491
156 Ga0207639_10340693 3300026041 Bacteria 1336
157 Ga0207678_10042160 3300026067 Bacteria 3955
158 Ga0207678_10084749 3300026067 Bacteria 2710
159 Ga0207678_10178299 3300026067 Bacteria 1814
160 Ga0207702_10000257 3300026078 Bacteria 61235
161 Ga0207702_10716305 3300026078 Bacteria 986
162 Ga0207675_100579471 3300026118 Bacteria 1123
163 Ga0207683_10078508 3300026121 Bacteria 2925
164 Ga0207683_10391437 3300026121 Bacteria 1278
165 Ga0207698_10833167 3300026142 Bacteria 926
166 Ga0209813_10078767 3300027866 Bacteria 1085
167 Ga0268266_10239305 3300028379 Bacteria 1674
168 Ga0268266_10572857 3300028379 Bacteria 1083
169 Ga0268265_10354808 3300028380 Bacteria 1340
170 Ga0268265_10522862 3300028380 Bacteria 1122
171 Ga0265334_10139435 3300028573 Bacteria 859
172 Ga0265338_10385541 3300028800 Unclassified 1002
173 Ga0265330_10026658 3300031235 Bacteria 2613
174 Ga0265325_10122250 3300031241 Bacteria 1254
175 Ga0265340_10109163 3300031247 Bacteria 1280
176 Ga0265316_10105909 3300031344 Unclassified 2133
177 Ga0265314_10024131 3300031711 Bacteria 4618
178 Ga0265342_10008945 3300031712 Bacteria 7113
179 Ga0265342_10120996 3300031712 Bacteria 1474
180 Ga0307510_10011579 3300033180 Bacteria 10466
181 Ga0373926_0042807 3300035083 Bacteria 1620
182 Ga0373934_0015387 3300035086 Bacteria 2902
183 Ga0373923_0004358 3300035111 Bacteria 4690
184 Ga0373923_0020014 3300035111 Bacteria 2596
185 Ga0373936_0030840 3300035113 Bacteria 2115
186 Ga0373953_0007080 3300035117 Bacteria 3736
187 Ga0373954_0030489 3300035118 Bacteria 2486
188 Ga0373956_0005761 3300035119 Bacteria 4953
189 Ga0373957_0003039 3300035120 Bacteria 4881
190 Ga0373943_0014337 3300035170 Bacteria 3587
191 Ga0373943_0124126 3300035170 Bacteria 1375
192 Ga0373946_0004813 3300035171 Bacteria 4859
193 Ga0373946_0161618 3300035171 Bacteria 1052
194 Ga0373955_0000352 3300035172 Bacteria 19413
195 Ga0373955_0053855 3300035172 Bacteria 2198
196 Ga0373962_0072821 3300035242 Bacteria 1030
197 Ga0373924_0000523 3300035410 Bacteria 11791
198 Ga0373924_0031720 3300035410 Bacteria 2126
199 Ga0373927_0000432 3300035695 Bacteria 32114
200 Ga0373927_0081394 3300035695 Bacteria 2098
201 Ga0373933_0002766 3300035724 Bacteria 9785
202 Ga0373933_0070357 3300035724 Bacteria 2128
203 Ga0373947_0011086 3300035725 Bacteria 5175
204 Ga0373937_0008910 3300036401 Bacteria 8710
205 Ga0373937_0182000 3300036401 Bacteria 1974
206 Ga0373937_0328561 3300036401 Bacteria 1447
207 Ga0373925_0456722 3300037068 Bacteria 1046
208 Ga0395900_0012630 3300037418 Bacteria 8637
209 Ga0395898_0039217 3300037466 Bacteria 4689
210 Ga0395905_0152558 3300037471 Bacteria 2173
211 Ga0395905_0261312 3300037471 Bacteria 1616
212 Ga0436364_0424493 3300037853 Bacteria 6234
213 Ga0436364_0767258 3300037853 Bacteria 964
214 Ga0436363_1057105 3300039450 Bacteria 1277
215 Ga0466966_0000600 3300044684 Bacteria 22805
216 Ga0466961_0000162 3300044693 Bacteria 45301
217 Ga0466970_0099957 3300044765 Bacteria 1579
218 Ga0466957_0045107 3300044842 Bacteria 2673
219 Ga0466959_0037437 3300045049 Bacteria 3584
220 Ga0466959_0103596 3300045049 Bacteria 2035
221 Ga0466958_0112497 3300045836 Bacteria 1700
222 Ga0495617_037713 3300046452 Bacteria 1618
223 Ga0495592_0003207 3300046454 Bacteria 11722
224 Ga0495592_0026570 3300046454 Bacteria 4388
225 Ga0495603_0000067 3300046455 Bacteria 45466
226 Ga0495629_0001343 3300046459 Bacteria 19368
227 Ga0495629_0003475 3300046459 Bacteria 11910
228 Ga0495629_0188724 3300046459 Bacteria 1427
229 Ga0495638_0019840 3300046460 Bacteria 4445
230 Ga0495638_0083169 3300046460 Bacteria 1940
231 Ga0495638_0469155 3300046460 Bacteria 639
232 Ga0495651_0033028 3300046462 Bacteria 4037
233 Ga0495651_0033516 3300046462 Bacteria 4005
234 Ga0495653_0000212 3300046463 Bacteria 47187
235 Ga0495653_0086472 3300046463 Bacteria 2304
236 Ga0495653_0594349 3300046463 Bacteria 681
237 Ga0495650_0062817 3300046471 Bacteria 1483
238 Ga0495580_0002382 3300046472 Bacteria 16421
239 Ga0495580_0024700 3300046472 Bacteria 4397
240 Ga0495582_0000049 3300046473 Bacteria 59194
241 Ga0495605_0136905 3300046474 Bacteria 1101
242 Ga0495639_0000106 3300046475 Bacteria 42031
243 Ga0495639_0193926 3300046475 Bacteria 992
244 Ga0495662_0000276 3300046476 Bacteria 22020
245 Ga0495662_0270520 3300046476 Bacteria 836
246 Ga0495664_0017824 3300046477 Bacteria 4060
247 Ga0495664_0070837 3300046477 Bacteria 2082
248 Ga0495664_0180986 3300046477 Bacteria 1278
249 Ga0495594_0001204 3300046499 Bacteria 13519
250 Ga0495596_0208664 3300046500 Bacteria 759
251 Ga0495583_0268000 3300046506 Bacteria 682
252 Ga0495608_0014735 3300046511 Bacteria 5426
253 Ga0495618_0235523 3300046514 Bacteria 1152
254 Ga0495628_0007748 3300046516 Bacteria 9263
255 Ga0495628_0105386 3300046516 Bacteria 2172
256 Ga0495628_0590074 3300046516 Bacteria 794
257 Ga0495630_0177159 3300046517 Bacteria 1625
258 Ga0495630_0264558 3300046517 Bacteria 1314
259 Ga0495632_0045378 3300046519 Bacteria 2189
260 Ga0495632_0070631 3300046519 Bacteria 1679
261 Ga0495643_0060232 3300046522 Bacteria 2015
262 Ga0495643_0219778 3300046522 Bacteria 902
263 Ga0495648_0095903 3300046524 Bacteria 1649
264 Ga0495648_0115269 3300046524 Bacteria 1454
265 Ga0495648_0184406 3300046524 Bacteria 1058
266 Ga0495648_0293600 3300046524 Bacteria 765
267 Ga0495666_0033825 3300046526 Bacteria 2496
268 Ga0495652_0008265 3300046529 Bacteria 9510
269 Ga0495652_0092591 3300046529 Bacteria 2469
270 Ga0495652_0117140 3300046529 Bacteria 2132
271 Ga0495654_0204137 3300046530 Bacteria 844
272 Ga0495665_0000307 3300046531 Bacteria 24786
273 Ga0495665_0014870 3300046531 Bacteria 4192
274 Ga0495640_0005046 3300046533 Bacteria 10482
275 Ga0495640_0006166 3300046533 Bacteria 9503
276 Ga0495640_0020568 3300046533 Bacteria 4856
277 Ga0495640_0038036 3300046533 Bacteria 3388
278 Ga0495587_0014477 3300046536 Bacteria 4945
279 Ga0495587_0358917 3300046536 Bacteria 812
280 Ga0495598_0081022 3300046537 Bacteria 1041
281 Ga0495645_0033851 3300046543 Bacteria 3727
282 Ga0495622_0026769 3300046557 Bacteria 2692
283 Ga0495622_0123885 3300046557 Bacteria 1179
284 Ga0495667_0001112 3300046559 Bacteria 17494
285 Ga0495667_0102706 3300046559 Bacteria 1849
286 Ga0495656_0145982 3300046615 Bacteria 1138
287 Ga0495634_0000267 3300046642 Bacteria 49323
288 Ga0495634_0072683 3300046642 Bacteria 2262
289 Ga0495635_0000230 3300046663 Bacteria 35642
290 Ga0495635_0004002 3300046663 Bacteria 10239
291 Ga0495635_0038800 3300046663 Bacteria 3297
292 Ga0495588_0020296 3300046674 Bacteria 3264
293 Ga0495657_0016784 3300046675 Bacteria 5324
294 Ga0495657_0024124 3300046675 Bacteria 4336
295 Ga0495657_0072863 3300046675 Bacteria 2239
296 Ga0495599_0000807 3300046678 Bacteria 17610
297 Ga0495599_0027325 3300046678 Bacteria 3577
298 Ga0495599_0069521 3300046678 Bacteria 2197
299 Ga0495599_0331094 3300046678 Bacteria 915
300 Ga0495623_0010742 3300046679 Bacteria 5927
301 Ga0495623_0634910 3300046679 Bacteria 552
302 Ga0495646_0029561 3300046680 Bacteria 3425
303 Ga0495646_0063995 3300046680 Bacteria 2181
304 Ga0495646_0309798 3300046680 Bacteria 833
305 Ga0495646_0435495 3300046680 Bacteria 678
306 Ga0495647_0001002 3300046681 Bacteria 8582
307 Ga0495647_0009264 3300046681 Bacteria 3330
308 Ga0495658_0023717 3300046683 Bacteria 3260
309 Ga0495669_0457170 3300046684 Bacteria 620
310 Ga0495613_0003663 3300046689 Bacteria 11518
311 Ga0495613_0064321 3300046689 Bacteria 2683
312 Ga0495613_0387785 3300046689 Bacteria 954
313 Ga0495624_0001957 3300046690 Bacteria 15673
314 Ga0495670_0066769 3300046691 Bacteria 1815
315 Ga0495671_0166017 3300046692 Bacteria 1074
316 Ga0495671_0289360 3300046692 Bacteria 789
317 Ga0495649_0323226 3300046694 Bacteria 783
318 Ga0495649_0379236 3300046694 Bacteria 712
319 Ga0495600_0001064 3300046809 Bacteria 14886
320 Ga0495600_0012503 3300046809 Bacteria 5311
321 Ga0495600_0109318 3300046809 Bacteria 1800
322 Ga0495581_0000022 3300047315 Bacteria 56149
323 Ga0495581_0127080 3300047315 Bacteria 1485
324 Ga0495604_0011802 3300047317 Bacteria 6948
325 Ga0495604_0011818 3300047317 Bacteria 6945
326 Ga0495604_0046272 3300047317 Bacteria 3392
327 Ga0495604_0071571 3300047317 Bacteria 2623
328 Ga0495674_0000629 3300047319 Bacteria 33021
329 Ga0495674_0009234 3300047319 Bacteria 9373
330 Ga0495674_0017832 3300047319 Bacteria 6609
331 Ga0495676_0026326 3300047321 Bacteria 5010
332 Ga0495676_0211927 3300047321 Bacteria 1340
333 Ga0495680_0001284 3300047322 Bacteria 27396
334 Ga0495680_0039557 3300047322 Bacteria 3761
335 Ga0495683_0354052 3300047323 Bacteria 619
336 Ga0495687_111123 3300047443 Bacteria 1007
337 Ga0495675_0008311 3300047444 Bacteria 6422
338 Ga0495675_0056589 3300047444 Bacteria 2486
339 Ga0495673_0105851 3300047469 Bacteria 1131
340 Ga0495673_0165793 3300047469 Bacteria 845
341 Ga0495684_0000780 3300047471 Bacteria 25813
342 Ga0495684_0154898 3300047471 Bacteria 1712
343 Ga0495686_0054318 3300047472 Bacteria 2508
344 Ga0495686_0257078 3300047472 Bacteria 979
345 Ga0495686_0395143 3300047472 Bacteria 743
346 Ga0495593_0000016 3300047673 Bacteria 80178
347 Ga0495593_0010013 3300047673 Bacteria 5494
348 Ga0495593_0374657 3300047673 Bacteria 711
349 Ga0495602_0035202 3300048088 Bacteria 4671
350 Ga0495602_0335554 3300048088 Bacteria 1095
351 Ga0495602_0395223 3300048088 Bacteria 987
352 Ga0495614_0076996 3300048089 Bacteria 1442
353 Ga0495626_0236976 3300048091 Bacteria 736
354 Ga0496100_0121082 3300048903 Bacteria 1831
355 Ga0496101_0175126 3300048904 Bacteria 1650
356 Ga0496101_0493564 3300048904 Bacteria 967
357 Ga0496102_0059942 3300048905 Bacteria 3481
358 Ga0496104_0007051 3300048907 Bacteria 9914
359 Ga0496104_0290575 3300048907 Bacteria 1547
360 Ga0496105_0084340 3300048908 Bacteria 2624
361 Ga0496106_0014425 3300048909 Bacteria 5838
362 Ga0496106_0066949 3300048909 Bacteria 2737
363 Ga0496106_1042573 3300048909 Bacteria 642
364 Ga0496107_0012037 3300048910 Bacteria 6033
365 Ga0496107_0123826 3300048910 Bacteria 1905
366 Ga0496107_0658580 3300048910 Bacteria 772
367 Ga0496108_0091518 3300048911 Bacteria 2585
368 Ga0496108_0153847 3300048911 Bacteria 1985
369 Ga0496108_0259768 3300048911 Bacteria 1511
370 Ga0496108_0512894 3300048911 Bacteria 1047
371 Ga0496109_0018354 3300048912 Bacteria 6145
372 Ga0496110_0027198 3300048913 Bacteria 4902
373 Ga0496111_0108112 3300048914 Bacteria 2048
374 Ga0496112_0044236 3300048915 Bacteria 4363
375 Ga0496112_0199872 3300048915 Bacteria 1959
376 Ga0496112_0398380 3300048915 Bacteria 1316
377 Ga0496113_0130974 3300048916 Bacteria 1968
378 Ga0496114_0424581 3300048917 Bacteria 1178
379 Ga0496115_0064231 3300048918 Bacteria 2963
380 Ga0496115_0241991 3300048918 Bacteria 1487
381 Ga0496115_0435646 3300048918 Bacteria 1060
382 Ga0496116_0030517 3300048919 Bacteria 3871
383 Ga0496117_0127773 3300048920 Bacteria 1548
384 Ga0496117_0248424 3300048920 Bacteria 972
385 Ga0496118_0091999 3300048921 Bacteria 2083
386 Ga0496118_0143848 3300048921 Bacteria 1506
387 Ga0496118_0515665 3300048921 Bacteria 591
388 Ga0496119_0007812 3300048922 Bacteria 9538
389 Ga0496119_0093996 3300048922 Bacteria 1697
390 Ga0496119_0149454 3300048922 Bacteria 1253
391 Ga0496119_0286946 3300048922 Bacteria 816
392 Ga0496120_0018530 3300048923 Bacteria 4482
393 Ga0496120_0026275 3300048923 Bacteria 3597
394 Ga0496120_0249533 3300048923 Bacteria 834
395 Ga0496121_0025652 3300048924 Bacteria 5586
396 Ga0496121_0050471 3300048924 Bacteria 3514
397 Ga0496121_0093929 3300048924 Bacteria 2334
398 Ga0496121_0102574 3300048924 Bacteria 2204
399 Ga0496121_0164697 3300048924 Bacteria 1617
400 Ga0496122_0076008 3300048925 Bacteria 2366
401 Ga0496123_0265666 3300048926 Bacteria 838
402 Ga0496124_0652632 3300048927 Bacteria 675
403 Ga0496124_0708123 3300048927 Bacteria 637
404 Ga0496126_0020375 3300048929 Bacteria 6503
405 Ga0496126_0064043 3300048929 Bacteria 3294
406 Ga0496126_0146095 3300048929 Bacteria 2031
407 Ga0496126_0170003 3300048929 Bacteria 1857
408 Ga0496126_0335223 3300048929 Bacteria 1240
409 Ga0496126_0527171 3300048929 Bacteria 940
410 Ga0496126_0971185 3300048929 Bacteria 639
411 Ga0495682_0037775 3300049460 Bacteria 1775
412 Ga0501031_0000186 3300049568 Bacteria 34900
413 Ga0501032_0005876 3300049569 Bacteria 9075
414 Ga0501033_0000098 3300049570 Bacteria 82803
415 Ga0501034_0001197 3300049571 Bacteria 35694
416 Ga0501036_0001134 3300049572 Bacteria 20288
417 Ga0501037_0000069 3300049573 Bacteria 95277
418 Ga0501038_0000034 3300049574 Bacteria 128854
419 Ga0501039_0000580 3300049575 Bacteria 26450
420 Ga0501040_0845500 3300049576 Bacteria 662
421 Ga0501043_0000130 3300049579 Bacteria 69795
422 Ga0501046_0001236 3300049580 Bacteria 24723
423 Ga0501046_0348229 3300049580 Bacteria 1076
424 Ga0501047_0000758 3300049581 Bacteria 33713
425 Ga0501047_0015918 3300049581 Bacteria 7169
426 Ga0501048_0003629 3300049582 Bacteria 11751
427 Ga0501067_0000264 3300049583 Bacteria 28689
428 Ga0501068_0011959 3300049584 Bacteria 4909
429 Ga0501069_0226491 3300049585 Bacteria 1087
430 Ga0501070_0004609 3300049586 Bacteria 11823
431 Ga0501070_0057566 3300049586 Bacteria 3222
432 Ga0501072_0012220 3300049588 Bacteria 6562
433 Ga0501073_0000532 3300049589 Bacteria 26744
434 Ga0501073_0149406 3300049589 Bacteria 1619
435 Ga0501074_0007521 3300049590 Bacteria 7882
436 Ga0501074_0261928 3300049590 Bacteria 1229
437 Ga0501080_0014171 3300049742 Bacteria 7337
438 Ga0501080_0063737 3300049742 Bacteria 3429
439 Ga0501083_0000590 3300049744 Bacteria 23293
440 Ga0501035_0000970 3300049822 Bacteria 30303
441 Ga0501044_0000725 3300049823 Bacteria 39776
442 Ga0501044_0291804 3300049823 Bacteria 1562
443 Ga0501045_0019911 3300049824 Bacteria 4790
444 nmdc:mga03n38_161337_c1 3300050490 Bacteria 1135
445 nmdc:mga0yw44_277519_c1 3300050492 Bacteria 1120
446 nmdc:mga0yw44_787742_c1 3300050492 Bacteria 646
447 nmdc:mga0k408_12565_c1 3300050493 Bacteria 4630
448 nmdc:mga04h51_14323_c1 3300050495 Bacteria 2264
449 nmdc:mga07m45_11206_c3 3300050496 Bacteria 3489
450 nmdc:mga0sz30_118505_c1 3300050516 Bacteria 1163
451 nmdc:mga0sz30_261463_c1 3300050516 Bacteria 771
452 Ga0495601_0022095 3300053077 Bacteria 3904
453 Ga0495655_0029333 3300053083 Bacteria 1322
454 Ga0495595_0001005 3300053084 Bacteria 10865
455 Ga0495619_0002499 3300053085 Bacteria 12040
456 Ga0495619_0029659 3300053085 Bacteria 3536
457 Ga0495619_0501036 3300053085 Bacteria 835
458 Ga0500578_0144737 3300053086 Bacteria 1484
459 Ga0500578_0164443 3300053086 Bacteria 1375
460 Ga0500643_000116 3300053087 Bacteria 83687
461 Ga0500583_0004980 3300053092 Bacteria 4400
462 Ga0500583_0178908 3300053092 Bacteria 1056
463 Ga0500651_0000920 3300053093 Bacteria 14408
464 Ga0500651_0079623 3300053093 Bacteria 2030
465 Ga0500651_0126122 3300053093 Bacteria 1551
466 Ga0500566_0000821 3300053094 Bacteria 17707
467 Ga0500566_0096776 3300053094 Bacteria 1624
468 Ga0500641_0058496 3300053096 Bacteria 1601
469 Ga0500650_0088526 3300053098 Bacteria 1449
470 Ga0500554_020223 3300053102 Bacteria 1827
471 Ga0500556_0007469 3300053104 Bacteria 3127
472 Ga0500562_006138 3300053108 Bacteria 3028
473 Ga0500569_007442 3300053109 Bacteria 2458
474 Ga0500572_009426 3300053111 Bacteria 2307
475 Ga0500592_041617 3300053116 Bacteria 744
476 Ga0500595_001014 3300053119 Bacteria 15754
477 Ga0500595_001340 3300053119 Bacteria 13316
478 Ga0500595_003474 3300053119 Bacteria 7332
479 Ga0500595_005248 3300053119 Bacteria 5677
480 Ga0500595_037375 3300053119 Bacteria 1584
481 Ga0500608_197133 3300053122 Bacteria 836
482 Ga0500642_0008376 3300053130 Bacteria 3536
483 Ga0500652_063282 3300053131 Bacteria 1526
484 Ga0500559_0161975 3300053136 Bacteria 1051
485 Ga0500559_0176451 3300053136 Bacteria 1005
486 Ga0500559_0241590 3300053136 Bacteria 851
487 Ga0500568_0014289 3300053139 Bacteria 3590
488 Ga0500577_0019644 3300053142 Bacteria 2195
489 Ga0500590_155681 3300053148 Bacteria 1025
490 Ga0500604_0220932 3300053151 Bacteria 653
491 Ga0500616_0049861 3300053153 Bacteria 2213
492 Ga0500620_003920 3300053155 Bacteria 3250
493 Ga0500622_0051671 3300053156 Bacteria 2115
494 Ga0500622_0097986 3300053156 Bacteria 1447
495 Ga0500627_0011187 3300053158 Bacteria 3302
496 Ga0500627_0115693 3300053158 Bacteria 1208
497 Ga0500633_0093613 3300053160 Bacteria 1100
498 Ga0500634_0071061 3300053161 Bacteria 1821
499 Ga0500638_002337 3300053162 Bacteria 6552
500 Ga0500638_276424 3300053162 Bacteria 661
501 Ga0500636_0000207 3300053177 Bacteria 31845
502 Ga0500636_0019821 3300053177 Bacteria 3977
503 Ga0500637_0000077 3300053178 Bacteria 35359
504 Ga0500637_0470497 3300053178 Bacteria 632
505 Ga0500645_011128 3300053730 Bacteria 2949
506 Ga0500645_143381 3300053730 Bacteria 660
507 Ga0500609_002330 3300053731 Bacteria 2710
508 Ga0500552_074627 3300053733 Bacteria 614
509 Ga0500599_007068 3300053736 Bacteria 1439
510 Ga0500601_000322 3300053737 Bacteria 8816
511 Ga0501084_0007469 3300054114 Bacteria 9011
512 Ga0500661_000100 3300055283 Bacteria 13873
513 Ga0501082_0011999 3300060353 Bacteria 7451
514 Ga0466962_0302393 3300061719 Bacteria 791

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0268000 Ga0495583_0268000_13_441 142
2 3300046460 Ga0495638_0469155 Ga0495638_0469155_50_577 146
3 3300025901 Ga0207688_10122945 Ga0207688_101229452 150
4 3300005436 Ga0070713_100740724 Ga0070713_1007407242 151
5 3300006028 Ga0070717_10430299 Ga0070717_104302992 151
6 3300021384 Ga0213876_10124548 Ga0213876_101245483 151
7 3300025928 Ga0207700_10627712 Ga0207700_106277122 151
8 3300025929 Ga0207664_10108916 Ga0207664_101089163 151
9 3300039450 Ga0436363_1057105 Ga0436363_1057105_330_854 151
10 3300035083 Ga0373926_0042807 Ga0373926_0042807_524_1048 152
11 3300035111 Ga0373923_0004358 Ga0373923_0004358_3618_4142 152
12 3300035170 Ga0373943_0124126 Ga0373943_0124126_566_1090 152
13 3300035171 Ga0373946_0161618 Ga0373946_0161618_357_881 152
14 3300035172 Ga0373955_0053855 Ga0373955_0053855_340_864 152
15 3300035410 Ga0373924_0031720 Ga0373924_0031720_1506_2030 152
16 3300035695 Ga0373927_0081394 Ga0373927_0081394_827_1351 152
17 3300035724 Ga0373933_0070357 Ga0373933_0070357_12_512 152
18 3300035725 Ga0373947_0011086 Ga0373947_0011086_4258_4782 152
19 3300036401 Ga0373937_0328561 Ga0373937_0328561_796_1320 152
20 3300037068 Ga0373925_0456722 Ga0373925_0456722_217_741 152
21 3300046459 Ga0495629_0188724 Ga0495629_0188724_458_982 152
22 3300046463 Ga0495653_0594349 Ga0495653_0594349_30_554 152
23 3300046472 Ga0495580_0024700 Ga0495580_0024700_186_710 152
24 3300046475 Ga0495639_0193926 Ga0495639_0193926_277_801 152
25 3300046476 Ga0495662_0270520 Ga0495662_0270520_114_638 152
26 3300046477 Ga0495664_0017824 Ga0495664_0017824_285_809 152
27 3300046516 Ga0495628_0590074 Ga0495628_0590074_39_563 152
28 3300046529 Ga0495652_0117140 Ga0495652_0117140_266_790 152
29 3300046531 Ga0495665_0014870 Ga0495665_0014870_3238_3762 152
30 3300046533 Ga0495640_0020568 Ga0495640_0020568_3986_4510 152
31 3300046536 Ga0495587_0358917 Ga0495587_0358917_26_550 152
32 3300046559 Ga0495667_0102706 Ga0495667_0102706_150_674 152
33 3300046642 Ga0495634_0072683 Ga0495634_0072683_1651_2175 152
34 3300046678 Ga0495599_0069521 Ga0495599_0069521_1254_1778 152
35 3300046679 Ga0495623_0634910 Ga0495623_0634910_10_534 152
36 3300046681 Ga0495647_0009264 Ga0495647_0009264_2163_2687 152
37 3300047319 Ga0495674_0017832 Ga0495674_0017832_5782_6306 152
38 3300047673 Ga0495593_0374657 Ga0495593_0374657_73_597 152
39 3300006028 Ga0070717_10020204 Ga0070717_100202045 154
40 3300046526 Ga0495666_0033825 Ga0495666_0033825_1995_2471 155
41 3300046452 Ga0495617_037713 Ga0495617_037713_420_944 156
42 3300005466 Ga0070685_10619924 Ga0070685_106199241 160
43 3300026121 Ga0207683_10078508 Ga0207683_100785083 160
44 3300046694 Ga0495649_0379236 Ga0495649_0379236_149_673 160
45 3300014325 Ga0163163_10259460 Ga0163163_102594603 161
46 3300014968 Ga0157379_10235908 Ga0157379_102359082 161
47 3300025315 Ga0207697_10131838 Ga0207697_101318381 161
48 3300025937 Ga0207669_10225490 Ga0207669_102254902 161
49 3300048917 Ga0496114_0424581 Ga0496114_0424581_242_766 161
50 3300006177 Ga0075362_10111203 Ga0075362_101112031 162
51 3300046537 Ga0495598_0081022 Ga0495598_0081022_323_850 162
52 3300046615 Ga0495656_0145982 Ga0495656_0145982_56_583 162
53 3300046684 Ga0495669_0457170 Ga0495669_0457170_28_555 162
54 3300046691 Ga0495670_0066769 Ga0495670_0066769_409_936 162
55 3300048929 Ga0496126_0020375 Ga0496126_0020375_2543_3082 163
56 3300006175 Ga0070712_100473653 Ga0070712_1004736532 164
57 3300009093 Ga0105240_10153056 Ga0105240_101530564 164
58 3300013104 Ga0157370_10180463 Ga0157370_101804631 164
59 3300013105 Ga0157369_10005972 Ga0157369_1000597215 164
60 3300025915 Ga0207693_10257709 Ga0207693_102577093 164
61 3300028800 Ga0265338_10385541 Ga0265338_103855411 164
62 3300031241 Ga0265325_10122250 Ga0265325_101222502 164
63 3300031247 Ga0265340_10109163 Ga0265340_101091632 164
64 3300031344 Ga0265316_10105909 Ga0265316_101059093 164
65 3300035086 Ga0373934_0015387 Ga0373934_0015387_1810_2457 164
66 3300035111 Ga0373923_0020014 Ga0373923_0020014_1311_1958 164
67 3300035117 Ga0373953_0007080 Ga0373953_0007080_3071_3718 164
68 3300035118 Ga0373954_0030489 Ga0373954_0030489_334_981 164
69 3300035119 Ga0373956_0005761 Ga0373956_0005761_1753_2400 164
70 3300035120 Ga0373957_0003039 Ga0373957_0003039_1312_1959 164
71 3300035172 Ga0373955_0000352 Ga0373955_0000352_16676_17323 164
72 3300035410 Ga0373924_0000523 Ga0373924_0000523_113_742 164
73 3300035724 Ga0373933_0002766 Ga0373933_0002766_5602_6249 164
74 3300036401 Ga0373937_0008910 Ga0373937_0008910_7367_8014 164
75 3300044765 Ga0466970_0099957 Ga0466970_0099957_425_949 164
76 3300044842 Ga0466957_0045107 Ga0466957_0045107_1329_1853 164
77 3300045049 Ga0466959_0037437 Ga0466959_0037437_2470_2994 164
78 3300045836 Ga0466958_0112497 Ga0466958_0112497_851_1375 164
79 3300046454 Ga0495592_0003207 Ga0495592_0003207_6421_7068 164
80 3300046459 Ga0495629_0001343 Ga0495629_0001343_13227_13874 164
81 3300046462 Ga0495651_0033516 Ga0495651_0033516_1853_2500 164
82 3300046463 Ga0495653_0000212 Ga0495653_0000212_5106_5753 164
83 3300046511 Ga0495608_0014735 Ga0495608_0014735_995_1642 164
84 3300046516 Ga0495628_0007748 Ga0495628_0007748_2988_3635 164
85 3300046529 Ga0495652_0008265 Ga0495652_0008265_3188_3835 164
86 3300046533 Ga0495640_0005046 Ga0495640_0005046_9260_9907 164
87 3300046543 Ga0495645_0033851 Ga0495645_0033851_447_1094 164
88 3300046559 Ga0495667_0001112 Ga0495667_0001112_1506_2153 164
89 3300046663 Ga0495635_0000230 Ga0495635_0000230_10263_10910 164
90 3300046675 Ga0495657_0016784 Ga0495657_0016784_1184_1831 164
91 3300046678 Ga0495599_0000807 Ga0495599_0000807_11638_12285 164
92 3300046680 Ga0495646_0063995 Ga0495646_0063995_1508_2155 164
93 3300046689 Ga0495613_0387785 Ga0495613_0387785_124_753 164
94 3300046809 Ga0495600_0001064 Ga0495600_0001064_3494_4141 164
95 3300047317 Ga0495604_0011802 Ga0495604_0011802_1184_1831 164
96 3300047319 Ga0495674_0009234 Ga0495674_0009234_5076_5723 164
97 3300047322 Ga0495680_0001284 Ga0495680_0001284_1506_2153 164
98 3300047444 Ga0495675_0056589 Ga0495675_0056589_334_981 164
99 3300047471 Ga0495684_0000780 Ga0495684_0000780_1934_2581 164
100 3300047673 Ga0495593_0010013 Ga0495593_0010013_3322_3969 164
101 3300053077 Ga0495601_0022095 Ga0495601_0022095_809_1456 164
102 3300053084 Ga0495595_0001005 Ga0495595_0001005_6497_7144 164
103 3300053085 Ga0495619_0002499 Ga0495619_0002499_10948_11595 164
104 3300061719 Ga0466962_0302393 Ga0466962_0302393_222_746 164
105 3300005539 Ga0068853_100967380 Ga0068853_1009673801 165
106 3300005563 Ga0068855_100657564 Ga0068855_1006575642 165
107 3300013307 Ga0157372_10185231 Ga0157372_101852316 165
108 3300025913 Ga0207695_10220511 Ga0207695_102205113 165
109 3300026041 Ga0207639_10243516 Ga0207639_102435161 165
110 3300037418 Ga0395900_0012630 Ga0395900_0012630_2977_3501 165
111 3300037466 Ga0395898_0039217 Ga0395898_0039217_1613_2137 165
112 3300048910 Ga0496107_0658580 Ga0496107_0658580_216_749 165
113 3300005338 Ga0068868_100998243 Ga0068868_1009982431 167
114 3300005347 Ga0070668_100428482 Ga0070668_1004284822 167
115 3300005354 Ga0070675_100226787 Ga0070675_1002267873 167
116 3300005548 Ga0070665_100144836 Ga0070665_1001448363 167
117 3300005564 Ga0070664_100616868 Ga0070664_1006168682 167
118 3300005617 Ga0068859_100224943 Ga0068859_1002249433 167
119 3300005841 Ga0068863_102245725 Ga0068863_1022457251 167
120 3300005842 Ga0068858_100154566 Ga0068858_1001545663 167
121 3300005843 Ga0068860_100862141 Ga0068860_1008621412 167
122 3300006931 Ga0097620_100224942 Ga0097620_1002249423 167
123 3300009101 Ga0105247_10137489 Ga0105247_101374892 167
124 3300009177 Ga0105248_10775796 Ga0105248_107757961 167
125 3300013308 Ga0157375_10279496 Ga0157375_102794962 167
126 3300014745 Ga0157377_10497228 Ga0157377_104972282 167
127 3300025925 Ga0207650_10138421 Ga0207650_101384213 167
128 3300025926 Ga0207659_10476852 Ga0207659_104768522 167
129 3300025941 Ga0207711_10845387 Ga0207711_108453872 167
130 3300025960 Ga0207651_10514851 Ga0207651_105148512 167
131 3300025972 Ga0207668_10521461 Ga0207668_105214611 167
132 3300025986 Ga0207658_10396621 Ga0207658_103966212 167
133 3300026067 Ga0207678_10178299 Ga0207678_101782992 167
134 3300026118 Ga0207675_100579471 Ga0207675_1005794713 167
135 3300028379 Ga0268266_10239305 Ga0268266_102393053 167
136 3300028380 Ga0268265_10354808 Ga0268265_103548082 167
137 3300035113 Ga0373936_0030840 Ga0373936_0030840_1456_1977 167
138 3300035170 Ga0373943_0014337 Ga0373943_0014337_1699_2220 167
139 3300035171 Ga0373946_0004813 Ga0373946_0004813_1263_1784 167
140 3300035242 Ga0373962_0072821 Ga0373962_0072821_205_729 167
141 3300035695 Ga0373927_0000432 Ga0373927_0000432_21767_22288 167
142 3300046454 Ga0495592_0026570 Ga0495592_0026570_3084_3605 167
143 3300046455 Ga0495603_0000067 Ga0495603_0000067_21827_22348 167
144 3300046459 Ga0495629_0003475 Ga0495629_0003475_3333_3854 167
145 3300046460 Ga0495638_0083169 Ga0495638_0083169_461_985 167
146 3300046471 Ga0495650_0062817 Ga0495650_0062817_88_612 167
147 3300046472 Ga0495580_0002382 Ga0495580_0002382_10639_11160 167
148 3300046473 Ga0495582_0000049 Ga0495582_0000049_54455_54976 167
149 3300046475 Ga0495639_0000106 Ga0495639_0000106_36086_36607 167
150 3300046476 Ga0495662_0000276 Ga0495662_0000276_5004_5525 167
151 3300046477 Ga0495664_0180986 Ga0495664_0180986_742_1263 167
152 3300046499 Ga0495594_0001204 Ga0495594_0001204_11165_11686 167
153 3300046516 Ga0495628_0105386 Ga0495628_0105386_353_874 167
154 3300046517 Ga0495630_0177159 Ga0495630_0177159_1050_1571 167
155 3300046519 Ga0495632_0045378 Ga0495632_0045378_47_571 167
156 3300046524 Ga0495648_0293600 Ga0495648_0293600_192_716 167
157 3300046529 Ga0495652_0092591 Ga0495652_0092591_1508_2029 167
158 3300046531 Ga0495665_0000307 Ga0495665_0000307_22080_22601 167
159 3300046533 Ga0495640_0006166 Ga0495640_0006166_8700_9221 167
160 3300046557 Ga0495622_0026769 Ga0495622_0026769_991_1512 167
161 3300046642 Ga0495634_0000267 Ga0495634_0000267_3111_3632 167
162 3300046663 Ga0495635_0004002 Ga0495635_0004002_4485_5006 167
163 3300046674 Ga0495588_0020296 Ga0495588_0020296_1458_1979 167
164 3300046678 Ga0495599_0331094 Ga0495599_0331094_45_566 167
165 3300046680 Ga0495646_0309798 Ga0495646_0309798_208_729 167
166 3300046681 Ga0495647_0001002 Ga0495647_0001002_371_892 167
167 3300046683 Ga0495658_0023717 Ga0495658_0023717_1134_1655 167
168 3300046689 Ga0495613_0003663 Ga0495613_0003663_4887_5408 167
169 3300046690 Ga0495624_0001957 Ga0495624_0001957_15021_15542 167
170 3300046809 Ga0495600_0109318 Ga0495600_0109318_788_1309 167
171 3300047315 Ga0495581_0000022 Ga0495581_0000022_21798_22319 167
172 3300047317 Ga0495604_0071571 Ga0495604_0071571_1292_1813 167
173 3300047319 Ga0495674_0000629 Ga0495674_0000629_31259_31780 167
174 3300047321 Ga0495676_0026326 Ga0495676_0026326_3172_3693 167
175 3300047469 Ga0495673_0165793 Ga0495673_0165793_213_737 167
176 3300047673 Ga0495593_0000016 Ga0495593_0000016_57027_57548 167
177 3300048088 Ga0495602_0395223 Ga0495602_0395223_263_784 167
178 3300048089 Ga0495614_0076996 Ga0495614_0076996_558_1079 167
179 3300048909 Ga0496106_1042573 Ga0496106_1042573_89_613 167
180 3300048911 Ga0496108_0259768 Ga0496108_0259768_48_572 167
181 3300048915 Ga0496112_0199872 Ga0496112_0199872_277_801 167
182 3300048924 Ga0496121_0164697 Ga0496121_0164697_1029_1553 167
183 3300048927 Ga0496124_0652632 Ga0496124_0652632_114_638 167
184 3300048929 Ga0496126_0335223 Ga0496126_0335223_133_657 167
185 iso_pu_bacteria 2879099564 2879108180 167
186 iso_pu_bacteria 2932818245 2932820758 167
187 iso_pu_bacteria 2935616580 2935621832 167
188 iso_pu_bacteria 2935694250 2935695981 167
189 iso_pu_bacteria 2935703347 2935706720 167
190 iso_pu_bacteria 2935760218 2935763154 167
191 iso_pu_bacteria 2935855204 2935860079 167
192 iso_pu_bacteria 2935864058 2935869286 167
193 iso_pu_bacteria 2935873716 2935880553 167
194 iso_pu_bacteria 2935992306 2935996279 167
195 iso_pu_bacteria 2936002035 2936006413 167
196 iso_pu_bacteria 8019576017 8019581929 167
197 iso_pu_bacteria 8019586578 8019589609 167
198 iso_pu_bacteria 8019597564 8019601659 167
199 iso_pu_bacteria 8019608314 8019616890 167
200 3300005334 Ga0068869_100149478 Ga0068869_1001494783 168
201 3300005546 Ga0070696_100074055 Ga0070696_1000740553 168
202 3300005615 Ga0070702_100348159 Ga0070702_1003481591 168
203 3300009545 Ga0105237_10601188 Ga0105237_106011882 168
204 3300028573 Ga0265334_10139435 Ga0265334_101394351 168
205 3300025254 Ga0209148_1000258 Ga0209148_100025837 169
206 3300025261 Ga0209233_1003783 Ga0209233_10037837 169
207 3300025261 Ga0209233_1008098 Ga0209233_10080983 169
208 3300025272 Ga0209455_1004545 Ga0209455_10045456 169
209 3300025272 Ga0209455_1007471 Ga0209455_10074715 169
210 3300025321 Ga0207656_10395183 Ga0207656_103951831 169
211 3300031711 Ga0265314_10024131 Ga0265314_100241312 169
212 3300031712 Ga0265342_10120996 Ga0265342_101209964 169
213 3300037853 Ga0436364_0424493 Ga0436364_0424493_1045_1563 169
214 3300046524 Ga0495648_0115269 Ga0495648_0115269_496_1005 169
215 3300047472 Ga0495686_0257078 Ga0495686_0257078_15_524 169
216 3300048922 Ga0496119_0149454 Ga0496119_0149454_314_841 169
217 3300048924 Ga0496121_0050471 Ga0496121_0050471_2516_3043 169
218 3300048929 Ga0496126_0064043 Ga0496126_0064043_324_851 169
219 3300048929 Ga0496126_0170003 Ga0496126_0170003_66_593 169
220 3300053119 Ga0500595_001014 Ga0500595_001014_10495_11022 169
221 3300005445 Ga0070708_100433906 Ga0070708_1004339062 170
222 3300005468 Ga0070707_100324803 Ga0070707_1003248032 170
223 3300005471 Ga0070698_100085336 Ga0070698_1000853361 170
224 3300005536 Ga0070697_100213085 Ga0070697_1002130852 170
225 3300005983 Ga0081540_1006213 Ga0081540_10062138 170
226 3300013102 Ga0157371_10309862 Ga0157371_103098622 170
227 3300013104 Ga0157370_10211757 Ga0157370_102117573 170
228 3300021388 Ga0213875_10198375 Ga0213875_101983751 170
229 3300025254 Ga0209148_1047697 Ga0209148_10476971 170
230 3300025949 Ga0207667_10763277 Ga0207667_107632772 170
231 3300037853 Ga0436364_0767258 Ga0436364_0767258_377_898 170
232 3300046530 Ga0495654_0204137 Ga0495654_0204137_258_788 170
233 3300048909 Ga0496106_0014425 Ga0496106_0014425_2413_3027 170
234 3300048910 Ga0496107_0012037 Ga0496107_0012037_2954_3568 170
235 3300048911 Ga0496108_0091518 Ga0496108_0091518_282_896 170
236 3300048912 Ga0496109_0018354 Ga0496109_0018354_3107_3721 170
237 3300048913 Ga0496110_0027198 Ga0496110_0027198_1226_1840 170
238 3300048914 Ga0496111_0108112 Ga0496111_0108112_478_1092 170
239 3300048915 Ga0496112_0044236 Ga0496112_0044236_3134_3748 170
240 3300048916 Ga0496113_0130974 Ga0496113_0130974_873_1487 170
241 3300048918 Ga0496115_0241991 Ga0496115_0241991_761_1375 170
242 3300048921 Ga0496118_0143848 Ga0496118_0143848_772_1302 170
243 3300049568 Ga0501031_0000186 Ga0501031_0000186_468_989 170
244 3300049569 Ga0501032_0005876 Ga0501032_0005876_4064_4585 170
245 3300049570 Ga0501033_0000098 Ga0501033_0000098_68996_69517 170
246 3300049571 Ga0501034_0001197 Ga0501034_0001197_11665_12186 170
247 3300049572 Ga0501036_0001134 Ga0501036_0001134_15026_15547 170
248 3300049573 Ga0501037_0000069 Ga0501037_0000069_73982_74503 170
249 3300049574 Ga0501038_0000034 Ga0501038_0000034_110622_111143 170
250 3300049575 Ga0501039_0000580 Ga0501039_0000580_4218_4739 170
251 3300049576 Ga0501040_0845500 Ga0501040_0845500_56_577 170
252 3300049579 Ga0501043_0000130 Ga0501043_0000130_61803_62324 170
253 3300049580 Ga0501046_0001236 Ga0501046_0001236_2008_2529 170
254 3300049581 Ga0501047_0000758 Ga0501047_0000758_10980_11501 170
255 3300049582 Ga0501048_0003629 Ga0501048_0003629_4564_5085 170
256 3300049583 Ga0501067_0000264 Ga0501067_0000264_26954_27475 170
257 3300049584 Ga0501068_0011959 Ga0501068_0011959_2817_3338 170
258 3300049585 Ga0501069_0226491 Ga0501069_0226491_25_546 170
259 3300049586 Ga0501070_0004609 Ga0501070_0004609_9581_10102 170
260 3300049588 Ga0501072_0012220 Ga0501072_0012220_4659_5180 170
261 3300049589 Ga0501073_0000532 Ga0501073_0000532_20786_21307 170
262 3300049590 Ga0501074_0007521 Ga0501074_0007521_1199_1720 170
263 3300049742 Ga0501080_0014171 Ga0501080_0014171_2490_3011 170
264 3300049744 Ga0501083_0000590 Ga0501083_0000590_16344_16865 170
265 3300049822 Ga0501035_0000970 Ga0501035_0000970_12225_12746 170
266 3300049823 Ga0501044_0000725 Ga0501044_0000725_21677_22198 170
267 3300049824 Ga0501045_0019911 Ga0501045_0019911_4203_4724 170
268 3300053092 Ga0500583_0178908 Ga0500583_0178908_366_896 170
269 3300053093 Ga0500651_0000920 Ga0500651_0000920_5730_6260 170
270 3300053096 Ga0500641_0058496 Ga0500641_0058496_171_701 170
271 3300053116 Ga0500592_041617 Ga0500592_041617_70_600 170
272 3300053119 Ga0500595_005248 Ga0500595_005248_2488_3018 170
273 3300053119 Ga0500595_037375 Ga0500595_037375_214_744 170
274 3300053130 Ga0500642_0008376 Ga0500642_0008376_1105_1635 170
275 3300053151 Ga0500604_0220932 Ga0500604_0220932_92_622 170
276 3300053156 Ga0500622_0051671 Ga0500622_0051671_1529_2059 170
277 3300053158 Ga0500627_0115693 Ga0500627_0115693_488_1018 170
278 3300053177 Ga0500636_0019821 Ga0500636_0019821_1942_2472 170
279 3300054114 Ga0501084_0007469 Ga0501084_0007469_7063_7584 170
280 3300060353 Ga0501082_0011999 Ga0501082_0011999_768_1289 170
281 3300003215 JGI25153J46596_10023618 JGI25153J46596_100236182 171
282 3300003215 JGI25153J46596_10025855 JGI25153J46596_100258553 171
283 3300003322 rootL2_10097589 rootL2_100975892 171
284 3300003323 rootH1_10027936 rootH1_100279365 171
285 3300005262 Ga0065165_1009387 Ga0065165_10093874 171
286 3300005262 Ga0065165_1047408 Ga0065165_10474083 171
287 3300005331 Ga0070670_100209930 Ga0070670_1002099304 171
288 3300005335 Ga0070666_10069776 Ga0070666_100697765 171
289 3300005336 Ga0070680_100430953 Ga0070680_1004309531 171
290 3300005338 Ga0068868_100358053 Ga0068868_1003580531 171
291 3300005347 Ga0070668_100040420 Ga0070668_1000404204 171
292 3300005347 Ga0070668_100639909 Ga0070668_1006399092 171
293 3300005355 Ga0070671_100249779 Ga0070671_1002497794 171
294 3300005367 Ga0070667_100507490 Ga0070667_1005074902 171
295 3300005367 Ga0070667_100574971 Ga0070667_1005749712 171
296 3300005434 Ga0070709_10568020 Ga0070709_105680201 171
297 3300005455 Ga0070663_100091642 Ga0070663_1000916423 171
298 3300005457 Ga0070662_100158312 Ga0070662_1001583123 171
299 3300005530 Ga0070679_100739886 Ga0070679_1007398862 171
300 3300005539 Ga0068853_100348531 Ga0068853_1003485313 171
301 3300005546 Ga0070696_100507653 Ga0070696_1005076532 171
302 3300005547 Ga0070693_100739646 Ga0070693_1007396461 171
303 3300005548 Ga0070665_100070981 Ga0070665_1000709814 171
304 3300005548 Ga0070665_100635498 Ga0070665_1006354981 171
305 3300005548 Ga0070665_100786374 Ga0070665_1007863742 171
306 3300005563 Ga0068855_101455801 Ga0068855_1014558011 171
307 3300005577 Ga0068857_100110928 Ga0068857_1001109283 171
308 3300005578 Ga0068854_100242225 Ga0068854_1002422252 171
309 3300005614 Ga0068856_100000919 Ga0068856_10000091935 171
310 3300005616 Ga0068852_101287002 Ga0068852_1012870022 171
311 3300005841 Ga0068863_100810650 Ga0068863_1008106502 171
312 3300005844 Ga0068862_101367870 Ga0068862_1013678701 171
313 3300005983 Ga0081540_1014958 Ga0081540_10149583 171
314 3300006038 Ga0075365_10047264 Ga0075365_100472644 171
315 3300006042 Ga0075368_10003302 Ga0075368_100033027 171
316 3300006042 Ga0075368_10009924 Ga0075368_100099246 171
317 3300006048 Ga0075363_100056159 Ga0075363_1000561593 171
318 3300006051 Ga0075364_10019540 Ga0075364_100195404 171
319 3300006178 Ga0075367_10040446 Ga0075367_100404464 171
320 3300006186 Ga0075369_10021722 Ga0075369_100217225 171
321 3300006186 Ga0075369_10265439 Ga0075369_102654392 171
322 3300006353 Ga0075370_10068087 Ga0075370_100680872 171
323 3300006358 Ga0068871_100079454 Ga0068871_1000794545 171
324 3300006881 Ga0068865_100166388 Ga0068865_1001663883 171
325 3300009093 Ga0105240_10172526 Ga0105240_101725262 171
326 3300009093 Ga0105240_10775999 Ga0105240_107759991 171
327 3300009093 Ga0105240_11160997 Ga0105240_111609972 171
328 3300009101 Ga0105247_10038756 Ga0105247_100387563 171
329 3300009101 Ga0105247_10215034 Ga0105247_102150342 171
330 3300009177 Ga0105248_10565739 Ga0105248_105657392 171
331 3300009545 Ga0105237_10053970 Ga0105237_100539703 171
332 3300009545 Ga0105237_10121328 Ga0105237_101213284 171
333 3300009545 Ga0105237_11455634 Ga0105237_114556341 171
334 3300009551 Ga0105238_10333454 Ga0105238_103334542 171
335 3300009551 Ga0105238_10479829 Ga0105238_104798292 171
336 3300009553 Ga0105249_10344315 Ga0105249_103443152 171
337 3300010375 Ga0105239_10156417 Ga0105239_101564172 171
338 3300010375 Ga0105239_10754936 Ga0105239_107549361 171
339 3300010375 Ga0105239_10987239 Ga0105239_109872392 171
340 3300011119 Ga0105246_10012729 Ga0105246_100127297 171
341 3300013306 Ga0163162_11059044 Ga0163162_110590441 171
342 3300013308 Ga0157375_10248577 Ga0157375_102485771 171
343 3300014325 Ga0163163_10018720 Ga0163163_100187203 171
344 3300014325 Ga0163163_10153884 Ga0163163_101538844 171
345 3300014497 Ga0182008_10107029 Ga0182008_101070292 171
346 3300025230 Ga0209563_103371 Ga0209563_1033712 171
347 3300025253 Ga0209677_106255 Ga0209677_1062556 171
348 3300025272 Ga0209455_1031803 Ga0209455_10318032 171
349 3300025295 Ga0209564_1002963 Ga0209564_10029634 171
350 3300025297 Ga0209758_1000775 Ga0209758_100077528 171
351 3300025297 Ga0209758_1005565 Ga0209758_10055658 171
352 3300025299 Ga0209256_1056840 Ga0209256_10568402 171
353 3300025302 Ga0207426_1000661 Ga0207426_100066125 171
354 3300025304 Ga0209257_1010306 Ga0209257_10103067 171
355 3300025315 Ga0207697_10029821 Ga0207697_100298212 171
356 3300025906 Ga0207699_10185362 Ga0207699_101853623 171
357 3300025913 Ga0207695_10545112 Ga0207695_105451121 171
358 3300025914 Ga0207671_10165762 Ga0207671_101657622 171
359 3300025914 Ga0207671_10907025 Ga0207671_109070251 171
360 3300025917 Ga0207660_10381730 Ga0207660_103817302 171
361 3300025921 Ga0207652_10672795 Ga0207652_106727953 171
362 3300025924 Ga0207694_10224526 Ga0207694_102245262 171
363 3300025925 Ga0207650_10055612 Ga0207650_100556123 171
364 3300025931 Ga0207644_10333958 Ga0207644_103339582 171
365 3300025933 Ga0207706_10070933 Ga0207706_100709333 171
366 3300025938 Ga0207704_10523644 Ga0207704_105236442 171
367 3300025972 Ga0207668_10329701 Ga0207668_103297012 171
368 3300025981 Ga0207640_10289010 Ga0207640_102890102 171
369 3300025986 Ga0207658_10279774 Ga0207658_102797742 171
370 3300026023 Ga0207677_10177885 Ga0207677_101778852 171
371 3300026035 Ga0207703_10184668 Ga0207703_101846684 171
372 3300026041 Ga0207639_10270299 Ga0207639_102702993 171
373 3300026041 Ga0207639_10340693 Ga0207639_103406932 171
374 3300026067 Ga0207678_10042160 Ga0207678_100421604 171
375 3300026067 Ga0207678_10084749 Ga0207678_100847495 171
376 3300026078 Ga0207702_10000257 Ga0207702_1000025727 171
377 3300026078 Ga0207702_10716305 Ga0207702_107163052 171
378 3300026121 Ga0207683_10391437 Ga0207683_103914373 171
379 3300026142 Ga0207698_10833167 Ga0207698_108331671 171
380 3300027866 Ga0209813_10078767 Ga0209813_100787672 171
381 3300028379 Ga0268266_10572857 Ga0268266_105728571 171
382 3300028380 Ga0268265_10522862 Ga0268265_105228622 171
383 3300031235 Ga0265330_10026658 Ga0265330_100266584 171
384 3300031712 Ga0265342_10008945 Ga0265342_100089455 171
385 3300033180 Ga0307510_10011579 Ga0307510_100115795 171
386 3300036401 Ga0373937_0182000 Ga0373937_0182000_949_1464 171
387 3300037471 Ga0395905_0152558 Ga0395905_0152558_1483_1998 171
388 3300037471 Ga0395905_0261312 Ga0395905_0261312_1034_1549 171
389 3300044684 Ga0466966_0000600 Ga0466966_0000600_21622_22176 171
390 3300044693 Ga0466961_0000162 Ga0466961_0000162_20294_20848 171
391 3300045049 Ga0466959_0103596 Ga0466959_0103596_319_873 171
392 3300046460 Ga0495638_0019840 Ga0495638_0019840_1735_2250 171
393 3300046462 Ga0495651_0033028 Ga0495651_0033028_148_663 171
394 3300046463 Ga0495653_0086472 Ga0495653_0086472_894_1409 171
395 3300046474 Ga0495605_0136905 Ga0495605_0136905_289_804 171
396 3300046477 Ga0495664_0070837 Ga0495664_0070837_1390_1905 171
397 3300046500 Ga0495596_0208664 Ga0495596_0208664_21_536 171
398 3300046514 Ga0495618_0235523 Ga0495618_0235523_124_639 171
399 3300046517 Ga0495630_0264558 Ga0495630_0264558_52_567 171
400 3300046519 Ga0495632_0070631 Ga0495632_0070631_790_1305 171
401 3300046522 Ga0495643_0060232 Ga0495643_0060232_544_1059 171
402 3300046522 Ga0495643_0219778 Ga0495643_0219778_71_586 171
403 3300046524 Ga0495648_0095903 Ga0495648_0095903_365_880 171
404 3300046524 Ga0495648_0184406 Ga0495648_0184406_465_980 171
405 3300046533 Ga0495640_0038036 Ga0495640_0038036_2205_2720 171
406 3300046536 Ga0495587_0014477 Ga0495587_0014477_3750_4265 171
407 3300046557 Ga0495622_0123885 Ga0495622_0123885_463_978 171
408 3300046663 Ga0495635_0038800 Ga0495635_0038800_1103_1618 171
409 3300046675 Ga0495657_0024124 Ga0495657_0024124_3289_3804 171
410 3300046675 Ga0495657_0072863 Ga0495657_0072863_888_1403 171
411 3300046678 Ga0495599_0027325 Ga0495599_0027325_132_647 171
412 3300046679 Ga0495623_0010742 Ga0495623_0010742_2531_3046 171
413 3300046680 Ga0495646_0029561 Ga0495646_0029561_2273_2788 171
414 3300046680 Ga0495646_0435495 Ga0495646_0435495_115_630 171
415 3300046689 Ga0495613_0064321 Ga0495613_0064321_1271_1786 171
416 3300046692 Ga0495671_0166017 Ga0495671_0166017_253_768 171
417 3300046692 Ga0495671_0289360 Ga0495671_0289360_122_637 171
418 3300046694 Ga0495649_0323226 Ga0495649_0323226_101_616 171
419 3300046809 Ga0495600_0012503 Ga0495600_0012503_4197_4712 171
420 3300047315 Ga0495581_0127080 Ga0495581_0127080_908_1423 171
421 3300047317 Ga0495604_0011818 Ga0495604_0011818_2964_3479 171
422 3300047317 Ga0495604_0046272 Ga0495604_0046272_203_718 171
423 3300047321 Ga0495676_0211927 Ga0495676_0211927_743_1258 171
424 3300047322 Ga0495680_0039557 Ga0495680_0039557_938_1453 171
425 3300047323 Ga0495683_0354052 Ga0495683_0354052_22_537 171
426 3300047443 Ga0495687_111123 Ga0495687_111123_161_676 171
427 3300047444 Ga0495675_0008311 Ga0495675_0008311_3648_4163 171
428 3300047469 Ga0495673_0105851 Ga0495673_0105851_556_1071 171
429 3300047471 Ga0495684_0154898 Ga0495684_0154898_590_1105 171
430 3300047472 Ga0495686_0054318 Ga0495686_0054318_274_789 171
431 3300047472 Ga0495686_0395143 Ga0495686_0395143_177_713 171
432 3300048088 Ga0495602_0035202 Ga0495602_0035202_1900_2415 171
433 3300048088 Ga0495602_0335554 Ga0495602_0335554_322_837 171
434 3300048091 Ga0495626_0236976 Ga0495626_0236976_206_721 171
435 3300048903 Ga0496100_0121082 Ga0496100_0121082_1130_1645 171
436 3300048904 Ga0496101_0175126 Ga0496101_0175126_892_1407 171
437 3300048904 Ga0496101_0493564 Ga0496101_0493564_377_892 171
438 3300048905 Ga0496102_0059942 Ga0496102_0059942_131_766 171
439 3300048907 Ga0496104_0007051 Ga0496104_0007051_6699_7214 171
440 3300048907 Ga0496104_0290575 Ga0496104_0290575_160_675 171
441 3300048908 Ga0496105_0084340 Ga0496105_0084340_79_594 171
442 3300048909 Ga0496106_0066949 Ga0496106_0066949_1026_1541 171
443 3300048910 Ga0496107_0123826 Ga0496107_0123826_267_782 171
444 3300048911 Ga0496108_0153847 Ga0496108_0153847_67_582 171
445 3300048911 Ga0496108_0512894 Ga0496108_0512894_16_531 171
446 3300048915 Ga0496112_0398380 Ga0496112_0398380_742_1257 171
447 3300048918 Ga0496115_0064231 Ga0496115_0064231_842_1357 171
448 3300048918 Ga0496115_0435646 Ga0496115_0435646_267_782 171
449 3300048919 Ga0496116_0030517 Ga0496116_0030517_245_760 171
450 3300048920 Ga0496117_0127773 Ga0496117_0127773_873_1388 171
451 3300048920 Ga0496117_0248424 Ga0496117_0248424_375_890 171
452 3300048921 Ga0496118_0091999 Ga0496118_0091999_35_550 171
453 3300048921 Ga0496118_0515665 Ga0496118_0515665_28_543 171
454 3300048922 Ga0496119_0007812 Ga0496119_0007812_8978_9493 171
455 3300048922 Ga0496119_0093996 Ga0496119_0093996_215_730 171
456 3300048922 Ga0496119_0286946 Ga0496119_0286946_185_700 171
457 3300048923 Ga0496120_0018530 Ga0496120_0018530_606_1121 171
458 3300048923 Ga0496120_0026275 Ga0496120_0026275_2828_3343 171
459 3300048923 Ga0496120_0249533 Ga0496120_0249533_11_526 171
460 3300048924 Ga0496121_0025652 Ga0496121_0025652_3835_4350 171
461 3300048924 Ga0496121_0093929 Ga0496121_0093929_521_1036 171
462 3300048924 Ga0496121_0102574 Ga0496121_0102574_594_1130 171
463 3300048925 Ga0496122_0076008 Ga0496122_0076008_1577_2092 171
464 3300048926 Ga0496123_0265666 Ga0496123_0265666_39_674 171
465 3300048927 Ga0496124_0708123 Ga0496124_0708123_43_558 171
466 3300048929 Ga0496126_0146095 Ga0496126_0146095_459_983 171
467 3300048929 Ga0496126_0527171 Ga0496126_0527171_283_798 171
468 3300048929 Ga0496126_0971185 Ga0496126_0971185_110_625 171
469 3300049460 Ga0495682_0037775 Ga0495682_0037775_173_688 171
470 3300049580 Ga0501046_0348229 Ga0501046_0348229_522_1046 171
471 3300049581 Ga0501047_0015918 Ga0501047_0015918_2327_2938 171
472 3300049586 Ga0501070_0057566 Ga0501070_0057566_22_546 171
473 3300049589 Ga0501073_0149406 Ga0501073_0149406_763_1287 171
474 3300049590 Ga0501074_0261928 Ga0501074_0261928_121_732 171
475 3300049742 Ga0501080_0063737 Ga0501080_0063737_2807_3418 171
476 3300049823 Ga0501044_0291804 Ga0501044_0291804_538_1062 171
477 3300050490 nmdc:mga03n38_161337_c1 nmdc:mga03n38_161337_c1_308_844 171
478 3300050492 nmdc:mga0yw44_277519_c1 nmdc:mga0yw44_277519_c1_447_1082 171
479 3300050492 nmdc:mga0yw44_787742_c1 nmdc:mga0yw44_787742_c1_39_554 171
480 3300050493 nmdc:mga0k408_12565_c1 nmdc:mga0k408_12565_c1_1107_1694 171
481 3300050495 nmdc:mga04h51_14323_c1 nmdc:mga04h51_14323_c1_1393_1908 171
482 3300050496 nmdc:mga07m45_11206_c3 nmdc:mga07m45_11206_c3_1002_1517 171
483 3300050516 nmdc:mga0sz30_118505_c1 nmdc:mga0sz30_118505_c1_43_558 171
484 3300050516 nmdc:mga0sz30_261463_c1 nmdc:mga0sz30_261463_c1_171_686 171
485 3300053083 Ga0495655_0029333 Ga0495655_0029333_161_676 171
486 3300053085 Ga0495619_0029659 Ga0495619_0029659_175_690 171
487 3300053085 Ga0495619_0501036 Ga0495619_0501036_185_721 171
488 3300053086 Ga0500578_0144737 Ga0500578_0144737_418_933 171
489 3300053086 Ga0500578_0164443 Ga0500578_0164443_45_560 171
490 3300053087 Ga0500643_000116 Ga0500643_000116_54482_54997 171
491 3300053092 Ga0500583_0004980 Ga0500583_0004980_1601_2116 171
492 3300053093 Ga0500651_0079623 Ga0500651_0079623_1001_1516 171
493 3300053093 Ga0500651_0126122 Ga0500651_0126122_744_1259 171
494 3300053094 Ga0500566_0000821 Ga0500566_0000821_11612_12127 171
495 3300053094 Ga0500566_0096776 Ga0500566_0096776_73_588 171
496 3300053098 Ga0500650_0088526 Ga0500650_0088526_344_859 171
497 3300053102 Ga0500554_020223 Ga0500554_020223_68_601 171
498 3300053104 Ga0500556_0007469 Ga0500556_0007469_395_910 171
499 3300053108 Ga0500562_006138 Ga0500562_006138_11_526 171
500 3300053109 Ga0500569_007442 Ga0500569_007442_1273_1788 171
501 3300053111 Ga0500572_009426 Ga0500572_009426_1446_1961 171
502 3300053119 Ga0500595_001340 Ga0500595_001340_3871_4404 171
503 3300053119 Ga0500595_003474 Ga0500595_003474_98_613 171
504 3300053122 Ga0500608_197133 Ga0500608_197133_284_799 171
505 3300053131 Ga0500652_063282 Ga0500652_063282_949_1464 171
506 3300053136 Ga0500559_0161975 Ga0500559_0161975_276_809 171
507 3300053136 Ga0500559_0176451 Ga0500559_0176451_410_925 171
508 3300053136 Ga0500559_0241590 Ga0500559_0241590_210_725 171
509 3300053139 Ga0500568_0014289 Ga0500568_0014289_2902_3417 171
510 3300053142 Ga0500577_0019644 Ga0500577_0019644_1436_1951 171
511 3300053148 Ga0500590_155681 Ga0500590_155681_295_810 171
512 3300053153 Ga0500616_0049861 Ga0500616_0049861_1384_1899 171
513 3300053155 Ga0500620_003920 Ga0500620_003920_2649_3164 171
514 3300053156 Ga0500622_0097986 Ga0500622_0097986_922_1437 171
515 3300053158 Ga0500627_0011187 Ga0500627_0011187_1116_1631 171
516 3300053160 Ga0500633_0093613 Ga0500633_0093613_541_1056 171
517 3300053161 Ga0500634_0071061 Ga0500634_0071061_1244_1759 171
518 3300053162 Ga0500638_002337 Ga0500638_002337_5466_5999 171
519 3300053162 Ga0500638_276424 Ga0500638_276424_91_606 171
520 3300053177 Ga0500636_0000207 Ga0500636_0000207_21064_21579 171
521 3300053178 Ga0500637_0000077 Ga0500637_0000077_11127_11660 171
522 3300053178 Ga0500637_0470497 Ga0500637_0470497_20_535 171
523 3300053730 Ga0500645_011128 Ga0500645_011128_2418_2933 171
524 3300053730 Ga0500645_143381 Ga0500645_143381_101_616 171
525 3300053731 Ga0500609_002330 Ga0500609_002330_1252_1767 171
526 3300053733 Ga0500552_074627 Ga0500552_074627_48_563 171
527 3300053736 Ga0500599_007068 Ga0500599_007068_44_559 171
528 3300053737 Ga0500601_000322 Ga0500601_000322_1651_2166 171
529 3300055283 Ga0500661_000100 Ga0500661_000100_8298_8831 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12883

DUF3828

Protein of unknown function (DUF3828)

69

195

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8oeu-assembly1.cif.gz_C structure of the mammalian pol ii-spt6 complex (composite structure, structure 4) 0.7512 101 121
5w64-assembly1.cif.gz_C rna polymerase i initial transcribing complex state 1 0.7475 100 121
7f4g-assembly1.cif.gz_C structure of rpap2-bound rna polymerase ii 0.7332 101 121
8p4d-assembly1.cif.gz_C structural insights into human co-transcriptional capping - structure 4 0.7294 101 121
4rmm-assembly1.cif.gz_A-2 crystal structure of the q7nvp2_chrvo protein from chromobacterium violaceum. northeast structural genomics consortium target cvr191 0.7212 102 142
ID Description Score Start End Superfamily
af_Q2G0L2_152_317_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.833 134 162 3.40.50.2000
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8046 102 125 3.10.129.10
af_Q46858_15_143_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7461 26 153 3.10.450.50
af_Q54PU4_55_149_2.60.40.290 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7382 101 121 2.60.40.290
af_A2V8C8_26_137_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7299 101 147 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1W9ICB7-F1-model_v4 DUF3828 domain-containing protein 0.9254 23 169
AF-A0A1W9ICB7-F1-model_v4 DUF3828 domain-containing protein 0.8958 23 169
AF-A4YV44-F1-model_v4 DUF3828 domain-containing protein 0.8561 1 170
AF-H0SFJ9-F1-model_v4 DUF3828 domain-containing protein 0.8382 1 170
AF-A0A431QUI5-F1-model_v4 deleted 0.8368 1 170

Feature Viewer

pLDDT pTM Quality
84.6 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map