F459860
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 338 | 514 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0059942|Ga0496102_0059942_131_766 |
| Length | 211 |
| Sequence | MRGWPKRPIEPNGRSISLQRYALTPAAQAYRRAPSPQGHFMLTRRTFVVASLLAGTSPAFAVVPAPSDPVAVLTAIYTRAAKGKGDGGGAFVIENKAAKAKYLSKALVALWARADAHTPKGDVGPVDFDPVTNSQEPDVKSFKVDAEKMEADKATLAVTIAGHRNDRKPADLIVRYDFVREAGSWRIDDIKGSSDGEAWSIRKMLTDSLKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 2 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 3 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 4 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 5 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 6 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 7 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 8 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 9 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 10 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 11 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 85 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 134 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 139 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 140 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 147 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 151 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 248 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 249 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 250 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 253 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 254 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 288 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 296 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 297 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 298 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 299 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 301 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 302 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 303 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 304 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 305 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 306 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 310 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 311 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 312 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 315 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 319 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 320 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 322 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 323 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 326 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 328 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 329 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 335 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 336 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 337 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 338 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.16 |
| Metatranscriptomes | 0 |
| Isolates | 2.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.39 |
| Nodule | 2.84 |
| Rhizoplane | 5.29 |
| Rhizosphere | 67.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10023618 | 3300003215 | Bacteria | 2236 |
| 2 | JGI25153J46596_10025855 | 3300003215 | Bacteria | 2089 |
| 3 | rootL2_10097589 | 3300003322 | Bacteria | 1151 |
| 4 | rootH1_10027936 | 3300003323 | Bacteria | 2972 |
| 5 | Ga0065165_1009387 | 3300005262 | Bacteria | 4393 |
| 6 | Ga0065165_1047408 | 3300005262 | Bacteria | 1241 |
| 7 | Ga0070670_100209930 | 3300005331 | Bacteria | 1693 |
| 8 | Ga0068869_100149478 | 3300005334 | Bacteria | 1810 |
| 9 | Ga0070666_10069776 | 3300005335 | Bacteria | 2390 |
| 10 | Ga0070680_100430953 | 3300005336 | Bacteria | 1125 |
| 11 | Ga0068868_100358053 | 3300005338 | Bacteria | 1251 |
| 12 | Ga0068868_100998243 | 3300005338 | Bacteria | 766 |
| 13 | Ga0070668_100040420 | 3300005347 | Bacteria | 3568 |
| 14 | Ga0070668_100428482 | 3300005347 | Bacteria | 1133 |
| 15 | Ga0070668_100639909 | 3300005347 | Bacteria | 933 |
| 16 | Ga0070675_100226787 | 3300005354 | Bacteria | 1629 |
| 17 | Ga0070671_100249779 | 3300005355 | Bacteria | 1507 |
| 18 | Ga0070667_100507490 | 3300005367 | Bacteria | 1106 |
| 19 | Ga0070667_100574971 | 3300005367 | Bacteria | 1037 |
| 20 | Ga0070709_10568020 | 3300005434 | Bacteria | 870 |
| 21 | Ga0070713_100740724 | 3300005436 | Bacteria | 940 |
| 22 | Ga0070708_100433906 | 3300005445 | Bacteria | 1239 |
| 23 | Ga0070663_100091642 | 3300005455 | Bacteria | 2252 |
| 24 | Ga0070662_100158312 | 3300005457 | Bacteria | 1769 |
| 25 | Ga0070685_10619924 | 3300005466 | Bacteria | 781 |
| 26 | Ga0070707_100324803 | 3300005468 | Bacteria | 1495 |
| 27 | Ga0070698_100085336 | 3300005471 | Bacteria | 3145 |
| 28 | Ga0070679_100739886 | 3300005530 | Bacteria | 926 |
| 29 | Ga0070697_100213085 | 3300005536 | Bacteria | 1645 |
| 30 | Ga0068853_100348531 | 3300005539 | Bacteria | 1377 |
| 31 | Ga0068853_100967380 | 3300005539 | Bacteria | 819 |
| 32 | Ga0070696_100074055 | 3300005546 | Bacteria | 2400 |
| 33 | Ga0070696_100507653 | 3300005546 | Bacteria | 960 |
| 34 | Ga0070693_100739646 | 3300005547 | Bacteria | 724 |
| 35 | Ga0070665_100070981 | 3300005548 | Bacteria | 3489 |
| 36 | Ga0070665_100144836 | 3300005548 | Bacteria | 2379 |
| 37 | Ga0070665_100635498 | 3300005548 | Bacteria | 1080 |
| 38 | Ga0070665_100786374 | 3300005548 | Bacteria | 965 |
| 39 | Ga0068855_100657564 | 3300005563 | Bacteria | 1125 |
| 40 | Ga0068855_101455801 | 3300005563 | Unclassified | 704 |
| 41 | Ga0070664_100616868 | 3300005564 | Bacteria | 1007 |
| 42 | Ga0068857_100110928 | 3300005577 | Bacteria | 2465 |
| 43 | Ga0068854_100242225 | 3300005578 | Bacteria | 1437 |
| 44 | Ga0068856_100000919 | 3300005614 | Bacteria | 31534 |
| 45 | Ga0070702_100348159 | 3300005615 | Bacteria | 1042 |
| 46 | Ga0068852_101287002 | 3300005616 | Bacteria | 753 |
| 47 | Ga0068859_100224943 | 3300005617 | Bacteria | 1964 |
| 48 | Ga0068863_100810650 | 3300005841 | Bacteria | 934 |
| 49 | Ga0068863_102245725 | 3300005841 | Bacteria | 556 |
| 50 | Ga0068858_100154566 | 3300005842 | Bacteria | 2158 |
| 51 | Ga0068860_100862141 | 3300005843 | Bacteria | 921 |
| 52 | Ga0068862_101367870 | 3300005844 | Bacteria | 711 |
| 53 | Ga0081540_1006213 | 3300005983 | Bacteria | 8758 |
| 54 | Ga0081540_1014958 | 3300005983 | Bacteria | 4935 |
| 55 | Ga0070717_10020204 | 3300006028 | Bacteria | 5234 |
| 56 | Ga0070717_10430299 | 3300006028 | Bacteria | 1188 |
| 57 | Ga0075365_10047264 | 3300006038 | Bacteria | 2828 |
| 58 | Ga0075368_10003302 | 3300006042 | Bacteria | 5372 |
| 59 | Ga0075368_10009924 | 3300006042 | Bacteria | 3434 |
| 60 | Ga0075363_100056159 | 3300006048 | Bacteria | 2110 |
| 61 | Ga0075364_10019540 | 3300006051 | Bacteria | 4252 |
| 62 | Ga0070712_100473653 | 3300006175 | Bacteria | 1046 |
| 63 | Ga0075362_10111203 | 3300006177 | Bacteria | 1289 |
| 64 | Ga0075367_10040446 | 3300006178 | Bacteria | 2722 |
| 65 | Ga0075369_10021722 | 3300006186 | Bacteria | 2641 |
| 66 | Ga0075369_10265439 | 3300006186 | Bacteria | 798 |
| 67 | Ga0075370_10068087 | 3300006353 | Bacteria | 2033 |
| 68 | Ga0068871_100079454 | 3300006358 | Bacteria | 2714 |
| 69 | Ga0068865_100166388 | 3300006881 | Bacteria | 1686 |
| 70 | Ga0097620_100224942 | 3300006931 | Bacteria | 1964 |
| 71 | Ga0105240_10153056 | 3300009093 | Bacteria | 2745 |
| 72 | Ga0105240_10172526 | 3300009093 | Bacteria | 2560 |
| 73 | Ga0105240_10775999 | 3300009093 | Bacteria | 1040 |
| 74 | Ga0105240_11160997 | 3300009093 | Bacteria | 819 |
| 75 | Ga0105247_10038756 | 3300009101 | Bacteria | 2910 |
| 76 | Ga0105247_10137489 | 3300009101 | Bacteria | 1598 |
| 77 | Ga0105247_10215034 | 3300009101 | Bacteria | 1298 |
| 78 | Ga0105248_10565739 | 3300009177 | Bacteria | 1282 |
| 79 | Ga0105248_10775796 | 3300009177 | Bacteria | 1082 |
| 80 | Ga0105237_10053970 | 3300009545 | Bacteria | 4028 |
| 81 | Ga0105237_10121328 | 3300009545 | Bacteria | 2608 |
| 82 | Ga0105237_10601188 | 3300009545 | Bacteria | 1107 |
| 83 | Ga0105237_11455634 | 3300009545 | Bacteria | 691 |
| 84 | Ga0105238_10333454 | 3300009551 | Bacteria | 1504 |
| 85 | Ga0105238_10479829 | 3300009551 | Bacteria | 1242 |
| 86 | Ga0105249_10344315 | 3300009553 | Bacteria | 1508 |
| 87 | Ga0105239_10156417 | 3300010375 | Bacteria | 2546 |
| 88 | Ga0105239_10754936 | 3300010375 | Bacteria | 1113 |
| 89 | Ga0105239_10987239 | 3300010375 | Bacteria | 968 |
| 90 | Ga0105246_10012729 | 3300011119 | Bacteria | 5257 |
| 91 | Ga0157371_10309862 | 3300013102 | Bacteria | 1144 |
| 92 | Ga0157370_10180463 | 3300013104 | Bacteria | 1962 |
| 93 | Ga0157370_10211757 | 3300013104 | Bacteria | 1796 |
| 94 | Ga0157369_10005972 | 3300013105 | Bacteria | 14140 |
| 95 | Ga0163162_11059044 | 3300013306 | Bacteria | 918 |
| 96 | Ga0157372_10185231 | 3300013307 | Bacteria | 2411 |
| 97 | Ga0157375_10248577 | 3300013308 | Bacteria | 1939 |
| 98 | Ga0157375_10279496 | 3300013308 | Bacteria | 1832 |
| 99 | Ga0163163_10018720 | 3300014325 | Bacteria | 6490 |
| 100 | Ga0163163_10153884 | 3300014325 | Bacteria | 2343 |
| 101 | Ga0163163_10259460 | 3300014325 | Bacteria | 1789 |
| 102 | Ga0182008_10107029 | 3300014497 | Bacteria | 1384 |
| 103 | Ga0157377_10497228 | 3300014745 | Bacteria | 851 |
| 104 | Ga0157379_10235908 | 3300014968 | Bacteria | 1659 |
| 105 | Ga0213876_10124548 | 3300021384 | Bacteria | 1369 |
| 106 | Ga0213875_10198375 | 3300021388 | Bacteria | 944 |
| 107 | Ga0209563_103371 | 3300025230 | Bacteria | 3326 |
| 108 | Ga0209677_106255 | 3300025253 | Bacteria | 2866 |
| 109 | Ga0209148_1000258 | 3300025254 | Bacteria | 83390 |
| 110 | Ga0209148_1047697 | 3300025254 | Bacteria | 565 |
| 111 | Ga0209233_1003783 | 3300025261 | Bacteria | 5281 |
| 112 | Ga0209233_1008098 | 3300025261 | Bacteria | 3281 |
| 113 | Ga0209455_1004545 | 3300025272 | Bacteria | 4504 |
| 114 | Ga0209455_1007471 | 3300025272 | Bacteria | 3081 |
| 115 | Ga0209455_1031803 | 3300025272 | Bacteria | 882 |
| 116 | Ga0209564_1002963 | 3300025295 | Bacteria | 12237 |
| 117 | Ga0209758_1000775 | 3300025297 | Bacteria | 45897 |
| 118 | Ga0209758_1005565 | 3300025297 | Bacteria | 9595 |
| 119 | Ga0209256_1056840 | 3300025299 | Bacteria | 924 |
| 120 | Ga0207426_1000661 | 3300025302 | Bacteria | 42239 |
| 121 | Ga0209257_1010306 | 3300025304 | Bacteria | 4756 |
| 122 | Ga0207697_10029821 | 3300025315 | Bacteria | 2233 |
| 123 | Ga0207697_10131838 | 3300025315 | Bacteria | 1080 |
| 124 | Ga0207656_10395183 | 3300025321 | Bacteria | 694 |
| 125 | Ga0207688_10122945 | 3300025901 | Bacteria | 1516 |
| 126 | Ga0207699_10185362 | 3300025906 | Bacteria | 1401 |
| 127 | Ga0207695_10220511 | 3300025913 | Bacteria | 1804 |
| 128 | Ga0207695_10545112 | 3300025913 | Bacteria | 1041 |
| 129 | Ga0207671_10165762 | 3300025914 | Bacteria | 1713 |
| 130 | Ga0207671_10907025 | 3300025914 | Bacteria | 697 |
| 131 | Ga0207693_10257709 | 3300025915 | Bacteria | 1368 |
| 132 | Ga0207660_10381730 | 3300025917 | Bacteria | 1133 |
| 133 | Ga0207652_10672795 | 3300025921 | Bacteria | 925 |
| 134 | Ga0207694_10224526 | 3300025924 | Bacteria | 1533 |
| 135 | Ga0207650_10055612 | 3300025925 | Bacteria | 2938 |
| 136 | Ga0207650_10138421 | 3300025925 | Bacteria | 1912 |
| 137 | Ga0207659_10476852 | 3300025926 | Bacteria | 1054 |
| 138 | Ga0207700_10627712 | 3300025928 | Bacteria | 957 |
| 139 | Ga0207664_10108916 | 3300025929 | Bacteria | 2301 |
| 140 | Ga0207644_10333958 | 3300025931 | Bacteria | 1228 |
| 141 | Ga0207706_10070933 | 3300025933 | Bacteria | 3064 |
| 142 | Ga0207669_10225490 | 3300025937 | Bacteria | 1379 |
| 143 | Ga0207704_10523644 | 3300025938 | Bacteria | 959 |
| 144 | Ga0207711_10845387 | 3300025941 | Bacteria | 852 |
| 145 | Ga0207667_10763277 | 3300025949 | Bacteria | 966 |
| 146 | Ga0207651_10514851 | 3300025960 | Bacteria | 1036 |
| 147 | Ga0207668_10329701 | 3300025972 | Bacteria | 1269 |
| 148 | Ga0207668_10521461 | 3300025972 | Bacteria | 1025 |
| 149 | Ga0207640_10289010 | 3300025981 | Bacteria | 1292 |
| 150 | Ga0207658_10279774 | 3300025986 | Bacteria | 1430 |
| 151 | Ga0207658_10396621 | 3300025986 | Bacteria | 1212 |
| 152 | Ga0207677_10177885 | 3300026023 | Bacteria | 1671 |
| 153 | Ga0207703_10184668 | 3300026035 | Bacteria | 1842 |
| 154 | Ga0207639_10243516 | 3300026041 | Bacteria | 1565 |
| 155 | Ga0207639_10270299 | 3300026041 | Bacteria | 1491 |
| 156 | Ga0207639_10340693 | 3300026041 | Bacteria | 1336 |
| 157 | Ga0207678_10042160 | 3300026067 | Bacteria | 3955 |
| 158 | Ga0207678_10084749 | 3300026067 | Bacteria | 2710 |
| 159 | Ga0207678_10178299 | 3300026067 | Bacteria | 1814 |
| 160 | Ga0207702_10000257 | 3300026078 | Bacteria | 61235 |
| 161 | Ga0207702_10716305 | 3300026078 | Bacteria | 986 |
| 162 | Ga0207675_100579471 | 3300026118 | Bacteria | 1123 |
| 163 | Ga0207683_10078508 | 3300026121 | Bacteria | 2925 |
| 164 | Ga0207683_10391437 | 3300026121 | Bacteria | 1278 |
| 165 | Ga0207698_10833167 | 3300026142 | Bacteria | 926 |
| 166 | Ga0209813_10078767 | 3300027866 | Bacteria | 1085 |
| 167 | Ga0268266_10239305 | 3300028379 | Bacteria | 1674 |
| 168 | Ga0268266_10572857 | 3300028379 | Bacteria | 1083 |
| 169 | Ga0268265_10354808 | 3300028380 | Bacteria | 1340 |
| 170 | Ga0268265_10522862 | 3300028380 | Bacteria | 1122 |
| 171 | Ga0265334_10139435 | 3300028573 | Bacteria | 859 |
| 172 | Ga0265338_10385541 | 3300028800 | Unclassified | 1002 |
| 173 | Ga0265330_10026658 | 3300031235 | Bacteria | 2613 |
| 174 | Ga0265325_10122250 | 3300031241 | Bacteria | 1254 |
| 175 | Ga0265340_10109163 | 3300031247 | Bacteria | 1280 |
| 176 | Ga0265316_10105909 | 3300031344 | Unclassified | 2133 |
| 177 | Ga0265314_10024131 | 3300031711 | Bacteria | 4618 |
| 178 | Ga0265342_10008945 | 3300031712 | Bacteria | 7113 |
| 179 | Ga0265342_10120996 | 3300031712 | Bacteria | 1474 |
| 180 | Ga0307510_10011579 | 3300033180 | Bacteria | 10466 |
| 181 | Ga0373926_0042807 | 3300035083 | Bacteria | 1620 |
| 182 | Ga0373934_0015387 | 3300035086 | Bacteria | 2902 |
| 183 | Ga0373923_0004358 | 3300035111 | Bacteria | 4690 |
| 184 | Ga0373923_0020014 | 3300035111 | Bacteria | 2596 |
| 185 | Ga0373936_0030840 | 3300035113 | Bacteria | 2115 |
| 186 | Ga0373953_0007080 | 3300035117 | Bacteria | 3736 |
| 187 | Ga0373954_0030489 | 3300035118 | Bacteria | 2486 |
| 188 | Ga0373956_0005761 | 3300035119 | Bacteria | 4953 |
| 189 | Ga0373957_0003039 | 3300035120 | Bacteria | 4881 |
| 190 | Ga0373943_0014337 | 3300035170 | Bacteria | 3587 |
| 191 | Ga0373943_0124126 | 3300035170 | Bacteria | 1375 |
| 192 | Ga0373946_0004813 | 3300035171 | Bacteria | 4859 |
| 193 | Ga0373946_0161618 | 3300035171 | Bacteria | 1052 |
| 194 | Ga0373955_0000352 | 3300035172 | Bacteria | 19413 |
| 195 | Ga0373955_0053855 | 3300035172 | Bacteria | 2198 |
| 196 | Ga0373962_0072821 | 3300035242 | Bacteria | 1030 |
| 197 | Ga0373924_0000523 | 3300035410 | Bacteria | 11791 |
| 198 | Ga0373924_0031720 | 3300035410 | Bacteria | 2126 |
| 199 | Ga0373927_0000432 | 3300035695 | Bacteria | 32114 |
| 200 | Ga0373927_0081394 | 3300035695 | Bacteria | 2098 |
| 201 | Ga0373933_0002766 | 3300035724 | Bacteria | 9785 |
| 202 | Ga0373933_0070357 | 3300035724 | Bacteria | 2128 |
| 203 | Ga0373947_0011086 | 3300035725 | Bacteria | 5175 |
| 204 | Ga0373937_0008910 | 3300036401 | Bacteria | 8710 |
| 205 | Ga0373937_0182000 | 3300036401 | Bacteria | 1974 |
| 206 | Ga0373937_0328561 | 3300036401 | Bacteria | 1447 |
| 207 | Ga0373925_0456722 | 3300037068 | Bacteria | 1046 |
| 208 | Ga0395900_0012630 | 3300037418 | Bacteria | 8637 |
| 209 | Ga0395898_0039217 | 3300037466 | Bacteria | 4689 |
| 210 | Ga0395905_0152558 | 3300037471 | Bacteria | 2173 |
| 211 | Ga0395905_0261312 | 3300037471 | Bacteria | 1616 |
| 212 | Ga0436364_0424493 | 3300037853 | Bacteria | 6234 |
| 213 | Ga0436364_0767258 | 3300037853 | Bacteria | 964 |
| 214 | Ga0436363_1057105 | 3300039450 | Bacteria | 1277 |
| 215 | Ga0466966_0000600 | 3300044684 | Bacteria | 22805 |
| 216 | Ga0466961_0000162 | 3300044693 | Bacteria | 45301 |
| 217 | Ga0466970_0099957 | 3300044765 | Bacteria | 1579 |
| 218 | Ga0466957_0045107 | 3300044842 | Bacteria | 2673 |
| 219 | Ga0466959_0037437 | 3300045049 | Bacteria | 3584 |
| 220 | Ga0466959_0103596 | 3300045049 | Bacteria | 2035 |
| 221 | Ga0466958_0112497 | 3300045836 | Bacteria | 1700 |
| 222 | Ga0495617_037713 | 3300046452 | Bacteria | 1618 |
| 223 | Ga0495592_0003207 | 3300046454 | Bacteria | 11722 |
| 224 | Ga0495592_0026570 | 3300046454 | Bacteria | 4388 |
| 225 | Ga0495603_0000067 | 3300046455 | Bacteria | 45466 |
| 226 | Ga0495629_0001343 | 3300046459 | Bacteria | 19368 |
| 227 | Ga0495629_0003475 | 3300046459 | Bacteria | 11910 |
| 228 | Ga0495629_0188724 | 3300046459 | Bacteria | 1427 |
| 229 | Ga0495638_0019840 | 3300046460 | Bacteria | 4445 |
| 230 | Ga0495638_0083169 | 3300046460 | Bacteria | 1940 |
| 231 | Ga0495638_0469155 | 3300046460 | Bacteria | 639 |
| 232 | Ga0495651_0033028 | 3300046462 | Bacteria | 4037 |
| 233 | Ga0495651_0033516 | 3300046462 | Bacteria | 4005 |
| 234 | Ga0495653_0000212 | 3300046463 | Bacteria | 47187 |
| 235 | Ga0495653_0086472 | 3300046463 | Bacteria | 2304 |
| 236 | Ga0495653_0594349 | 3300046463 | Bacteria | 681 |
| 237 | Ga0495650_0062817 | 3300046471 | Bacteria | 1483 |
| 238 | Ga0495580_0002382 | 3300046472 | Bacteria | 16421 |
| 239 | Ga0495580_0024700 | 3300046472 | Bacteria | 4397 |
| 240 | Ga0495582_0000049 | 3300046473 | Bacteria | 59194 |
| 241 | Ga0495605_0136905 | 3300046474 | Bacteria | 1101 |
| 242 | Ga0495639_0000106 | 3300046475 | Bacteria | 42031 |
| 243 | Ga0495639_0193926 | 3300046475 | Bacteria | 992 |
| 244 | Ga0495662_0000276 | 3300046476 | Bacteria | 22020 |
| 245 | Ga0495662_0270520 | 3300046476 | Bacteria | 836 |
| 246 | Ga0495664_0017824 | 3300046477 | Bacteria | 4060 |
| 247 | Ga0495664_0070837 | 3300046477 | Bacteria | 2082 |
| 248 | Ga0495664_0180986 | 3300046477 | Bacteria | 1278 |
| 249 | Ga0495594_0001204 | 3300046499 | Bacteria | 13519 |
| 250 | Ga0495596_0208664 | 3300046500 | Bacteria | 759 |
| 251 | Ga0495583_0268000 | 3300046506 | Bacteria | 682 |
| 252 | Ga0495608_0014735 | 3300046511 | Bacteria | 5426 |
| 253 | Ga0495618_0235523 | 3300046514 | Bacteria | 1152 |
| 254 | Ga0495628_0007748 | 3300046516 | Bacteria | 9263 |
| 255 | Ga0495628_0105386 | 3300046516 | Bacteria | 2172 |
| 256 | Ga0495628_0590074 | 3300046516 | Bacteria | 794 |
| 257 | Ga0495630_0177159 | 3300046517 | Bacteria | 1625 |
| 258 | Ga0495630_0264558 | 3300046517 | Bacteria | 1314 |
| 259 | Ga0495632_0045378 | 3300046519 | Bacteria | 2189 |
| 260 | Ga0495632_0070631 | 3300046519 | Bacteria | 1679 |
| 261 | Ga0495643_0060232 | 3300046522 | Bacteria | 2015 |
| 262 | Ga0495643_0219778 | 3300046522 | Bacteria | 902 |
| 263 | Ga0495648_0095903 | 3300046524 | Bacteria | 1649 |
| 264 | Ga0495648_0115269 | 3300046524 | Bacteria | 1454 |
| 265 | Ga0495648_0184406 | 3300046524 | Bacteria | 1058 |
| 266 | Ga0495648_0293600 | 3300046524 | Bacteria | 765 |
| 267 | Ga0495666_0033825 | 3300046526 | Bacteria | 2496 |
| 268 | Ga0495652_0008265 | 3300046529 | Bacteria | 9510 |
| 269 | Ga0495652_0092591 | 3300046529 | Bacteria | 2469 |
| 270 | Ga0495652_0117140 | 3300046529 | Bacteria | 2132 |
| 271 | Ga0495654_0204137 | 3300046530 | Bacteria | 844 |
| 272 | Ga0495665_0000307 | 3300046531 | Bacteria | 24786 |
| 273 | Ga0495665_0014870 | 3300046531 | Bacteria | 4192 |
| 274 | Ga0495640_0005046 | 3300046533 | Bacteria | 10482 |
| 275 | Ga0495640_0006166 | 3300046533 | Bacteria | 9503 |
| 276 | Ga0495640_0020568 | 3300046533 | Bacteria | 4856 |
| 277 | Ga0495640_0038036 | 3300046533 | Bacteria | 3388 |
| 278 | Ga0495587_0014477 | 3300046536 | Bacteria | 4945 |
| 279 | Ga0495587_0358917 | 3300046536 | Bacteria | 812 |
| 280 | Ga0495598_0081022 | 3300046537 | Bacteria | 1041 |
| 281 | Ga0495645_0033851 | 3300046543 | Bacteria | 3727 |
| 282 | Ga0495622_0026769 | 3300046557 | Bacteria | 2692 |
| 283 | Ga0495622_0123885 | 3300046557 | Bacteria | 1179 |
| 284 | Ga0495667_0001112 | 3300046559 | Bacteria | 17494 |
| 285 | Ga0495667_0102706 | 3300046559 | Bacteria | 1849 |
| 286 | Ga0495656_0145982 | 3300046615 | Bacteria | 1138 |
| 287 | Ga0495634_0000267 | 3300046642 | Bacteria | 49323 |
| 288 | Ga0495634_0072683 | 3300046642 | Bacteria | 2262 |
| 289 | Ga0495635_0000230 | 3300046663 | Bacteria | 35642 |
| 290 | Ga0495635_0004002 | 3300046663 | Bacteria | 10239 |
| 291 | Ga0495635_0038800 | 3300046663 | Bacteria | 3297 |
| 292 | Ga0495588_0020296 | 3300046674 | Bacteria | 3264 |
| 293 | Ga0495657_0016784 | 3300046675 | Bacteria | 5324 |
| 294 | Ga0495657_0024124 | 3300046675 | Bacteria | 4336 |
| 295 | Ga0495657_0072863 | 3300046675 | Bacteria | 2239 |
| 296 | Ga0495599_0000807 | 3300046678 | Bacteria | 17610 |
| 297 | Ga0495599_0027325 | 3300046678 | Bacteria | 3577 |
| 298 | Ga0495599_0069521 | 3300046678 | Bacteria | 2197 |
| 299 | Ga0495599_0331094 | 3300046678 | Bacteria | 915 |
| 300 | Ga0495623_0010742 | 3300046679 | Bacteria | 5927 |
| 301 | Ga0495623_0634910 | 3300046679 | Bacteria | 552 |
| 302 | Ga0495646_0029561 | 3300046680 | Bacteria | 3425 |
| 303 | Ga0495646_0063995 | 3300046680 | Bacteria | 2181 |
| 304 | Ga0495646_0309798 | 3300046680 | Bacteria | 833 |
| 305 | Ga0495646_0435495 | 3300046680 | Bacteria | 678 |
| 306 | Ga0495647_0001002 | 3300046681 | Bacteria | 8582 |
| 307 | Ga0495647_0009264 | 3300046681 | Bacteria | 3330 |
| 308 | Ga0495658_0023717 | 3300046683 | Bacteria | 3260 |
| 309 | Ga0495669_0457170 | 3300046684 | Bacteria | 620 |
| 310 | Ga0495613_0003663 | 3300046689 | Bacteria | 11518 |
| 311 | Ga0495613_0064321 | 3300046689 | Bacteria | 2683 |
| 312 | Ga0495613_0387785 | 3300046689 | Bacteria | 954 |
| 313 | Ga0495624_0001957 | 3300046690 | Bacteria | 15673 |
| 314 | Ga0495670_0066769 | 3300046691 | Bacteria | 1815 |
| 315 | Ga0495671_0166017 | 3300046692 | Bacteria | 1074 |
| 316 | Ga0495671_0289360 | 3300046692 | Bacteria | 789 |
| 317 | Ga0495649_0323226 | 3300046694 | Bacteria | 783 |
| 318 | Ga0495649_0379236 | 3300046694 | Bacteria | 712 |
| 319 | Ga0495600_0001064 | 3300046809 | Bacteria | 14886 |
| 320 | Ga0495600_0012503 | 3300046809 | Bacteria | 5311 |
| 321 | Ga0495600_0109318 | 3300046809 | Bacteria | 1800 |
| 322 | Ga0495581_0000022 | 3300047315 | Bacteria | 56149 |
| 323 | Ga0495581_0127080 | 3300047315 | Bacteria | 1485 |
| 324 | Ga0495604_0011802 | 3300047317 | Bacteria | 6948 |
| 325 | Ga0495604_0011818 | 3300047317 | Bacteria | 6945 |
| 326 | Ga0495604_0046272 | 3300047317 | Bacteria | 3392 |
| 327 | Ga0495604_0071571 | 3300047317 | Bacteria | 2623 |
| 328 | Ga0495674_0000629 | 3300047319 | Bacteria | 33021 |
| 329 | Ga0495674_0009234 | 3300047319 | Bacteria | 9373 |
| 330 | Ga0495674_0017832 | 3300047319 | Bacteria | 6609 |
| 331 | Ga0495676_0026326 | 3300047321 | Bacteria | 5010 |
| 332 | Ga0495676_0211927 | 3300047321 | Bacteria | 1340 |
| 333 | Ga0495680_0001284 | 3300047322 | Bacteria | 27396 |
| 334 | Ga0495680_0039557 | 3300047322 | Bacteria | 3761 |
| 335 | Ga0495683_0354052 | 3300047323 | Bacteria | 619 |
| 336 | Ga0495687_111123 | 3300047443 | Bacteria | 1007 |
| 337 | Ga0495675_0008311 | 3300047444 | Bacteria | 6422 |
| 338 | Ga0495675_0056589 | 3300047444 | Bacteria | 2486 |
| 339 | Ga0495673_0105851 | 3300047469 | Bacteria | 1131 |
| 340 | Ga0495673_0165793 | 3300047469 | Bacteria | 845 |
| 341 | Ga0495684_0000780 | 3300047471 | Bacteria | 25813 |
| 342 | Ga0495684_0154898 | 3300047471 | Bacteria | 1712 |
| 343 | Ga0495686_0054318 | 3300047472 | Bacteria | 2508 |
| 344 | Ga0495686_0257078 | 3300047472 | Bacteria | 979 |
| 345 | Ga0495686_0395143 | 3300047472 | Bacteria | 743 |
| 346 | Ga0495593_0000016 | 3300047673 | Bacteria | 80178 |
| 347 | Ga0495593_0010013 | 3300047673 | Bacteria | 5494 |
| 348 | Ga0495593_0374657 | 3300047673 | Bacteria | 711 |
| 349 | Ga0495602_0035202 | 3300048088 | Bacteria | 4671 |
| 350 | Ga0495602_0335554 | 3300048088 | Bacteria | 1095 |
| 351 | Ga0495602_0395223 | 3300048088 | Bacteria | 987 |
| 352 | Ga0495614_0076996 | 3300048089 | Bacteria | 1442 |
| 353 | Ga0495626_0236976 | 3300048091 | Bacteria | 736 |
| 354 | Ga0496100_0121082 | 3300048903 | Bacteria | 1831 |
| 355 | Ga0496101_0175126 | 3300048904 | Bacteria | 1650 |
| 356 | Ga0496101_0493564 | 3300048904 | Bacteria | 967 |
| 357 | Ga0496102_0059942 | 3300048905 | Bacteria | 3481 |
| 358 | Ga0496104_0007051 | 3300048907 | Bacteria | 9914 |
| 359 | Ga0496104_0290575 | 3300048907 | Bacteria | 1547 |
| 360 | Ga0496105_0084340 | 3300048908 | Bacteria | 2624 |
| 361 | Ga0496106_0014425 | 3300048909 | Bacteria | 5838 |
| 362 | Ga0496106_0066949 | 3300048909 | Bacteria | 2737 |
| 363 | Ga0496106_1042573 | 3300048909 | Bacteria | 642 |
| 364 | Ga0496107_0012037 | 3300048910 | Bacteria | 6033 |
| 365 | Ga0496107_0123826 | 3300048910 | Bacteria | 1905 |
| 366 | Ga0496107_0658580 | 3300048910 | Bacteria | 772 |
| 367 | Ga0496108_0091518 | 3300048911 | Bacteria | 2585 |
| 368 | Ga0496108_0153847 | 3300048911 | Bacteria | 1985 |
| 369 | Ga0496108_0259768 | 3300048911 | Bacteria | 1511 |
| 370 | Ga0496108_0512894 | 3300048911 | Bacteria | 1047 |
| 371 | Ga0496109_0018354 | 3300048912 | Bacteria | 6145 |
| 372 | Ga0496110_0027198 | 3300048913 | Bacteria | 4902 |
| 373 | Ga0496111_0108112 | 3300048914 | Bacteria | 2048 |
| 374 | Ga0496112_0044236 | 3300048915 | Bacteria | 4363 |
| 375 | Ga0496112_0199872 | 3300048915 | Bacteria | 1959 |
| 376 | Ga0496112_0398380 | 3300048915 | Bacteria | 1316 |
| 377 | Ga0496113_0130974 | 3300048916 | Bacteria | 1968 |
| 378 | Ga0496114_0424581 | 3300048917 | Bacteria | 1178 |
| 379 | Ga0496115_0064231 | 3300048918 | Bacteria | 2963 |
| 380 | Ga0496115_0241991 | 3300048918 | Bacteria | 1487 |
| 381 | Ga0496115_0435646 | 3300048918 | Bacteria | 1060 |
| 382 | Ga0496116_0030517 | 3300048919 | Bacteria | 3871 |
| 383 | Ga0496117_0127773 | 3300048920 | Bacteria | 1548 |
| 384 | Ga0496117_0248424 | 3300048920 | Bacteria | 972 |
| 385 | Ga0496118_0091999 | 3300048921 | Bacteria | 2083 |
| 386 | Ga0496118_0143848 | 3300048921 | Bacteria | 1506 |
| 387 | Ga0496118_0515665 | 3300048921 | Bacteria | 591 |
| 388 | Ga0496119_0007812 | 3300048922 | Bacteria | 9538 |
| 389 | Ga0496119_0093996 | 3300048922 | Bacteria | 1697 |
| 390 | Ga0496119_0149454 | 3300048922 | Bacteria | 1253 |
| 391 | Ga0496119_0286946 | 3300048922 | Bacteria | 816 |
| 392 | Ga0496120_0018530 | 3300048923 | Bacteria | 4482 |
| 393 | Ga0496120_0026275 | 3300048923 | Bacteria | 3597 |
| 394 | Ga0496120_0249533 | 3300048923 | Bacteria | 834 |
| 395 | Ga0496121_0025652 | 3300048924 | Bacteria | 5586 |
| 396 | Ga0496121_0050471 | 3300048924 | Bacteria | 3514 |
| 397 | Ga0496121_0093929 | 3300048924 | Bacteria | 2334 |
| 398 | Ga0496121_0102574 | 3300048924 | Bacteria | 2204 |
| 399 | Ga0496121_0164697 | 3300048924 | Bacteria | 1617 |
| 400 | Ga0496122_0076008 | 3300048925 | Bacteria | 2366 |
| 401 | Ga0496123_0265666 | 3300048926 | Bacteria | 838 |
| 402 | Ga0496124_0652632 | 3300048927 | Bacteria | 675 |
| 403 | Ga0496124_0708123 | 3300048927 | Bacteria | 637 |
| 404 | Ga0496126_0020375 | 3300048929 | Bacteria | 6503 |
| 405 | Ga0496126_0064043 | 3300048929 | Bacteria | 3294 |
| 406 | Ga0496126_0146095 | 3300048929 | Bacteria | 2031 |
| 407 | Ga0496126_0170003 | 3300048929 | Bacteria | 1857 |
| 408 | Ga0496126_0335223 | 3300048929 | Bacteria | 1240 |
| 409 | Ga0496126_0527171 | 3300048929 | Bacteria | 940 |
| 410 | Ga0496126_0971185 | 3300048929 | Bacteria | 639 |
| 411 | Ga0495682_0037775 | 3300049460 | Bacteria | 1775 |
| 412 | Ga0501031_0000186 | 3300049568 | Bacteria | 34900 |
| 413 | Ga0501032_0005876 | 3300049569 | Bacteria | 9075 |
| 414 | Ga0501033_0000098 | 3300049570 | Bacteria | 82803 |
| 415 | Ga0501034_0001197 | 3300049571 | Bacteria | 35694 |
| 416 | Ga0501036_0001134 | 3300049572 | Bacteria | 20288 |
| 417 | Ga0501037_0000069 | 3300049573 | Bacteria | 95277 |
| 418 | Ga0501038_0000034 | 3300049574 | Bacteria | 128854 |
| 419 | Ga0501039_0000580 | 3300049575 | Bacteria | 26450 |
| 420 | Ga0501040_0845500 | 3300049576 | Bacteria | 662 |
| 421 | Ga0501043_0000130 | 3300049579 | Bacteria | 69795 |
| 422 | Ga0501046_0001236 | 3300049580 | Bacteria | 24723 |
| 423 | Ga0501046_0348229 | 3300049580 | Bacteria | 1076 |
| 424 | Ga0501047_0000758 | 3300049581 | Bacteria | 33713 |
| 425 | Ga0501047_0015918 | 3300049581 | Bacteria | 7169 |
| 426 | Ga0501048_0003629 | 3300049582 | Bacteria | 11751 |
| 427 | Ga0501067_0000264 | 3300049583 | Bacteria | 28689 |
| 428 | Ga0501068_0011959 | 3300049584 | Bacteria | 4909 |
| 429 | Ga0501069_0226491 | 3300049585 | Bacteria | 1087 |
| 430 | Ga0501070_0004609 | 3300049586 | Bacteria | 11823 |
| 431 | Ga0501070_0057566 | 3300049586 | Bacteria | 3222 |
| 432 | Ga0501072_0012220 | 3300049588 | Bacteria | 6562 |
| 433 | Ga0501073_0000532 | 3300049589 | Bacteria | 26744 |
| 434 | Ga0501073_0149406 | 3300049589 | Bacteria | 1619 |
| 435 | Ga0501074_0007521 | 3300049590 | Bacteria | 7882 |
| 436 | Ga0501074_0261928 | 3300049590 | Bacteria | 1229 |
| 437 | Ga0501080_0014171 | 3300049742 | Bacteria | 7337 |
| 438 | Ga0501080_0063737 | 3300049742 | Bacteria | 3429 |
| 439 | Ga0501083_0000590 | 3300049744 | Bacteria | 23293 |
| 440 | Ga0501035_0000970 | 3300049822 | Bacteria | 30303 |
| 441 | Ga0501044_0000725 | 3300049823 | Bacteria | 39776 |
| 442 | Ga0501044_0291804 | 3300049823 | Bacteria | 1562 |
| 443 | Ga0501045_0019911 | 3300049824 | Bacteria | 4790 |
| 444 | nmdc:mga03n38_161337_c1 | 3300050490 | Bacteria | 1135 |
| 445 | nmdc:mga0yw44_277519_c1 | 3300050492 | Bacteria | 1120 |
| 446 | nmdc:mga0yw44_787742_c1 | 3300050492 | Bacteria | 646 |
| 447 | nmdc:mga0k408_12565_c1 | 3300050493 | Bacteria | 4630 |
| 448 | nmdc:mga04h51_14323_c1 | 3300050495 | Bacteria | 2264 |
| 449 | nmdc:mga07m45_11206_c3 | 3300050496 | Bacteria | 3489 |
| 450 | nmdc:mga0sz30_118505_c1 | 3300050516 | Bacteria | 1163 |
| 451 | nmdc:mga0sz30_261463_c1 | 3300050516 | Bacteria | 771 |
| 452 | Ga0495601_0022095 | 3300053077 | Bacteria | 3904 |
| 453 | Ga0495655_0029333 | 3300053083 | Bacteria | 1322 |
| 454 | Ga0495595_0001005 | 3300053084 | Bacteria | 10865 |
| 455 | Ga0495619_0002499 | 3300053085 | Bacteria | 12040 |
| 456 | Ga0495619_0029659 | 3300053085 | Bacteria | 3536 |
| 457 | Ga0495619_0501036 | 3300053085 | Bacteria | 835 |
| 458 | Ga0500578_0144737 | 3300053086 | Bacteria | 1484 |
| 459 | Ga0500578_0164443 | 3300053086 | Bacteria | 1375 |
| 460 | Ga0500643_000116 | 3300053087 | Bacteria | 83687 |
| 461 | Ga0500583_0004980 | 3300053092 | Bacteria | 4400 |
| 462 | Ga0500583_0178908 | 3300053092 | Bacteria | 1056 |
| 463 | Ga0500651_0000920 | 3300053093 | Bacteria | 14408 |
| 464 | Ga0500651_0079623 | 3300053093 | Bacteria | 2030 |
| 465 | Ga0500651_0126122 | 3300053093 | Bacteria | 1551 |
| 466 | Ga0500566_0000821 | 3300053094 | Bacteria | 17707 |
| 467 | Ga0500566_0096776 | 3300053094 | Bacteria | 1624 |
| 468 | Ga0500641_0058496 | 3300053096 | Bacteria | 1601 |
| 469 | Ga0500650_0088526 | 3300053098 | Bacteria | 1449 |
| 470 | Ga0500554_020223 | 3300053102 | Bacteria | 1827 |
| 471 | Ga0500556_0007469 | 3300053104 | Bacteria | 3127 |
| 472 | Ga0500562_006138 | 3300053108 | Bacteria | 3028 |
| 473 | Ga0500569_007442 | 3300053109 | Bacteria | 2458 |
| 474 | Ga0500572_009426 | 3300053111 | Bacteria | 2307 |
| 475 | Ga0500592_041617 | 3300053116 | Bacteria | 744 |
| 476 | Ga0500595_001014 | 3300053119 | Bacteria | 15754 |
| 477 | Ga0500595_001340 | 3300053119 | Bacteria | 13316 |
| 478 | Ga0500595_003474 | 3300053119 | Bacteria | 7332 |
| 479 | Ga0500595_005248 | 3300053119 | Bacteria | 5677 |
| 480 | Ga0500595_037375 | 3300053119 | Bacteria | 1584 |
| 481 | Ga0500608_197133 | 3300053122 | Bacteria | 836 |
| 482 | Ga0500642_0008376 | 3300053130 | Bacteria | 3536 |
| 483 | Ga0500652_063282 | 3300053131 | Bacteria | 1526 |
| 484 | Ga0500559_0161975 | 3300053136 | Bacteria | 1051 |
| 485 | Ga0500559_0176451 | 3300053136 | Bacteria | 1005 |
| 486 | Ga0500559_0241590 | 3300053136 | Bacteria | 851 |
| 487 | Ga0500568_0014289 | 3300053139 | Bacteria | 3590 |
| 488 | Ga0500577_0019644 | 3300053142 | Bacteria | 2195 |
| 489 | Ga0500590_155681 | 3300053148 | Bacteria | 1025 |
| 490 | Ga0500604_0220932 | 3300053151 | Bacteria | 653 |
| 491 | Ga0500616_0049861 | 3300053153 | Bacteria | 2213 |
| 492 | Ga0500620_003920 | 3300053155 | Bacteria | 3250 |
| 493 | Ga0500622_0051671 | 3300053156 | Bacteria | 2115 |
| 494 | Ga0500622_0097986 | 3300053156 | Bacteria | 1447 |
| 495 | Ga0500627_0011187 | 3300053158 | Bacteria | 3302 |
| 496 | Ga0500627_0115693 | 3300053158 | Bacteria | 1208 |
| 497 | Ga0500633_0093613 | 3300053160 | Bacteria | 1100 |
| 498 | Ga0500634_0071061 | 3300053161 | Bacteria | 1821 |
| 499 | Ga0500638_002337 | 3300053162 | Bacteria | 6552 |
| 500 | Ga0500638_276424 | 3300053162 | Bacteria | 661 |
| 501 | Ga0500636_0000207 | 3300053177 | Bacteria | 31845 |
| 502 | Ga0500636_0019821 | 3300053177 | Bacteria | 3977 |
| 503 | Ga0500637_0000077 | 3300053178 | Bacteria | 35359 |
| 504 | Ga0500637_0470497 | 3300053178 | Bacteria | 632 |
| 505 | Ga0500645_011128 | 3300053730 | Bacteria | 2949 |
| 506 | Ga0500645_143381 | 3300053730 | Bacteria | 660 |
| 507 | Ga0500609_002330 | 3300053731 | Bacteria | 2710 |
| 508 | Ga0500552_074627 | 3300053733 | Bacteria | 614 |
| 509 | Ga0500599_007068 | 3300053736 | Bacteria | 1439 |
| 510 | Ga0500601_000322 | 3300053737 | Bacteria | 8816 |
| 511 | Ga0501084_0007469 | 3300054114 | Bacteria | 9011 |
| 512 | Ga0500661_000100 | 3300055283 | Bacteria | 13873 |
| 513 | Ga0501082_0011999 | 3300060353 | Bacteria | 7451 |
| 514 | Ga0466962_0302393 | 3300061719 | Bacteria | 791 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046506 | Ga0495583_0268000 | Ga0495583_0268000_13_441 | 142 |
| 2 | 3300046460 | Ga0495638_0469155 | Ga0495638_0469155_50_577 | 146 |
| 3 | 3300025901 | Ga0207688_10122945 | Ga0207688_101229452 | 150 |
| 4 | 3300005436 | Ga0070713_100740724 | Ga0070713_1007407242 | 151 |
| 5 | 3300006028 | Ga0070717_10430299 | Ga0070717_104302992 | 151 |
| 6 | 3300021384 | Ga0213876_10124548 | Ga0213876_101245483 | 151 |
| 7 | 3300025928 | Ga0207700_10627712 | Ga0207700_106277122 | 151 |
| 8 | 3300025929 | Ga0207664_10108916 | Ga0207664_101089163 | 151 |
| 9 | 3300039450 | Ga0436363_1057105 | Ga0436363_1057105_330_854 | 151 |
| 10 | 3300035083 | Ga0373926_0042807 | Ga0373926_0042807_524_1048 | 152 |
| 11 | 3300035111 | Ga0373923_0004358 | Ga0373923_0004358_3618_4142 | 152 |
| 12 | 3300035170 | Ga0373943_0124126 | Ga0373943_0124126_566_1090 | 152 |
| 13 | 3300035171 | Ga0373946_0161618 | Ga0373946_0161618_357_881 | 152 |
| 14 | 3300035172 | Ga0373955_0053855 | Ga0373955_0053855_340_864 | 152 |
| 15 | 3300035410 | Ga0373924_0031720 | Ga0373924_0031720_1506_2030 | 152 |
| 16 | 3300035695 | Ga0373927_0081394 | Ga0373927_0081394_827_1351 | 152 |
| 17 | 3300035724 | Ga0373933_0070357 | Ga0373933_0070357_12_512 | 152 |
| 18 | 3300035725 | Ga0373947_0011086 | Ga0373947_0011086_4258_4782 | 152 |
| 19 | 3300036401 | Ga0373937_0328561 | Ga0373937_0328561_796_1320 | 152 |
| 20 | 3300037068 | Ga0373925_0456722 | Ga0373925_0456722_217_741 | 152 |
| 21 | 3300046459 | Ga0495629_0188724 | Ga0495629_0188724_458_982 | 152 |
| 22 | 3300046463 | Ga0495653_0594349 | Ga0495653_0594349_30_554 | 152 |
| 23 | 3300046472 | Ga0495580_0024700 | Ga0495580_0024700_186_710 | 152 |
| 24 | 3300046475 | Ga0495639_0193926 | Ga0495639_0193926_277_801 | 152 |
| 25 | 3300046476 | Ga0495662_0270520 | Ga0495662_0270520_114_638 | 152 |
| 26 | 3300046477 | Ga0495664_0017824 | Ga0495664_0017824_285_809 | 152 |
| 27 | 3300046516 | Ga0495628_0590074 | Ga0495628_0590074_39_563 | 152 |
| 28 | 3300046529 | Ga0495652_0117140 | Ga0495652_0117140_266_790 | 152 |
| 29 | 3300046531 | Ga0495665_0014870 | Ga0495665_0014870_3238_3762 | 152 |
| 30 | 3300046533 | Ga0495640_0020568 | Ga0495640_0020568_3986_4510 | 152 |
| 31 | 3300046536 | Ga0495587_0358917 | Ga0495587_0358917_26_550 | 152 |
| 32 | 3300046559 | Ga0495667_0102706 | Ga0495667_0102706_150_674 | 152 |
| 33 | 3300046642 | Ga0495634_0072683 | Ga0495634_0072683_1651_2175 | 152 |
| 34 | 3300046678 | Ga0495599_0069521 | Ga0495599_0069521_1254_1778 | 152 |
| 35 | 3300046679 | Ga0495623_0634910 | Ga0495623_0634910_10_534 | 152 |
| 36 | 3300046681 | Ga0495647_0009264 | Ga0495647_0009264_2163_2687 | 152 |
| 37 | 3300047319 | Ga0495674_0017832 | Ga0495674_0017832_5782_6306 | 152 |
| 38 | 3300047673 | Ga0495593_0374657 | Ga0495593_0374657_73_597 | 152 |
| 39 | 3300006028 | Ga0070717_10020204 | Ga0070717_100202045 | 154 |
| 40 | 3300046526 | Ga0495666_0033825 | Ga0495666_0033825_1995_2471 | 155 |
| 41 | 3300046452 | Ga0495617_037713 | Ga0495617_037713_420_944 | 156 |
| 42 | 3300005466 | Ga0070685_10619924 | Ga0070685_106199241 | 160 |
| 43 | 3300026121 | Ga0207683_10078508 | Ga0207683_100785083 | 160 |
| 44 | 3300046694 | Ga0495649_0379236 | Ga0495649_0379236_149_673 | 160 |
| 45 | 3300014325 | Ga0163163_10259460 | Ga0163163_102594603 | 161 |
| 46 | 3300014968 | Ga0157379_10235908 | Ga0157379_102359082 | 161 |
| 47 | 3300025315 | Ga0207697_10131838 | Ga0207697_101318381 | 161 |
| 48 | 3300025937 | Ga0207669_10225490 | Ga0207669_102254902 | 161 |
| 49 | 3300048917 | Ga0496114_0424581 | Ga0496114_0424581_242_766 | 161 |
| 50 | 3300006177 | Ga0075362_10111203 | Ga0075362_101112031 | 162 |
| 51 | 3300046537 | Ga0495598_0081022 | Ga0495598_0081022_323_850 | 162 |
| 52 | 3300046615 | Ga0495656_0145982 | Ga0495656_0145982_56_583 | 162 |
| 53 | 3300046684 | Ga0495669_0457170 | Ga0495669_0457170_28_555 | 162 |
| 54 | 3300046691 | Ga0495670_0066769 | Ga0495670_0066769_409_936 | 162 |
| 55 | 3300048929 | Ga0496126_0020375 | Ga0496126_0020375_2543_3082 | 163 |
| 56 | 3300006175 | Ga0070712_100473653 | Ga0070712_1004736532 | 164 |
| 57 | 3300009093 | Ga0105240_10153056 | Ga0105240_101530564 | 164 |
| 58 | 3300013104 | Ga0157370_10180463 | Ga0157370_101804631 | 164 |
| 59 | 3300013105 | Ga0157369_10005972 | Ga0157369_1000597215 | 164 |
| 60 | 3300025915 | Ga0207693_10257709 | Ga0207693_102577093 | 164 |
| 61 | 3300028800 | Ga0265338_10385541 | Ga0265338_103855411 | 164 |
| 62 | 3300031241 | Ga0265325_10122250 | Ga0265325_101222502 | 164 |
| 63 | 3300031247 | Ga0265340_10109163 | Ga0265340_101091632 | 164 |
| 64 | 3300031344 | Ga0265316_10105909 | Ga0265316_101059093 | 164 |
| 65 | 3300035086 | Ga0373934_0015387 | Ga0373934_0015387_1810_2457 | 164 |
| 66 | 3300035111 | Ga0373923_0020014 | Ga0373923_0020014_1311_1958 | 164 |
| 67 | 3300035117 | Ga0373953_0007080 | Ga0373953_0007080_3071_3718 | 164 |
| 68 | 3300035118 | Ga0373954_0030489 | Ga0373954_0030489_334_981 | 164 |
| 69 | 3300035119 | Ga0373956_0005761 | Ga0373956_0005761_1753_2400 | 164 |
| 70 | 3300035120 | Ga0373957_0003039 | Ga0373957_0003039_1312_1959 | 164 |
| 71 | 3300035172 | Ga0373955_0000352 | Ga0373955_0000352_16676_17323 | 164 |
| 72 | 3300035410 | Ga0373924_0000523 | Ga0373924_0000523_113_742 | 164 |
| 73 | 3300035724 | Ga0373933_0002766 | Ga0373933_0002766_5602_6249 | 164 |
| 74 | 3300036401 | Ga0373937_0008910 | Ga0373937_0008910_7367_8014 | 164 |
| 75 | 3300044765 | Ga0466970_0099957 | Ga0466970_0099957_425_949 | 164 |
| 76 | 3300044842 | Ga0466957_0045107 | Ga0466957_0045107_1329_1853 | 164 |
| 77 | 3300045049 | Ga0466959_0037437 | Ga0466959_0037437_2470_2994 | 164 |
| 78 | 3300045836 | Ga0466958_0112497 | Ga0466958_0112497_851_1375 | 164 |
| 79 | 3300046454 | Ga0495592_0003207 | Ga0495592_0003207_6421_7068 | 164 |
| 80 | 3300046459 | Ga0495629_0001343 | Ga0495629_0001343_13227_13874 | 164 |
| 81 | 3300046462 | Ga0495651_0033516 | Ga0495651_0033516_1853_2500 | 164 |
| 82 | 3300046463 | Ga0495653_0000212 | Ga0495653_0000212_5106_5753 | 164 |
| 83 | 3300046511 | Ga0495608_0014735 | Ga0495608_0014735_995_1642 | 164 |
| 84 | 3300046516 | Ga0495628_0007748 | Ga0495628_0007748_2988_3635 | 164 |
| 85 | 3300046529 | Ga0495652_0008265 | Ga0495652_0008265_3188_3835 | 164 |
| 86 | 3300046533 | Ga0495640_0005046 | Ga0495640_0005046_9260_9907 | 164 |
| 87 | 3300046543 | Ga0495645_0033851 | Ga0495645_0033851_447_1094 | 164 |
| 88 | 3300046559 | Ga0495667_0001112 | Ga0495667_0001112_1506_2153 | 164 |
| 89 | 3300046663 | Ga0495635_0000230 | Ga0495635_0000230_10263_10910 | 164 |
| 90 | 3300046675 | Ga0495657_0016784 | Ga0495657_0016784_1184_1831 | 164 |
| 91 | 3300046678 | Ga0495599_0000807 | Ga0495599_0000807_11638_12285 | 164 |
| 92 | 3300046680 | Ga0495646_0063995 | Ga0495646_0063995_1508_2155 | 164 |
| 93 | 3300046689 | Ga0495613_0387785 | Ga0495613_0387785_124_753 | 164 |
| 94 | 3300046809 | Ga0495600_0001064 | Ga0495600_0001064_3494_4141 | 164 |
| 95 | 3300047317 | Ga0495604_0011802 | Ga0495604_0011802_1184_1831 | 164 |
| 96 | 3300047319 | Ga0495674_0009234 | Ga0495674_0009234_5076_5723 | 164 |
| 97 | 3300047322 | Ga0495680_0001284 | Ga0495680_0001284_1506_2153 | 164 |
| 98 | 3300047444 | Ga0495675_0056589 | Ga0495675_0056589_334_981 | 164 |
| 99 | 3300047471 | Ga0495684_0000780 | Ga0495684_0000780_1934_2581 | 164 |
| 100 | 3300047673 | Ga0495593_0010013 | Ga0495593_0010013_3322_3969 | 164 |
| 101 | 3300053077 | Ga0495601_0022095 | Ga0495601_0022095_809_1456 | 164 |
| 102 | 3300053084 | Ga0495595_0001005 | Ga0495595_0001005_6497_7144 | 164 |
| 103 | 3300053085 | Ga0495619_0002499 | Ga0495619_0002499_10948_11595 | 164 |
| 104 | 3300061719 | Ga0466962_0302393 | Ga0466962_0302393_222_746 | 164 |
| 105 | 3300005539 | Ga0068853_100967380 | Ga0068853_1009673801 | 165 |
| 106 | 3300005563 | Ga0068855_100657564 | Ga0068855_1006575642 | 165 |
| 107 | 3300013307 | Ga0157372_10185231 | Ga0157372_101852316 | 165 |
| 108 | 3300025913 | Ga0207695_10220511 | Ga0207695_102205113 | 165 |
| 109 | 3300026041 | Ga0207639_10243516 | Ga0207639_102435161 | 165 |
| 110 | 3300037418 | Ga0395900_0012630 | Ga0395900_0012630_2977_3501 | 165 |
| 111 | 3300037466 | Ga0395898_0039217 | Ga0395898_0039217_1613_2137 | 165 |
| 112 | 3300048910 | Ga0496107_0658580 | Ga0496107_0658580_216_749 | 165 |
| 113 | 3300005338 | Ga0068868_100998243 | Ga0068868_1009982431 | 167 |
| 114 | 3300005347 | Ga0070668_100428482 | Ga0070668_1004284822 | 167 |
| 115 | 3300005354 | Ga0070675_100226787 | Ga0070675_1002267873 | 167 |
| 116 | 3300005548 | Ga0070665_100144836 | Ga0070665_1001448363 | 167 |
| 117 | 3300005564 | Ga0070664_100616868 | Ga0070664_1006168682 | 167 |
| 118 | 3300005617 | Ga0068859_100224943 | Ga0068859_1002249433 | 167 |
| 119 | 3300005841 | Ga0068863_102245725 | Ga0068863_1022457251 | 167 |
| 120 | 3300005842 | Ga0068858_100154566 | Ga0068858_1001545663 | 167 |
| 121 | 3300005843 | Ga0068860_100862141 | Ga0068860_1008621412 | 167 |
| 122 | 3300006931 | Ga0097620_100224942 | Ga0097620_1002249423 | 167 |
| 123 | 3300009101 | Ga0105247_10137489 | Ga0105247_101374892 | 167 |
| 124 | 3300009177 | Ga0105248_10775796 | Ga0105248_107757961 | 167 |
| 125 | 3300013308 | Ga0157375_10279496 | Ga0157375_102794962 | 167 |
| 126 | 3300014745 | Ga0157377_10497228 | Ga0157377_104972282 | 167 |
| 127 | 3300025925 | Ga0207650_10138421 | Ga0207650_101384213 | 167 |
| 128 | 3300025926 | Ga0207659_10476852 | Ga0207659_104768522 | 167 |
| 129 | 3300025941 | Ga0207711_10845387 | Ga0207711_108453872 | 167 |
| 130 | 3300025960 | Ga0207651_10514851 | Ga0207651_105148512 | 167 |
| 131 | 3300025972 | Ga0207668_10521461 | Ga0207668_105214611 | 167 |
| 132 | 3300025986 | Ga0207658_10396621 | Ga0207658_103966212 | 167 |
| 133 | 3300026067 | Ga0207678_10178299 | Ga0207678_101782992 | 167 |
| 134 | 3300026118 | Ga0207675_100579471 | Ga0207675_1005794713 | 167 |
| 135 | 3300028379 | Ga0268266_10239305 | Ga0268266_102393053 | 167 |
| 136 | 3300028380 | Ga0268265_10354808 | Ga0268265_103548082 | 167 |
| 137 | 3300035113 | Ga0373936_0030840 | Ga0373936_0030840_1456_1977 | 167 |
| 138 | 3300035170 | Ga0373943_0014337 | Ga0373943_0014337_1699_2220 | 167 |
| 139 | 3300035171 | Ga0373946_0004813 | Ga0373946_0004813_1263_1784 | 167 |
| 140 | 3300035242 | Ga0373962_0072821 | Ga0373962_0072821_205_729 | 167 |
| 141 | 3300035695 | Ga0373927_0000432 | Ga0373927_0000432_21767_22288 | 167 |
| 142 | 3300046454 | Ga0495592_0026570 | Ga0495592_0026570_3084_3605 | 167 |
| 143 | 3300046455 | Ga0495603_0000067 | Ga0495603_0000067_21827_22348 | 167 |
| 144 | 3300046459 | Ga0495629_0003475 | Ga0495629_0003475_3333_3854 | 167 |
| 145 | 3300046460 | Ga0495638_0083169 | Ga0495638_0083169_461_985 | 167 |
| 146 | 3300046471 | Ga0495650_0062817 | Ga0495650_0062817_88_612 | 167 |
| 147 | 3300046472 | Ga0495580_0002382 | Ga0495580_0002382_10639_11160 | 167 |
| 148 | 3300046473 | Ga0495582_0000049 | Ga0495582_0000049_54455_54976 | 167 |
| 149 | 3300046475 | Ga0495639_0000106 | Ga0495639_0000106_36086_36607 | 167 |
| 150 | 3300046476 | Ga0495662_0000276 | Ga0495662_0000276_5004_5525 | 167 |
| 151 | 3300046477 | Ga0495664_0180986 | Ga0495664_0180986_742_1263 | 167 |
| 152 | 3300046499 | Ga0495594_0001204 | Ga0495594_0001204_11165_11686 | 167 |
| 153 | 3300046516 | Ga0495628_0105386 | Ga0495628_0105386_353_874 | 167 |
| 154 | 3300046517 | Ga0495630_0177159 | Ga0495630_0177159_1050_1571 | 167 |
| 155 | 3300046519 | Ga0495632_0045378 | Ga0495632_0045378_47_571 | 167 |
| 156 | 3300046524 | Ga0495648_0293600 | Ga0495648_0293600_192_716 | 167 |
| 157 | 3300046529 | Ga0495652_0092591 | Ga0495652_0092591_1508_2029 | 167 |
| 158 | 3300046531 | Ga0495665_0000307 | Ga0495665_0000307_22080_22601 | 167 |
| 159 | 3300046533 | Ga0495640_0006166 | Ga0495640_0006166_8700_9221 | 167 |
| 160 | 3300046557 | Ga0495622_0026769 | Ga0495622_0026769_991_1512 | 167 |
| 161 | 3300046642 | Ga0495634_0000267 | Ga0495634_0000267_3111_3632 | 167 |
| 162 | 3300046663 | Ga0495635_0004002 | Ga0495635_0004002_4485_5006 | 167 |
| 163 | 3300046674 | Ga0495588_0020296 | Ga0495588_0020296_1458_1979 | 167 |
| 164 | 3300046678 | Ga0495599_0331094 | Ga0495599_0331094_45_566 | 167 |
| 165 | 3300046680 | Ga0495646_0309798 | Ga0495646_0309798_208_729 | 167 |
| 166 | 3300046681 | Ga0495647_0001002 | Ga0495647_0001002_371_892 | 167 |
| 167 | 3300046683 | Ga0495658_0023717 | Ga0495658_0023717_1134_1655 | 167 |
| 168 | 3300046689 | Ga0495613_0003663 | Ga0495613_0003663_4887_5408 | 167 |
| 169 | 3300046690 | Ga0495624_0001957 | Ga0495624_0001957_15021_15542 | 167 |
| 170 | 3300046809 | Ga0495600_0109318 | Ga0495600_0109318_788_1309 | 167 |
| 171 | 3300047315 | Ga0495581_0000022 | Ga0495581_0000022_21798_22319 | 167 |
| 172 | 3300047317 | Ga0495604_0071571 | Ga0495604_0071571_1292_1813 | 167 |
| 173 | 3300047319 | Ga0495674_0000629 | Ga0495674_0000629_31259_31780 | 167 |
| 174 | 3300047321 | Ga0495676_0026326 | Ga0495676_0026326_3172_3693 | 167 |
| 175 | 3300047469 | Ga0495673_0165793 | Ga0495673_0165793_213_737 | 167 |
| 176 | 3300047673 | Ga0495593_0000016 | Ga0495593_0000016_57027_57548 | 167 |
| 177 | 3300048088 | Ga0495602_0395223 | Ga0495602_0395223_263_784 | 167 |
| 178 | 3300048089 | Ga0495614_0076996 | Ga0495614_0076996_558_1079 | 167 |
| 179 | 3300048909 | Ga0496106_1042573 | Ga0496106_1042573_89_613 | 167 |
| 180 | 3300048911 | Ga0496108_0259768 | Ga0496108_0259768_48_572 | 167 |
| 181 | 3300048915 | Ga0496112_0199872 | Ga0496112_0199872_277_801 | 167 |
| 182 | 3300048924 | Ga0496121_0164697 | Ga0496121_0164697_1029_1553 | 167 |
| 183 | 3300048927 | Ga0496124_0652632 | Ga0496124_0652632_114_638 | 167 |
| 184 | 3300048929 | Ga0496126_0335223 | Ga0496126_0335223_133_657 | 167 |
| 185 | iso_pu_bacteria | 2879099564 | 2879108180 | 167 |
| 186 | iso_pu_bacteria | 2932818245 | 2932820758 | 167 |
| 187 | iso_pu_bacteria | 2935616580 | 2935621832 | 167 |
| 188 | iso_pu_bacteria | 2935694250 | 2935695981 | 167 |
| 189 | iso_pu_bacteria | 2935703347 | 2935706720 | 167 |
| 190 | iso_pu_bacteria | 2935760218 | 2935763154 | 167 |
| 191 | iso_pu_bacteria | 2935855204 | 2935860079 | 167 |
| 192 | iso_pu_bacteria | 2935864058 | 2935869286 | 167 |
| 193 | iso_pu_bacteria | 2935873716 | 2935880553 | 167 |
| 194 | iso_pu_bacteria | 2935992306 | 2935996279 | 167 |
| 195 | iso_pu_bacteria | 2936002035 | 2936006413 | 167 |
| 196 | iso_pu_bacteria | 8019576017 | 8019581929 | 167 |
| 197 | iso_pu_bacteria | 8019586578 | 8019589609 | 167 |
| 198 | iso_pu_bacteria | 8019597564 | 8019601659 | 167 |
| 199 | iso_pu_bacteria | 8019608314 | 8019616890 | 167 |
| 200 | 3300005334 | Ga0068869_100149478 | Ga0068869_1001494783 | 168 |
| 201 | 3300005546 | Ga0070696_100074055 | Ga0070696_1000740553 | 168 |
| 202 | 3300005615 | Ga0070702_100348159 | Ga0070702_1003481591 | 168 |
| 203 | 3300009545 | Ga0105237_10601188 | Ga0105237_106011882 | 168 |
| 204 | 3300028573 | Ga0265334_10139435 | Ga0265334_101394351 | 168 |
| 205 | 3300025254 | Ga0209148_1000258 | Ga0209148_100025837 | 169 |
| 206 | 3300025261 | Ga0209233_1003783 | Ga0209233_10037837 | 169 |
| 207 | 3300025261 | Ga0209233_1008098 | Ga0209233_10080983 | 169 |
| 208 | 3300025272 | Ga0209455_1004545 | Ga0209455_10045456 | 169 |
| 209 | 3300025272 | Ga0209455_1007471 | Ga0209455_10074715 | 169 |
| 210 | 3300025321 | Ga0207656_10395183 | Ga0207656_103951831 | 169 |
| 211 | 3300031711 | Ga0265314_10024131 | Ga0265314_100241312 | 169 |
| 212 | 3300031712 | Ga0265342_10120996 | Ga0265342_101209964 | 169 |
| 213 | 3300037853 | Ga0436364_0424493 | Ga0436364_0424493_1045_1563 | 169 |
| 214 | 3300046524 | Ga0495648_0115269 | Ga0495648_0115269_496_1005 | 169 |
| 215 | 3300047472 | Ga0495686_0257078 | Ga0495686_0257078_15_524 | 169 |
| 216 | 3300048922 | Ga0496119_0149454 | Ga0496119_0149454_314_841 | 169 |
| 217 | 3300048924 | Ga0496121_0050471 | Ga0496121_0050471_2516_3043 | 169 |
| 218 | 3300048929 | Ga0496126_0064043 | Ga0496126_0064043_324_851 | 169 |
| 219 | 3300048929 | Ga0496126_0170003 | Ga0496126_0170003_66_593 | 169 |
| 220 | 3300053119 | Ga0500595_001014 | Ga0500595_001014_10495_11022 | 169 |
| 221 | 3300005445 | Ga0070708_100433906 | Ga0070708_1004339062 | 170 |
| 222 | 3300005468 | Ga0070707_100324803 | Ga0070707_1003248032 | 170 |
| 223 | 3300005471 | Ga0070698_100085336 | Ga0070698_1000853361 | 170 |
| 224 | 3300005536 | Ga0070697_100213085 | Ga0070697_1002130852 | 170 |
| 225 | 3300005983 | Ga0081540_1006213 | Ga0081540_10062138 | 170 |
| 226 | 3300013102 | Ga0157371_10309862 | Ga0157371_103098622 | 170 |
| 227 | 3300013104 | Ga0157370_10211757 | Ga0157370_102117573 | 170 |
| 228 | 3300021388 | Ga0213875_10198375 | Ga0213875_101983751 | 170 |
| 229 | 3300025254 | Ga0209148_1047697 | Ga0209148_10476971 | 170 |
| 230 | 3300025949 | Ga0207667_10763277 | Ga0207667_107632772 | 170 |
| 231 | 3300037853 | Ga0436364_0767258 | Ga0436364_0767258_377_898 | 170 |
| 232 | 3300046530 | Ga0495654_0204137 | Ga0495654_0204137_258_788 | 170 |
| 233 | 3300048909 | Ga0496106_0014425 | Ga0496106_0014425_2413_3027 | 170 |
| 234 | 3300048910 | Ga0496107_0012037 | Ga0496107_0012037_2954_3568 | 170 |
| 235 | 3300048911 | Ga0496108_0091518 | Ga0496108_0091518_282_896 | 170 |
| 236 | 3300048912 | Ga0496109_0018354 | Ga0496109_0018354_3107_3721 | 170 |
| 237 | 3300048913 | Ga0496110_0027198 | Ga0496110_0027198_1226_1840 | 170 |
| 238 | 3300048914 | Ga0496111_0108112 | Ga0496111_0108112_478_1092 | 170 |
| 239 | 3300048915 | Ga0496112_0044236 | Ga0496112_0044236_3134_3748 | 170 |
| 240 | 3300048916 | Ga0496113_0130974 | Ga0496113_0130974_873_1487 | 170 |
| 241 | 3300048918 | Ga0496115_0241991 | Ga0496115_0241991_761_1375 | 170 |
| 242 | 3300048921 | Ga0496118_0143848 | Ga0496118_0143848_772_1302 | 170 |
| 243 | 3300049568 | Ga0501031_0000186 | Ga0501031_0000186_468_989 | 170 |
| 244 | 3300049569 | Ga0501032_0005876 | Ga0501032_0005876_4064_4585 | 170 |
| 245 | 3300049570 | Ga0501033_0000098 | Ga0501033_0000098_68996_69517 | 170 |
| 246 | 3300049571 | Ga0501034_0001197 | Ga0501034_0001197_11665_12186 | 170 |
| 247 | 3300049572 | Ga0501036_0001134 | Ga0501036_0001134_15026_15547 | 170 |
| 248 | 3300049573 | Ga0501037_0000069 | Ga0501037_0000069_73982_74503 | 170 |
| 249 | 3300049574 | Ga0501038_0000034 | Ga0501038_0000034_110622_111143 | 170 |
| 250 | 3300049575 | Ga0501039_0000580 | Ga0501039_0000580_4218_4739 | 170 |
| 251 | 3300049576 | Ga0501040_0845500 | Ga0501040_0845500_56_577 | 170 |
| 252 | 3300049579 | Ga0501043_0000130 | Ga0501043_0000130_61803_62324 | 170 |
| 253 | 3300049580 | Ga0501046_0001236 | Ga0501046_0001236_2008_2529 | 170 |
| 254 | 3300049581 | Ga0501047_0000758 | Ga0501047_0000758_10980_11501 | 170 |
| 255 | 3300049582 | Ga0501048_0003629 | Ga0501048_0003629_4564_5085 | 170 |
| 256 | 3300049583 | Ga0501067_0000264 | Ga0501067_0000264_26954_27475 | 170 |
| 257 | 3300049584 | Ga0501068_0011959 | Ga0501068_0011959_2817_3338 | 170 |
| 258 | 3300049585 | Ga0501069_0226491 | Ga0501069_0226491_25_546 | 170 |
| 259 | 3300049586 | Ga0501070_0004609 | Ga0501070_0004609_9581_10102 | 170 |
| 260 | 3300049588 | Ga0501072_0012220 | Ga0501072_0012220_4659_5180 | 170 |
| 261 | 3300049589 | Ga0501073_0000532 | Ga0501073_0000532_20786_21307 | 170 |
| 262 | 3300049590 | Ga0501074_0007521 | Ga0501074_0007521_1199_1720 | 170 |
| 263 | 3300049742 | Ga0501080_0014171 | Ga0501080_0014171_2490_3011 | 170 |
| 264 | 3300049744 | Ga0501083_0000590 | Ga0501083_0000590_16344_16865 | 170 |
| 265 | 3300049822 | Ga0501035_0000970 | Ga0501035_0000970_12225_12746 | 170 |
| 266 | 3300049823 | Ga0501044_0000725 | Ga0501044_0000725_21677_22198 | 170 |
| 267 | 3300049824 | Ga0501045_0019911 | Ga0501045_0019911_4203_4724 | 170 |
| 268 | 3300053092 | Ga0500583_0178908 | Ga0500583_0178908_366_896 | 170 |
| 269 | 3300053093 | Ga0500651_0000920 | Ga0500651_0000920_5730_6260 | 170 |
| 270 | 3300053096 | Ga0500641_0058496 | Ga0500641_0058496_171_701 | 170 |
| 271 | 3300053116 | Ga0500592_041617 | Ga0500592_041617_70_600 | 170 |
| 272 | 3300053119 | Ga0500595_005248 | Ga0500595_005248_2488_3018 | 170 |
| 273 | 3300053119 | Ga0500595_037375 | Ga0500595_037375_214_744 | 170 |
| 274 | 3300053130 | Ga0500642_0008376 | Ga0500642_0008376_1105_1635 | 170 |
| 275 | 3300053151 | Ga0500604_0220932 | Ga0500604_0220932_92_622 | 170 |
| 276 | 3300053156 | Ga0500622_0051671 | Ga0500622_0051671_1529_2059 | 170 |
| 277 | 3300053158 | Ga0500627_0115693 | Ga0500627_0115693_488_1018 | 170 |
| 278 | 3300053177 | Ga0500636_0019821 | Ga0500636_0019821_1942_2472 | 170 |
| 279 | 3300054114 | Ga0501084_0007469 | Ga0501084_0007469_7063_7584 | 170 |
| 280 | 3300060353 | Ga0501082_0011999 | Ga0501082_0011999_768_1289 | 170 |
| 281 | 3300003215 | JGI25153J46596_10023618 | JGI25153J46596_100236182 | 171 |
| 282 | 3300003215 | JGI25153J46596_10025855 | JGI25153J46596_100258553 | 171 |
| 283 | 3300003322 | rootL2_10097589 | rootL2_100975892 | 171 |
| 284 | 3300003323 | rootH1_10027936 | rootH1_100279365 | 171 |
| 285 | 3300005262 | Ga0065165_1009387 | Ga0065165_10093874 | 171 |
| 286 | 3300005262 | Ga0065165_1047408 | Ga0065165_10474083 | 171 |
| 287 | 3300005331 | Ga0070670_100209930 | Ga0070670_1002099304 | 171 |
| 288 | 3300005335 | Ga0070666_10069776 | Ga0070666_100697765 | 171 |
| 289 | 3300005336 | Ga0070680_100430953 | Ga0070680_1004309531 | 171 |
| 290 | 3300005338 | Ga0068868_100358053 | Ga0068868_1003580531 | 171 |
| 291 | 3300005347 | Ga0070668_100040420 | Ga0070668_1000404204 | 171 |
| 292 | 3300005347 | Ga0070668_100639909 | Ga0070668_1006399092 | 171 |
| 293 | 3300005355 | Ga0070671_100249779 | Ga0070671_1002497794 | 171 |
| 294 | 3300005367 | Ga0070667_100507490 | Ga0070667_1005074902 | 171 |
| 295 | 3300005367 | Ga0070667_100574971 | Ga0070667_1005749712 | 171 |
| 296 | 3300005434 | Ga0070709_10568020 | Ga0070709_105680201 | 171 |
| 297 | 3300005455 | Ga0070663_100091642 | Ga0070663_1000916423 | 171 |
| 298 | 3300005457 | Ga0070662_100158312 | Ga0070662_1001583123 | 171 |
| 299 | 3300005530 | Ga0070679_100739886 | Ga0070679_1007398862 | 171 |
| 300 | 3300005539 | Ga0068853_100348531 | Ga0068853_1003485313 | 171 |
| 301 | 3300005546 | Ga0070696_100507653 | Ga0070696_1005076532 | 171 |
| 302 | 3300005547 | Ga0070693_100739646 | Ga0070693_1007396461 | 171 |
| 303 | 3300005548 | Ga0070665_100070981 | Ga0070665_1000709814 | 171 |
| 304 | 3300005548 | Ga0070665_100635498 | Ga0070665_1006354981 | 171 |
| 305 | 3300005548 | Ga0070665_100786374 | Ga0070665_1007863742 | 171 |
| 306 | 3300005563 | Ga0068855_101455801 | Ga0068855_1014558011 | 171 |
| 307 | 3300005577 | Ga0068857_100110928 | Ga0068857_1001109283 | 171 |
| 308 | 3300005578 | Ga0068854_100242225 | Ga0068854_1002422252 | 171 |
| 309 | 3300005614 | Ga0068856_100000919 | Ga0068856_10000091935 | 171 |
| 310 | 3300005616 | Ga0068852_101287002 | Ga0068852_1012870022 | 171 |
| 311 | 3300005841 | Ga0068863_100810650 | Ga0068863_1008106502 | 171 |
| 312 | 3300005844 | Ga0068862_101367870 | Ga0068862_1013678701 | 171 |
| 313 | 3300005983 | Ga0081540_1014958 | Ga0081540_10149583 | 171 |
| 314 | 3300006038 | Ga0075365_10047264 | Ga0075365_100472644 | 171 |
| 315 | 3300006042 | Ga0075368_10003302 | Ga0075368_100033027 | 171 |
| 316 | 3300006042 | Ga0075368_10009924 | Ga0075368_100099246 | 171 |
| 317 | 3300006048 | Ga0075363_100056159 | Ga0075363_1000561593 | 171 |
| 318 | 3300006051 | Ga0075364_10019540 | Ga0075364_100195404 | 171 |
| 319 | 3300006178 | Ga0075367_10040446 | Ga0075367_100404464 | 171 |
| 320 | 3300006186 | Ga0075369_10021722 | Ga0075369_100217225 | 171 |
| 321 | 3300006186 | Ga0075369_10265439 | Ga0075369_102654392 | 171 |
| 322 | 3300006353 | Ga0075370_10068087 | Ga0075370_100680872 | 171 |
| 323 | 3300006358 | Ga0068871_100079454 | Ga0068871_1000794545 | 171 |
| 324 | 3300006881 | Ga0068865_100166388 | Ga0068865_1001663883 | 171 |
| 325 | 3300009093 | Ga0105240_10172526 | Ga0105240_101725262 | 171 |
| 326 | 3300009093 | Ga0105240_10775999 | Ga0105240_107759991 | 171 |
| 327 | 3300009093 | Ga0105240_11160997 | Ga0105240_111609972 | 171 |
| 328 | 3300009101 | Ga0105247_10038756 | Ga0105247_100387563 | 171 |
| 329 | 3300009101 | Ga0105247_10215034 | Ga0105247_102150342 | 171 |
| 330 | 3300009177 | Ga0105248_10565739 | Ga0105248_105657392 | 171 |
| 331 | 3300009545 | Ga0105237_10053970 | Ga0105237_100539703 | 171 |
| 332 | 3300009545 | Ga0105237_10121328 | Ga0105237_101213284 | 171 |
| 333 | 3300009545 | Ga0105237_11455634 | Ga0105237_114556341 | 171 |
| 334 | 3300009551 | Ga0105238_10333454 | Ga0105238_103334542 | 171 |
| 335 | 3300009551 | Ga0105238_10479829 | Ga0105238_104798292 | 171 |
| 336 | 3300009553 | Ga0105249_10344315 | Ga0105249_103443152 | 171 |
| 337 | 3300010375 | Ga0105239_10156417 | Ga0105239_101564172 | 171 |
| 338 | 3300010375 | Ga0105239_10754936 | Ga0105239_107549361 | 171 |
| 339 | 3300010375 | Ga0105239_10987239 | Ga0105239_109872392 | 171 |
| 340 | 3300011119 | Ga0105246_10012729 | Ga0105246_100127297 | 171 |
| 341 | 3300013306 | Ga0163162_11059044 | Ga0163162_110590441 | 171 |
| 342 | 3300013308 | Ga0157375_10248577 | Ga0157375_102485771 | 171 |
| 343 | 3300014325 | Ga0163163_10018720 | Ga0163163_100187203 | 171 |
| 344 | 3300014325 | Ga0163163_10153884 | Ga0163163_101538844 | 171 |
| 345 | 3300014497 | Ga0182008_10107029 | Ga0182008_101070292 | 171 |
| 346 | 3300025230 | Ga0209563_103371 | Ga0209563_1033712 | 171 |
| 347 | 3300025253 | Ga0209677_106255 | Ga0209677_1062556 | 171 |
| 348 | 3300025272 | Ga0209455_1031803 | Ga0209455_10318032 | 171 |
| 349 | 3300025295 | Ga0209564_1002963 | Ga0209564_10029634 | 171 |
| 350 | 3300025297 | Ga0209758_1000775 | Ga0209758_100077528 | 171 |
| 351 | 3300025297 | Ga0209758_1005565 | Ga0209758_10055658 | 171 |
| 352 | 3300025299 | Ga0209256_1056840 | Ga0209256_10568402 | 171 |
| 353 | 3300025302 | Ga0207426_1000661 | Ga0207426_100066125 | 171 |
| 354 | 3300025304 | Ga0209257_1010306 | Ga0209257_10103067 | 171 |
| 355 | 3300025315 | Ga0207697_10029821 | Ga0207697_100298212 | 171 |
| 356 | 3300025906 | Ga0207699_10185362 | Ga0207699_101853623 | 171 |
| 357 | 3300025913 | Ga0207695_10545112 | Ga0207695_105451121 | 171 |
| 358 | 3300025914 | Ga0207671_10165762 | Ga0207671_101657622 | 171 |
| 359 | 3300025914 | Ga0207671_10907025 | Ga0207671_109070251 | 171 |
| 360 | 3300025917 | Ga0207660_10381730 | Ga0207660_103817302 | 171 |
| 361 | 3300025921 | Ga0207652_10672795 | Ga0207652_106727953 | 171 |
| 362 | 3300025924 | Ga0207694_10224526 | Ga0207694_102245262 | 171 |
| 363 | 3300025925 | Ga0207650_10055612 | Ga0207650_100556123 | 171 |
| 364 | 3300025931 | Ga0207644_10333958 | Ga0207644_103339582 | 171 |
| 365 | 3300025933 | Ga0207706_10070933 | Ga0207706_100709333 | 171 |
| 366 | 3300025938 | Ga0207704_10523644 | Ga0207704_105236442 | 171 |
| 367 | 3300025972 | Ga0207668_10329701 | Ga0207668_103297012 | 171 |
| 368 | 3300025981 | Ga0207640_10289010 | Ga0207640_102890102 | 171 |
| 369 | 3300025986 | Ga0207658_10279774 | Ga0207658_102797742 | 171 |
| 370 | 3300026023 | Ga0207677_10177885 | Ga0207677_101778852 | 171 |
| 371 | 3300026035 | Ga0207703_10184668 | Ga0207703_101846684 | 171 |
| 372 | 3300026041 | Ga0207639_10270299 | Ga0207639_102702993 | 171 |
| 373 | 3300026041 | Ga0207639_10340693 | Ga0207639_103406932 | 171 |
| 374 | 3300026067 | Ga0207678_10042160 | Ga0207678_100421604 | 171 |
| 375 | 3300026067 | Ga0207678_10084749 | Ga0207678_100847495 | 171 |
| 376 | 3300026078 | Ga0207702_10000257 | Ga0207702_1000025727 | 171 |
| 377 | 3300026078 | Ga0207702_10716305 | Ga0207702_107163052 | 171 |
| 378 | 3300026121 | Ga0207683_10391437 | Ga0207683_103914373 | 171 |
| 379 | 3300026142 | Ga0207698_10833167 | Ga0207698_108331671 | 171 |
| 380 | 3300027866 | Ga0209813_10078767 | Ga0209813_100787672 | 171 |
| 381 | 3300028379 | Ga0268266_10572857 | Ga0268266_105728571 | 171 |
| 382 | 3300028380 | Ga0268265_10522862 | Ga0268265_105228622 | 171 |
| 383 | 3300031235 | Ga0265330_10026658 | Ga0265330_100266584 | 171 |
| 384 | 3300031712 | Ga0265342_10008945 | Ga0265342_100089455 | 171 |
| 385 | 3300033180 | Ga0307510_10011579 | Ga0307510_100115795 | 171 |
| 386 | 3300036401 | Ga0373937_0182000 | Ga0373937_0182000_949_1464 | 171 |
| 387 | 3300037471 | Ga0395905_0152558 | Ga0395905_0152558_1483_1998 | 171 |
| 388 | 3300037471 | Ga0395905_0261312 | Ga0395905_0261312_1034_1549 | 171 |
| 389 | 3300044684 | Ga0466966_0000600 | Ga0466966_0000600_21622_22176 | 171 |
| 390 | 3300044693 | Ga0466961_0000162 | Ga0466961_0000162_20294_20848 | 171 |
| 391 | 3300045049 | Ga0466959_0103596 | Ga0466959_0103596_319_873 | 171 |
| 392 | 3300046460 | Ga0495638_0019840 | Ga0495638_0019840_1735_2250 | 171 |
| 393 | 3300046462 | Ga0495651_0033028 | Ga0495651_0033028_148_663 | 171 |
| 394 | 3300046463 | Ga0495653_0086472 | Ga0495653_0086472_894_1409 | 171 |
| 395 | 3300046474 | Ga0495605_0136905 | Ga0495605_0136905_289_804 | 171 |
| 396 | 3300046477 | Ga0495664_0070837 | Ga0495664_0070837_1390_1905 | 171 |
| 397 | 3300046500 | Ga0495596_0208664 | Ga0495596_0208664_21_536 | 171 |
| 398 | 3300046514 | Ga0495618_0235523 | Ga0495618_0235523_124_639 | 171 |
| 399 | 3300046517 | Ga0495630_0264558 | Ga0495630_0264558_52_567 | 171 |
| 400 | 3300046519 | Ga0495632_0070631 | Ga0495632_0070631_790_1305 | 171 |
| 401 | 3300046522 | Ga0495643_0060232 | Ga0495643_0060232_544_1059 | 171 |
| 402 | 3300046522 | Ga0495643_0219778 | Ga0495643_0219778_71_586 | 171 |
| 403 | 3300046524 | Ga0495648_0095903 | Ga0495648_0095903_365_880 | 171 |
| 404 | 3300046524 | Ga0495648_0184406 | Ga0495648_0184406_465_980 | 171 |
| 405 | 3300046533 | Ga0495640_0038036 | Ga0495640_0038036_2205_2720 | 171 |
| 406 | 3300046536 | Ga0495587_0014477 | Ga0495587_0014477_3750_4265 | 171 |
| 407 | 3300046557 | Ga0495622_0123885 | Ga0495622_0123885_463_978 | 171 |
| 408 | 3300046663 | Ga0495635_0038800 | Ga0495635_0038800_1103_1618 | 171 |
| 409 | 3300046675 | Ga0495657_0024124 | Ga0495657_0024124_3289_3804 | 171 |
| 410 | 3300046675 | Ga0495657_0072863 | Ga0495657_0072863_888_1403 | 171 |
| 411 | 3300046678 | Ga0495599_0027325 | Ga0495599_0027325_132_647 | 171 |
| 412 | 3300046679 | Ga0495623_0010742 | Ga0495623_0010742_2531_3046 | 171 |
| 413 | 3300046680 | Ga0495646_0029561 | Ga0495646_0029561_2273_2788 | 171 |
| 414 | 3300046680 | Ga0495646_0435495 | Ga0495646_0435495_115_630 | 171 |
| 415 | 3300046689 | Ga0495613_0064321 | Ga0495613_0064321_1271_1786 | 171 |
| 416 | 3300046692 | Ga0495671_0166017 | Ga0495671_0166017_253_768 | 171 |
| 417 | 3300046692 | Ga0495671_0289360 | Ga0495671_0289360_122_637 | 171 |
| 418 | 3300046694 | Ga0495649_0323226 | Ga0495649_0323226_101_616 | 171 |
| 419 | 3300046809 | Ga0495600_0012503 | Ga0495600_0012503_4197_4712 | 171 |
| 420 | 3300047315 | Ga0495581_0127080 | Ga0495581_0127080_908_1423 | 171 |
| 421 | 3300047317 | Ga0495604_0011818 | Ga0495604_0011818_2964_3479 | 171 |
| 422 | 3300047317 | Ga0495604_0046272 | Ga0495604_0046272_203_718 | 171 |
| 423 | 3300047321 | Ga0495676_0211927 | Ga0495676_0211927_743_1258 | 171 |
| 424 | 3300047322 | Ga0495680_0039557 | Ga0495680_0039557_938_1453 | 171 |
| 425 | 3300047323 | Ga0495683_0354052 | Ga0495683_0354052_22_537 | 171 |
| 426 | 3300047443 | Ga0495687_111123 | Ga0495687_111123_161_676 | 171 |
| 427 | 3300047444 | Ga0495675_0008311 | Ga0495675_0008311_3648_4163 | 171 |
| 428 | 3300047469 | Ga0495673_0105851 | Ga0495673_0105851_556_1071 | 171 |
| 429 | 3300047471 | Ga0495684_0154898 | Ga0495684_0154898_590_1105 | 171 |
| 430 | 3300047472 | Ga0495686_0054318 | Ga0495686_0054318_274_789 | 171 |
| 431 | 3300047472 | Ga0495686_0395143 | Ga0495686_0395143_177_713 | 171 |
| 432 | 3300048088 | Ga0495602_0035202 | Ga0495602_0035202_1900_2415 | 171 |
| 433 | 3300048088 | Ga0495602_0335554 | Ga0495602_0335554_322_837 | 171 |
| 434 | 3300048091 | Ga0495626_0236976 | Ga0495626_0236976_206_721 | 171 |
| 435 | 3300048903 | Ga0496100_0121082 | Ga0496100_0121082_1130_1645 | 171 |
| 436 | 3300048904 | Ga0496101_0175126 | Ga0496101_0175126_892_1407 | 171 |
| 437 | 3300048904 | Ga0496101_0493564 | Ga0496101_0493564_377_892 | 171 |
| 438 | 3300048905 | Ga0496102_0059942 | Ga0496102_0059942_131_766 | 171 |
| 439 | 3300048907 | Ga0496104_0007051 | Ga0496104_0007051_6699_7214 | 171 |
| 440 | 3300048907 | Ga0496104_0290575 | Ga0496104_0290575_160_675 | 171 |
| 441 | 3300048908 | Ga0496105_0084340 | Ga0496105_0084340_79_594 | 171 |
| 442 | 3300048909 | Ga0496106_0066949 | Ga0496106_0066949_1026_1541 | 171 |
| 443 | 3300048910 | Ga0496107_0123826 | Ga0496107_0123826_267_782 | 171 |
| 444 | 3300048911 | Ga0496108_0153847 | Ga0496108_0153847_67_582 | 171 |
| 445 | 3300048911 | Ga0496108_0512894 | Ga0496108_0512894_16_531 | 171 |
| 446 | 3300048915 | Ga0496112_0398380 | Ga0496112_0398380_742_1257 | 171 |
| 447 | 3300048918 | Ga0496115_0064231 | Ga0496115_0064231_842_1357 | 171 |
| 448 | 3300048918 | Ga0496115_0435646 | Ga0496115_0435646_267_782 | 171 |
| 449 | 3300048919 | Ga0496116_0030517 | Ga0496116_0030517_245_760 | 171 |
| 450 | 3300048920 | Ga0496117_0127773 | Ga0496117_0127773_873_1388 | 171 |
| 451 | 3300048920 | Ga0496117_0248424 | Ga0496117_0248424_375_890 | 171 |
| 452 | 3300048921 | Ga0496118_0091999 | Ga0496118_0091999_35_550 | 171 |
| 453 | 3300048921 | Ga0496118_0515665 | Ga0496118_0515665_28_543 | 171 |
| 454 | 3300048922 | Ga0496119_0007812 | Ga0496119_0007812_8978_9493 | 171 |
| 455 | 3300048922 | Ga0496119_0093996 | Ga0496119_0093996_215_730 | 171 |
| 456 | 3300048922 | Ga0496119_0286946 | Ga0496119_0286946_185_700 | 171 |
| 457 | 3300048923 | Ga0496120_0018530 | Ga0496120_0018530_606_1121 | 171 |
| 458 | 3300048923 | Ga0496120_0026275 | Ga0496120_0026275_2828_3343 | 171 |
| 459 | 3300048923 | Ga0496120_0249533 | Ga0496120_0249533_11_526 | 171 |
| 460 | 3300048924 | Ga0496121_0025652 | Ga0496121_0025652_3835_4350 | 171 |
| 461 | 3300048924 | Ga0496121_0093929 | Ga0496121_0093929_521_1036 | 171 |
| 462 | 3300048924 | Ga0496121_0102574 | Ga0496121_0102574_594_1130 | 171 |
| 463 | 3300048925 | Ga0496122_0076008 | Ga0496122_0076008_1577_2092 | 171 |
| 464 | 3300048926 | Ga0496123_0265666 | Ga0496123_0265666_39_674 | 171 |
| 465 | 3300048927 | Ga0496124_0708123 | Ga0496124_0708123_43_558 | 171 |
| 466 | 3300048929 | Ga0496126_0146095 | Ga0496126_0146095_459_983 | 171 |
| 467 | 3300048929 | Ga0496126_0527171 | Ga0496126_0527171_283_798 | 171 |
| 468 | 3300048929 | Ga0496126_0971185 | Ga0496126_0971185_110_625 | 171 |
| 469 | 3300049460 | Ga0495682_0037775 | Ga0495682_0037775_173_688 | 171 |
| 470 | 3300049580 | Ga0501046_0348229 | Ga0501046_0348229_522_1046 | 171 |
| 471 | 3300049581 | Ga0501047_0015918 | Ga0501047_0015918_2327_2938 | 171 |
| 472 | 3300049586 | Ga0501070_0057566 | Ga0501070_0057566_22_546 | 171 |
| 473 | 3300049589 | Ga0501073_0149406 | Ga0501073_0149406_763_1287 | 171 |
| 474 | 3300049590 | Ga0501074_0261928 | Ga0501074_0261928_121_732 | 171 |
| 475 | 3300049742 | Ga0501080_0063737 | Ga0501080_0063737_2807_3418 | 171 |
| 476 | 3300049823 | Ga0501044_0291804 | Ga0501044_0291804_538_1062 | 171 |
| 477 | 3300050490 | nmdc:mga03n38_161337_c1 | nmdc:mga03n38_161337_c1_308_844 | 171 |
| 478 | 3300050492 | nmdc:mga0yw44_277519_c1 | nmdc:mga0yw44_277519_c1_447_1082 | 171 |
| 479 | 3300050492 | nmdc:mga0yw44_787742_c1 | nmdc:mga0yw44_787742_c1_39_554 | 171 |
| 480 | 3300050493 | nmdc:mga0k408_12565_c1 | nmdc:mga0k408_12565_c1_1107_1694 | 171 |
| 481 | 3300050495 | nmdc:mga04h51_14323_c1 | nmdc:mga04h51_14323_c1_1393_1908 | 171 |
| 482 | 3300050496 | nmdc:mga07m45_11206_c3 | nmdc:mga07m45_11206_c3_1002_1517 | 171 |
| 483 | 3300050516 | nmdc:mga0sz30_118505_c1 | nmdc:mga0sz30_118505_c1_43_558 | 171 |
| 484 | 3300050516 | nmdc:mga0sz30_261463_c1 | nmdc:mga0sz30_261463_c1_171_686 | 171 |
| 485 | 3300053083 | Ga0495655_0029333 | Ga0495655_0029333_161_676 | 171 |
| 486 | 3300053085 | Ga0495619_0029659 | Ga0495619_0029659_175_690 | 171 |
| 487 | 3300053085 | Ga0495619_0501036 | Ga0495619_0501036_185_721 | 171 |
| 488 | 3300053086 | Ga0500578_0144737 | Ga0500578_0144737_418_933 | 171 |
| 489 | 3300053086 | Ga0500578_0164443 | Ga0500578_0164443_45_560 | 171 |
| 490 | 3300053087 | Ga0500643_000116 | Ga0500643_000116_54482_54997 | 171 |
| 491 | 3300053092 | Ga0500583_0004980 | Ga0500583_0004980_1601_2116 | 171 |
| 492 | 3300053093 | Ga0500651_0079623 | Ga0500651_0079623_1001_1516 | 171 |
| 493 | 3300053093 | Ga0500651_0126122 | Ga0500651_0126122_744_1259 | 171 |
| 494 | 3300053094 | Ga0500566_0000821 | Ga0500566_0000821_11612_12127 | 171 |
| 495 | 3300053094 | Ga0500566_0096776 | Ga0500566_0096776_73_588 | 171 |
| 496 | 3300053098 | Ga0500650_0088526 | Ga0500650_0088526_344_859 | 171 |
| 497 | 3300053102 | Ga0500554_020223 | Ga0500554_020223_68_601 | 171 |
| 498 | 3300053104 | Ga0500556_0007469 | Ga0500556_0007469_395_910 | 171 |
| 499 | 3300053108 | Ga0500562_006138 | Ga0500562_006138_11_526 | 171 |
| 500 | 3300053109 | Ga0500569_007442 | Ga0500569_007442_1273_1788 | 171 |
| 501 | 3300053111 | Ga0500572_009426 | Ga0500572_009426_1446_1961 | 171 |
| 502 | 3300053119 | Ga0500595_001340 | Ga0500595_001340_3871_4404 | 171 |
| 503 | 3300053119 | Ga0500595_003474 | Ga0500595_003474_98_613 | 171 |
| 504 | 3300053122 | Ga0500608_197133 | Ga0500608_197133_284_799 | 171 |
| 505 | 3300053131 | Ga0500652_063282 | Ga0500652_063282_949_1464 | 171 |
| 506 | 3300053136 | Ga0500559_0161975 | Ga0500559_0161975_276_809 | 171 |
| 507 | 3300053136 | Ga0500559_0176451 | Ga0500559_0176451_410_925 | 171 |
| 508 | 3300053136 | Ga0500559_0241590 | Ga0500559_0241590_210_725 | 171 |
| 509 | 3300053139 | Ga0500568_0014289 | Ga0500568_0014289_2902_3417 | 171 |
| 510 | 3300053142 | Ga0500577_0019644 | Ga0500577_0019644_1436_1951 | 171 |
| 511 | 3300053148 | Ga0500590_155681 | Ga0500590_155681_295_810 | 171 |
| 512 | 3300053153 | Ga0500616_0049861 | Ga0500616_0049861_1384_1899 | 171 |
| 513 | 3300053155 | Ga0500620_003920 | Ga0500620_003920_2649_3164 | 171 |
| 514 | 3300053156 | Ga0500622_0097986 | Ga0500622_0097986_922_1437 | 171 |
| 515 | 3300053158 | Ga0500627_0011187 | Ga0500627_0011187_1116_1631 | 171 |
| 516 | 3300053160 | Ga0500633_0093613 | Ga0500633_0093613_541_1056 | 171 |
| 517 | 3300053161 | Ga0500634_0071061 | Ga0500634_0071061_1244_1759 | 171 |
| 518 | 3300053162 | Ga0500638_002337 | Ga0500638_002337_5466_5999 | 171 |
| 519 | 3300053162 | Ga0500638_276424 | Ga0500638_276424_91_606 | 171 |
| 520 | 3300053177 | Ga0500636_0000207 | Ga0500636_0000207_21064_21579 | 171 |
| 521 | 3300053178 | Ga0500637_0000077 | Ga0500637_0000077_11127_11660 | 171 |
| 522 | 3300053178 | Ga0500637_0470497 | Ga0500637_0470497_20_535 | 171 |
| 523 | 3300053730 | Ga0500645_011128 | Ga0500645_011128_2418_2933 | 171 |
| 524 | 3300053730 | Ga0500645_143381 | Ga0500645_143381_101_616 | 171 |
| 525 | 3300053731 | Ga0500609_002330 | Ga0500609_002330_1252_1767 | 171 |
| 526 | 3300053733 | Ga0500552_074627 | Ga0500552_074627_48_563 | 171 |
| 527 | 3300053736 | Ga0500599_007068 | Ga0500599_007068_44_559 | 171 |
| 528 | 3300053737 | Ga0500601_000322 | Ga0500601_000322_1651_2166 | 171 |
| 529 | 3300055283 | Ga0500661_000100 | Ga0500661_000100_8298_8831 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8oeu-assembly1.cif.gz_C | structure of the mammalian pol ii-spt6 complex (composite structure, structure 4) | 0.7512 | 101 | 121 |
| 5w64-assembly1.cif.gz_C | rna polymerase i initial transcribing complex state 1 | 0.7475 | 100 | 121 |
| 7f4g-assembly1.cif.gz_C | structure of rpap2-bound rna polymerase ii | 0.7332 | 101 | 121 |
| 8p4d-assembly1.cif.gz_C | structural insights into human co-transcriptional capping - structure 4 | 0.7294 | 101 | 121 |
| 4rmm-assembly1.cif.gz_A-2 | crystal structure of the q7nvp2_chrvo protein from chromobacterium violaceum. northeast structural genomics consortium target cvr191 | 0.7212 | 102 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0L2_152_317_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.833 | 134 | 162 | 3.40.50.2000 |
| af_Q2FXM2_325_429_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8046 | 102 | 125 | 3.10.129.10 |
| af_Q46858_15_143_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7461 | 26 | 153 | 3.10.450.50 |
| af_Q54PU4_55_149_2.60.40.290 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7382 | 101 | 121 | 2.60.40.290 |
| af_A2V8C8_26_137_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7299 | 101 | 147 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9ICB7-F1-model_v4 | DUF3828 domain-containing protein | 0.9254 | 23 | 169 |
|
| AF-A0A1W9ICB7-F1-model_v4 | DUF3828 domain-containing protein | 0.8958 | 23 | 169 |
|
| AF-A4YV44-F1-model_v4 | DUF3828 domain-containing protein | 0.8561 | 1 | 170 |
|
| AF-H0SFJ9-F1-model_v4 | DUF3828 domain-containing protein | 0.8382 | 1 | 170 |
|
| AF-A0A431QUI5-F1-model_v4 | deleted | 0.8368 | 1 | 170 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar