F459858

General Info

Members Datasets Scaffolds Average Seq Length
529 216 529 293

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0073787|Ga0495672_0073787_552_1616
Length 354
Sequence MRAAESPTGEGVIALVCELPTFSALRRGLFFLGNTRRVVTFRFRITLLFQRTDQTYSKQRLACNMPSVEDLLRRSIPELRDLFLERGRPVPKGLLEALEIDARAGAHQLAKRIRERYRSNRSEGQRLHTLLRFEIDLWAQGFSLVAGVDEAGMAPLAGPVVAGAVILPQNYKLRGLNDSKKILDHEMREELAAQIKQDAVCWAYGFADVEEIDKINIYHAGLLAMRRAVNGLRCAPDFVLVDARKIPQCPAPQRGIIRGDALSASIAAASIIAKTTRDAHMLEMDSLYQGYGFASHKGYPTPEHCRALEELGAVAIHRRSFGRVRQALGLDPVQTELFAEQEETVNEVAIAHAQ

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
192 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
193 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
194 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
195 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
196 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
201 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
202 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
205 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
206 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.27
Rhizosphere 97.35
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000769 3300000532 Bacteria 3060
2 JGI24748J21848_1000014 3300002074 Bacteria 147126
3 JGI24034J26672_10000012 3300002239 Bacteria 146139
4 JGI24751J29686_10000008 3300002459 Bacteria 128004
5 Ga0065704_10101934 3300005289 Bacteria 2221
6 Ga0065704_10105465 3300005289 Bacteria 2110
7 Ga0065712_10000112 3300005290 Bacteria 340011
8 Ga0065712_10004634 3300005290 Bacteria 3807
9 Ga0065712_10086626 3300005290 Unclassified 2624
10 Ga0065715_10090657 3300005293 Bacteria 6637
11 Ga0065715_10147351 3300005293 Bacteria 1772
12 Ga0065707_10011478 3300005295 Bacteria 2332
13 Ga0065707_10116447 3300005295 Bacteria 2227
14 Ga0065707_10136531 3300005295 Bacteria 1833
15 Ga0070690_100027211 3300005330 Bacteria 3534
16 Ga0070690_100063075 3300005330 Unclassified 2391
17 Ga0070690_100070791 3300005330 Bacteria 2265
18 Ga0070690_100155847 3300005330 Archaea 1561
19 Ga0070670_100000136 3300005331 Bacteria 68887
20 Ga0070670_100000937 3300005331 Bacteria 22916
21 Ga0070670_100017381 3300005331 Bacteria 6170
22 Ga0070670_100158605 3300005331 Bacteria 1960
23 Ga0070670_100388856 3300005331 Bacteria 1230
24 Ga0068869_100030759 3300005334 Bacteria 3772
25 Ga0068869_100037825 3300005334 Unclassified 3433
26 Ga0068869_100060950 3300005334 Bacteria 2766
27 Ga0068869_100088511 3300005334 Bacteria 2324
28 Ga0068869_100204609 3300005334 Bacteria 1558
29 Ga0070666_10011117 3300005335 Bacteria 5641
30 Ga0070680_100000420 3300005336 Bacteria 28901
31 Ga0070682_100001105 3300005337 Bacteria 15473
32 Ga0070682_100024420 3300005337 Bacteria 3597
33 Ga0068868_100055295 3300005338 Unclassified 3131
34 Ga0068868_100075379 3300005338 Bacteria 2696
35 Ga0070689_100082922 3300005340 Bacteria 2519
36 Ga0070689_100185107 3300005340 Bacteria 1693
37 Ga0070689_100209559 3300005340 Unclassified 1594
38 Ga0070687_100003666 3300005343 Bacteria 6006
39 Ga0070687_100028930 3300005343 Unclassified 2692
40 Ga0070661_100084754 3300005344 Bacteria 2341
41 Ga0070692_10089445 3300005345 Bacteria 1671
42 Ga0070692_10198747 3300005345 Bacteria 1173
43 Ga0070668_100001395 3300005347 Bacteria 17365
44 Ga0070668_100521724 3300005347 Unclassified 1031
45 Ga0070669_100000969 3300005353 Bacteria 20968
46 Ga0070669_100001076 3300005353 Bacteria 20001
47 Ga0070669_100013173 3300005353 Bacteria 5878
48 Ga0070669_100065198 3300005353 Bacteria 2683
49 Ga0070671_100035787 3300005355 Unclassified 4114
50 Ga0070671_100052525 3300005355 Unclassified 3388
51 Ga0070671_100175850 3300005355 Bacteria 1811
52 Ga0070671_100257104 3300005355 Unclassified 1484
53 Ga0070674_100010156 3300005356 Bacteria 5672
54 Ga0070673_100004235 3300005364 Bacteria 9053
55 Ga0070673_100158712 3300005364 Bacteria 1921
56 Ga0070673_100162718 3300005364 Unclassified 1899
57 Ga0070673_100230295 3300005364 Bacteria 1607
58 Ga0070688_100019588 3300005365 Bacteria 3922
59 Ga0070659_100055212 3300005366 Bacteria 3130
60 Ga0070659_100055617 3300005366 Bacteria 3120
61 Ga0070667_100014772 3300005367 Bacteria 6451
62 Ga0070667_100079734 3300005367 Unclassified 2799
63 Ga0070703_10000806 3300005406 Bacteria 10258
64 Ga0070709_10111562 3300005434 Bacteria 1839
65 Ga0070701_10035393 3300005438 Bacteria 2508
66 Ga0070701_10040403 3300005438 Bacteria 2371
67 Ga0070705_100018607 3300005440 Unclassified 3644
68 Ga0070705_100026535 3300005440 Bacteria 3154
69 Ga0070700_100001687 3300005441 Bacteria 11080
70 Ga0070700_100026564 3300005441 Bacteria 3421
71 Ga0070700_100058987 3300005441 Unclassified 2414
72 Ga0070700_100070810 3300005441 Unclassified 2224
73 Ga0070694_100002499 3300005444 Bacteria 10855
74 Ga0070694_100017132 3300005444 Unclassified 4573
75 Ga0070694_100044809 3300005444 Bacteria 2961
76 Ga0070694_100058888 3300005444 Bacteria 2615
77 Ga0070694_100060154 3300005444 Bacteria 2590
78 Ga0070694_100063472 3300005444 Bacteria 2526
79 Ga0070694_100415162 3300005444 Bacteria 1056
80 Ga0070708_100087716 3300005445 Bacteria 2828
81 Ga0070708_100123407 3300005445 Bacteria 2391
82 Ga0070663_100474896 3300005455 Unclassified 1034
83 Ga0070678_100017457 3300005456 Bacteria 4622
84 Ga0070662_100101385 3300005457 Bacteria 2179
85 Ga0070662_100160298 3300005457 Unclassified 1759
86 Ga0070662_100283928 3300005457 Bacteria 1340
87 Ga0070681_10000329 3300005458 Bacteria 38591
88 Ga0068867_100047767 3300005459 Bacteria 3147
89 Ga0070685_10007588 3300005466 Bacteria 5548
90 Ga0070706_100000425 3300005467 Bacteria 50825
91 Ga0070706_100004816 3300005467 Bacteria 12926
92 Ga0070706_100058337 3300005467 Bacteria 3563
93 Ga0070706_100197969 3300005467 Bacteria 1876
94 Ga0070706_100343415 3300005467 Bacteria 1392
95 Ga0070707_100000284 3300005468 Bacteria 49662
96 Ga0070707_100009698 3300005468 Bacteria 8948
97 Ga0070707_100116861 3300005468 Bacteria 2589
98 Ga0070707_100586756 3300005468 Bacteria 1077
99 Ga0070698_100001091 3300005471 Bacteria 29857
100 Ga0070698_100004056 3300005471 Bacteria 16110
101 Ga0070698_100004176 3300005471 Bacteria 15867
102 Ga0070698_100052477 3300005471 Bacteria 4148
103 Ga0070698_100063822 3300005471 Unclassified 3713
104 Ga0070698_100100902 3300005471 Bacteria 2858
105 Ga0070698_100303294 3300005471 Bacteria 1528
106 Ga0070699_100008590 3300005518 Bacteria 8851
107 Ga0070699_100042744 3300005518 Bacteria 3922
108 Ga0070699_100053023 3300005518 Bacteria 3510
109 Ga0070699_100059446 3300005518 Bacteria 3311
110 Ga0070699_100170714 3300005518 Bacteria 1927
111 Ga0070699_100677188 3300005518 Unclassified 942
112 Ga0070679_100000439 3300005530 Bacteria 35386
113 Ga0070679_100017594 3300005530 Bacteria 6918
114 Ga0070684_100093833 3300005535 Bacteria 2672
115 Ga0070697_100000109 3300005536 Bacteria 63972
116 Ga0070697_100001077 3300005536 Bacteria 20618
117 Ga0070697_100001462 3300005536 Bacteria 18001
118 Ga0070697_100015843 3300005536 Bacteria 5923
119 Ga0070697_100032772 3300005536 Unclassified 4183
120 Ga0070697_100040488 3300005536 Bacteria 3771
121 Ga0070697_100051794 3300005536 Bacteria 3336
122 Ga0070697_100072138 3300005536 Bacteria 2833
123 Ga0070672_100176648 3300005543 Bacteria 1778
124 Ga0070672_100192975 3300005543 Unclassified 1701
125 Ga0070686_100004746 3300005544 Bacteria 7497
126 Ga0070695_100029852 3300005545 Bacteria 3390
127 Ga0070695_100142286 3300005545 Bacteria 1665
128 Ga0070695_100237475 3300005545 Bacteria 1321
129 Ga0070695_100360760 3300005545 Bacteria 1091
130 Ga0070696_100051480 3300005546 Bacteria 2864
131 Ga0070696_100057373 3300005546 Bacteria 2718
132 Ga0070696_100062289 3300005546 Unclassified 2611
133 Ga0070696_100080925 3300005546 Bacteria 2301
134 Ga0070696_100096512 3300005546 Bacteria 2113
135 Ga0070696_100206812 3300005546 Bacteria 1468
136 Ga0070696_100314864 3300005546 Bacteria 1203
137 Ga0070693_100031399 3300005547 Bacteria 2910
138 Ga0070665_100099841 3300005548 Unclassified 2907
139 Ga0070704_100038506 3300005549 Bacteria 3277
140 Ga0070704_100084027 3300005549 Bacteria 2352
141 Ga0070704_100137245 3300005549 Bacteria 1904
142 Ga0070664_100000982 3300005564 Bacteria 22340
143 Ga0068857_100000684 3300005577 Bacteria 25216
144 Ga0068857_100046215 3300005577 Bacteria 3864
145 Ga0068854_100011088 3300005578 Bacteria 5852
146 Ga0068854_100157952 3300005578 Bacteria 1754
147 Ga0068854_100274349 3300005578 Unclassified 1355
148 Ga0070702_100006355 3300005615 Bacteria 5588
149 Ga0070702_100051597 3300005615 Bacteria 2355
150 Ga0068852_100621344 3300005616 Unclassified 1086
151 Ga0068859_100019484 3300005617 Bacteria 6816
152 Ga0068859_100099576 3300005617 Bacteria 2962
153 Ga0068859_100119678 3300005617 Bacteria 2700
154 Ga0068859_100119894 3300005617 Bacteria 2697
155 Ga0068859_100131200 3300005617 Bacteria 2577
156 Ga0068859_100141186 3300005617 Bacteria 2482
157 Ga0068859_100164803 3300005617 Unclassified 2296
158 Ga0068859_100171322 3300005617 Bacteria 2252
159 Ga0068859_100297632 3300005617 Bacteria 1707
160 Ga0068859_100551067 3300005617 Bacteria 1247
161 Ga0068859_100562227 3300005617 Bacteria 1235
162 Ga0068864_100019740 3300005618 Bacteria 5637
163 Ga0068864_100050832 3300005618 Unclassified 3569
164 Ga0068864_100096934 3300005618 Bacteria 2611
165 Ga0068864_100155785 3300005618 Bacteria 2073
166 Ga0068864_100407793 3300005618 Bacteria 1293
167 Ga0068866_10045175 3300005718 Bacteria 2208
168 Ga0068861_100020934 3300005719 Bacteria 4694
169 Ga0068861_100035636 3300005719 Bacteria 3687
170 Ga0068861_100096084 3300005719 Bacteria 2348
171 Ga0068861_100331666 3300005719 Bacteria 1328
172 Ga0068851_10001024 3300005834 Bacteria 12142
173 Ga0068851_10206260 3300005834 Bacteria 1099
174 Ga0068870_10018530 3300005840 Bacteria 3363
175 Ga0068870_10100822 3300005840 Unclassified 1631
176 Ga0068870_10143818 3300005840 Bacteria 1398
177 Ga0068863_100109177 3300005841 Unclassified 2633
178 Ga0068863_100203860 3300005841 Bacteria 1903
179 Ga0068863_100284895 3300005841 Bacteria 1601
180 Ga0068863_100336387 3300005841 Bacteria 1468
181 Ga0068858_100007933 3300005842 Bacteria 10231
182 Ga0068858_100012441 3300005842 Bacteria 8023
183 Ga0068858_100024559 3300005842 Bacteria 5615
184 Ga0068858_100056136 3300005842 Bacteria 3641
185 Ga0068858_100095242 3300005842 Unclassified 2774
186 Ga0068858_100156139 3300005842 Bacteria 2147
187 Ga0068860_100021224 3300005843 Bacteria 6290
188 Ga0068860_100082577 3300005843 Bacteria 3056
189 Ga0068860_100281779 3300005843 Bacteria 1624
190 Ga0068860_100445850 3300005843 Bacteria 1286
191 Ga0068862_100025782 3300005844 Bacteria 4937
192 Ga0068862_100026551 3300005844 Bacteria 4868
193 Ga0068862_100037085 3300005844 Bacteria 4132
194 Ga0068862_100047182 3300005844 Bacteria 3676
195 Ga0081540_1070204 3300005983 Unclassified 1623
196 Ga0081539_10000804 3300005985 Bacteria 61071
197 Ga0070715_10000017 3300006163 Bacteria 132686
198 Ga0070716_100170456 3300006173 Bacteria 1420
199 Ga0097621_100002178 3300006237 Bacteria 13408
200 Ga0097621_100198904 3300006237 Bacteria 1739
201 Ga0097621_100415138 3300006237 Unclassified 1207
202 Ga0068871_100008713 3300006358 Bacteria 7297
203 Ga0068871_100022655 3300006358 Unclassified 4846
204 Ga0068871_100053522 3300006358 Bacteria 3272
205 Ga0075428_100109034 3300006844 Bacteria 3017
206 Ga0075428_100144458 3300006844 Bacteria 2586
207 Ga0075428_100739794 3300006844 Bacteria 1047
208 Ga0075430_100019131 3300006846 Bacteria 5824
209 Ga0075431_100020724 3300006847 Bacteria 6717
210 Ga0075431_100256275 3300006847 Bacteria 1776
211 Ga0075433_10057418 3300006852 Unclassified 3402
212 Ga0075433_10066074 3300006852 Bacteria 3173
213 Ga0075433_10319110 3300006852 Bacteria 1375
214 Ga0075433_10438038 3300006852 Unclassified 1152
215 Ga0075433_10451907 3300006852 Bacteria 1132
216 Ga0075434_100022506 3300006871 Bacteria 6137
217 Ga0075434_100258220 3300006871 Bacteria 1761
218 Ga0075434_100539843 3300006871 Bacteria 1186
219 Ga0075434_100751945 3300006871 Unclassified 992
220 Ga0068865_100008322 3300006881 Bacteria 6407
221 Ga0075436_100000101 3300006914 Bacteria 50528
222 Ga0097620_100019484 3300006931 Bacteria 6816
223 Ga0097620_100099577 3300006931 Bacteria 2962
224 Ga0097620_100119676 3300006931 Bacteria 2700
225 Ga0097620_100119889 3300006931 Bacteria 2697
226 Ga0097620_100131209 3300006931 Bacteria 2577
227 Ga0097620_100141181 3300006931 Bacteria 2482
228 Ga0097620_100164801 3300006931 Unclassified 2296
229 Ga0097620_100171306 3300006931 Bacteria 2252
230 Ga0097620_100211936 3300006931 Bacteria 2024
231 Ga0097620_100297641 3300006931 Bacteria 1707
232 Ga0097620_100551059 3300006931 Bacteria 1247
233 Ga0097620_100562247 3300006931 Bacteria 1235
234 Ga0075435_100009232 3300007076 Bacteria 7124
235 Ga0075435_100083743 3300007076 Unclassified 2623
236 Ga0075435_100153919 3300007076 Unclassified 1934
237 Ga0105240_10078704 3300009093 Bacteria 4059
238 Ga0105240_10733360 3300009093 Unclassified 1076
239 Ga0111539_10032289 3300009094 Bacteria 6358
240 Ga0111539_10095015 3300009094 Bacteria 3502
241 Ga0111539_10233903 3300009094 Bacteria 2139
242 Ga0105245_10053384 3300009098 Unclassified 3628
243 Ga0105245_10171986 3300009098 Bacteria 2063
244 Ga0105245_10468360 3300009098 Unclassified 1271
245 Ga0105245_10556075 3300009098 Bacteria 1170
246 Ga0105247_10000050 3300009101 Bacteria 146183
247 Ga0105247_10000686 3300009101 Bacteria 26694
248 Ga0105247_10273915 3300009101 Unclassified 1162
249 Ga0114129_10000855 3300009147 Bacteria 39483
250 Ga0114129_10004324 3300009147 Bacteria 20086
251 Ga0114129_10071035 3300009147 Unclassified 4854
252 Ga0114129_10072705 3300009147 Bacteria 4794
253 Ga0114129_10128215 3300009147 Bacteria 3487
254 Ga0114129_10141398 3300009147 Bacteria 3298
255 Ga0114129_10176384 3300009147 Bacteria 2911
256 Ga0114129_10520626 3300009147 Bacteria 1551
257 Ga0105243_10000112 3300009148 Bacteria 93493
258 Ga0105243_10001558 3300009148 Bacteria 20035
259 Ga0105243_10001700 3300009148 Bacteria 18973
260 Ga0105243_10046055 3300009148 Unclassified 3429
261 Ga0105241_10077748 3300009174 Unclassified 2591
262 Ga0105241_10238151 3300009174 Bacteria 1537
263 Ga0105242_10000013 3300009176 Bacteria 133981
264 Ga0105242_10000636 3300009176 Bacteria 27544
265 Ga0105242_10001346 3300009176 Bacteria 19400
266 Ga0105242_10009681 3300009176 Bacteria 7387
267 Ga0105242_10155642 3300009176 Unclassified 1996
268 Ga0105248_10002561 3300009177 Bacteria 20239
269 Ga0105248_10014161 3300009177 Bacteria 8780
270 Ga0105248_10023953 3300009177 Bacteria 6786
271 Ga0105248_10024473 3300009177 Bacteria 6713
272 Ga0105248_10062938 3300009177 Unclassified 4164
273 Ga0105237_10001019 3300009545 Bacteria 37716
274 Ga0105237_10022465 3300009545 Bacteria 6472
275 Ga0105249_10000025 3300009553 Bacteria 232713
276 Ga0105249_10002819 3300009553 Bacteria 14999
277 Ga0105249_10058224 3300009553 Bacteria 3542
278 Ga0105249_10081906 3300009553 Bacteria 3001
279 Ga0105239_10017438 3300010375 Bacteria 7941
280 Ga0105239_10318664 3300010375 Bacteria 1753
281 Ga0105239_10688841 3300010375 Bacteria 1168
282 Ga0105246_10003721 3300011119 Bacteria 9233
283 Ga0105246_10264610 3300011119 Bacteria 1371
284 Ga0157373_10012338 3300013100 Bacteria 6283
285 Ga0157373_10024905 3300013100 Bacteria 4333
286 Ga0157371_10188962 3300013102 Bacteria 1474
287 Ga0157374_10149966 3300013296 Unclassified 2267
288 Ga0157378_10000001 3300013297 Bacteria 352632
289 Ga0157378_10006891 3300013297 Bacteria 9916
290 Ga0157378_10008709 3300013297 Bacteria 8829
291 Ga0157378_10078117 3300013297 Bacteria 2985
292 Ga0157378_10175051 3300013297 Bacteria 2015
293 Ga0157378_10192206 3300013297 Archaea 1926
294 Ga0157378_10197738 3300013297 Bacteria 1900
295 Ga0157378_10230749 3300013297 Bacteria 1764
296 Ga0163162_10000002 3300013306 Bacteria 717331
297 Ga0163162_10000610 3300013306 Bacteria 33195
298 Ga0163162_10037544 3300013306 Bacteria 4834
299 Ga0163162_10072567 3300013306 Bacteria 3497
300 Ga0163162_10210647 3300013306 Bacteria 2073
301 Ga0163162_10232871 3300013306 Bacteria 1972
302 Ga0163162_10313029 3300013306 Bacteria 1702
303 Ga0163162_10328007 3300013306 Viruses 1663
304 Ga0157372_10050817 3300013307 Bacteria 4611
305 Ga0157372_10490195 3300013307 Bacteria 1433
306 Ga0157375_10015021 3300013308 Bacteria 6927
307 Ga0157375_10025566 3300013308 Bacteria 5489
308 Ga0157375_10209586 3300013308 Bacteria 2106
309 Ga0157375_10257202 3300013308 Bacteria 1907
310 Ga0163163_10000576 3300014325 Bacteria 32365
311 Ga0163163_10003677 3300014325 Bacteria 13053
312 Ga0163163_10007052 3300014325 Bacteria 9877
313 Ga0163163_10017153 3300014325 Bacteria 6747
314 Ga0163163_10017537 3300014325 Bacteria 6680
315 Ga0163163_10045316 3300014325 Bacteria 4316
316 Ga0163163_10050037 3300014325 Bacteria 4114
317 Ga0163163_10163004 3300014325 Unclassified 2275
318 Ga0163163_10507334 3300014325 Bacteria 1268
319 Ga0157380_10006958 3300014326 Bacteria 8004
320 Ga0157380_10017149 3300014326 Bacteria 5355
321 Ga0157380_10028901 3300014326 Bacteria 4233
322 Ga0157380_10214533 3300014326 Bacteria 1718
323 Ga0157380_10392876 3300014326 Bacteria 1313
324 Ga0157377_10036090 3300014745 Unclassified 2717
325 Ga0157379_10348610 3300014968 Bacteria 1355
326 Ga0157376_10003648 3300014969 Bacteria 10626
327 Ga0157376_10230384 3300014969 Bacteria 1720
328 Ga0207656_10000933 3300025321 Bacteria 9530
329 Ga0207653_10000035 3300025885 Bacteria 102840
330 Ga0207653_10014489 3300025885 Bacteria 2474
331 Ga0207642_10027013 3300025899 Bacteria 2345
332 Ga0207710_10000555 3300025900 Bacteria 22351
333 Ga0207680_10096154 3300025903 Bacteria 1894
334 Ga0207647_10003679 3300025904 Bacteria 11471
335 Ga0207699_10149925 3300025906 Bacteria 1542
336 Ga0207643_10111851 3300025908 Bacteria 1610
337 Ga0207643_10116663 3300025908 Unclassified 1577
338 Ga0207684_10000168 3300025910 Bacteria 110284
339 Ga0207684_10001178 3300025910 Bacteria 29249
340 Ga0207684_10009666 3300025910 Bacteria 8504
341 Ga0207684_10090170 3300025910 Bacteria 2612
342 Ga0207684_10431476 3300025910 Bacteria 1132
343 Ga0207707_10000037 3300025912 Bacteria 144937
344 Ga0207707_10038799 3300025912 Bacteria 4162
345 Ga0207707_10052721 3300025912 Bacteria 3540
346 Ga0207671_10002920 3300025914 Bacteria 17614
347 Ga0207671_10160247 3300025914 Bacteria 1742
348 Ga0207660_10001157 3300025917 Bacteria 17634
349 Ga0207662_10003048 3300025918 Bacteria 8554
350 Ga0207662_10003743 3300025918 Bacteria 7880
351 Ga0207662_10164971 3300025918 Bacteria 1417
352 Ga0207649_10050554 3300025920 Bacteria 2571
353 Ga0207652_10000417 3300025921 Bacteria 44140
354 Ga0207646_10094761 3300025922 Bacteria 2674
355 Ga0207681_10001089 3300025923 Bacteria 17622
356 Ga0207681_10074869 3300025923 Bacteria 2373
357 Ga0207694_10001601 3300025924 Bacteria 19138
358 Ga0207650_10000001 3300025925 Bacteria 1545726
359 Ga0207650_10001194 3300025925 Bacteria 19071
360 Ga0207650_10014456 3300025925 Bacteria 5487
361 Ga0207650_10142757 3300025925 Bacteria 1884
362 Ga0207650_10393330 3300025925 Bacteria 1146
363 Ga0207659_10152426 3300025926 Bacteria 1806
364 Ga0207644_10000093 3300025931 Bacteria 64685
365 Ga0207644_10006469 3300025931 Bacteria 7639
366 Ga0207644_10048222 3300025931 Unclassified 3044
367 Ga0207644_10059021 3300025931 Bacteria 2774
368 Ga0207644_10132229 3300025931 Bacteria 1912
369 Ga0207690_10014227 3300025932 Bacteria 4802
370 Ga0207690_10263467 3300025932 Unclassified 1336
371 Ga0207690_10344231 3300025932 Unclassified 1177
372 Ga0207706_10109954 3300025933 Bacteria 2425
373 Ga0207706_10122593 3300025933 Bacteria 2286
374 Ga0207706_10364038 3300025933 Bacteria 1256
375 Ga0207706_10442336 3300025933 Unclassified 1125
376 Ga0207686_10000012 3300025934 Bacteria 209763
377 Ga0207709_10000636 3300025935 Bacteria 28655
378 Ga0207709_10005717 3300025935 Bacteria 7022
379 Ga0207709_10090217 3300025935 Bacteria 2001
380 Ga0207709_10395120 3300025935 Unclassified 1056
381 Ga0207670_10000374 3300025936 Bacteria 25747
382 Ga0207670_10020488 3300025936 Bacteria 4064
383 Ga0207670_10154990 3300025936 Bacteria 1704
384 Ga0207669_10017108 3300025937 Unclassified 3709
385 Ga0207665_10146302 3300025939 Bacteria 1689
386 Ga0207691_10009958 3300025940 Bacteria 9128
387 Ga0207691_10251097 3300025940 Bacteria 1527
388 Ga0207711_10062723 3300025941 Unclassified 3206
389 Ga0207711_10253376 3300025941 Bacteria 1617
390 Ga0207689_10003279 3300025942 Bacteria 14839
391 Ga0207689_10026211 3300025942 Bacteria 4882
392 Ga0207689_10053412 3300025942 Unclassified 3329
393 Ga0207689_10055598 3300025942 Bacteria 3257
394 Ga0207689_10142067 3300025942 Bacteria 1978
395 Ga0207689_10546278 3300025942 Unclassified 973
396 Ga0207679_10003867 3300025945 Bacteria 9285
397 Ga0207651_10078505 3300025960 Bacteria 2368
398 Ga0207651_10496820 3300025960 Unclassified 1054
399 Ga0207712_10017941 3300025961 Bacteria 4606
400 Ga0207712_10033113 3300025961 Bacteria 3492
401 Ga0207712_10142753 3300025961 Bacteria 1840
402 Ga0207640_10034775 3300025981 Bacteria 3148
403 Ga0207658_10081460 3300025986 Unclassified 2482
404 Ga0207677_10045310 3300026023 Bacteria 2936
405 Ga0207703_10011188 3300026035 Bacteria 6981
406 Ga0207703_10049020 3300026035 Bacteria 3412
407 Ga0207703_10111220 3300026035 Bacteria 2338
408 Ga0207703_10403155 3300026035 Unclassified 1269
409 Ga0207639_10019046 3300026041 Bacteria 4888
410 Ga0207639_10507421 3300026041 Unclassified 1103
411 Ga0207708_10003823 3300026075 Bacteria 11093
412 Ga0207708_10012215 3300026075 Bacteria 6406
413 Ga0207708_10014853 3300026075 Bacteria 5829
414 Ga0207708_10138715 3300026075 Bacteria 1906
415 Ga0207708_10200307 3300026075 Bacteria 1593
416 Ga0207708_10230098 3300026075 Bacteria 1488
417 Ga0207641_10090099 3300026088 Bacteria 2681
418 Ga0207641_10181490 3300026088 Unclassified 1928
419 Ga0207641_10208934 3300026088 Bacteria 1804
420 Ga0207641_10294083 3300026088 Unclassified 1532
421 Ga0207648_10009538 3300026089 Bacteria 9284
422 Ga0207648_10065633 3300026089 Bacteria 3164
423 Ga0207676_10014954 3300026095 Bacteria 5591
424 Ga0207676_10016390 3300026095 Bacteria 5364
425 Ga0207676_10049721 3300026095 Bacteria 3264
426 Ga0207676_10054576 3300026095 Bacteria 3132
427 Ga0207676_10229982 3300026095 Bacteria 1657
428 Ga0207676_10318106 3300026095 Unclassified 1427
429 Ga0207674_10000037 3300026116 Bacteria 134125
430 Ga0207674_10035677 3300026116 Bacteria 5189
431 Ga0207674_10182747 3300026116 Bacteria 2048
432 Ga0207674_10625716 3300026116 Bacteria 1039
433 Ga0207675_100026615 3300026118 Bacteria 5385
434 Ga0207675_100032851 3300026118 Bacteria 4835
435 Ga0207675_100061543 3300026118 Bacteria 3504
436 Ga0207675_100099270 3300026118 Bacteria 2742
437 Ga0207675_100144926 3300026118 Bacteria 2258
438 Ga0207683_10003301 3300026121 Bacteria 14064
439 Ga0207698_10030827 3300026142 Bacteria 3862
440 Ga0207698_10374339 3300026142 Bacteria 1353
441 Ga0207428_10033151 3300027907 Bacteria 4244
442 Ga0268266_10158104 3300028379 Unclassified 2049
443 Ga0268265_10251229 3300028380 Archaea 1566
444 Ga0268264_10140265 3300028381 Unclassified 2154
445 Ga0268264_10447071 3300028381 Bacteria 1251
446 Ga0307513_10246402 3300031456 Bacteria 1587
447 Ga0307408_100116793 3300031548 Bacteria 2060
448 Ga0307408_100288360 3300031548 Bacteria 1370
449 Ga0307405_10309919 3300031731 Bacteria 1201
450 Ga0307413_10108361 3300031824 Bacteria 1854
451 Ga0307412_10283015 3300031911 Bacteria 1303
452 Ga0307409_100294390 3300031995 Bacteria 1507
453 Ga0307416_100144837 3300032002 Bacteria 2167
454 Ga0307416_100245773 3300032002 Bacteria 1738
455 Ga0307416_100492580 3300032002 Bacteria 1288
456 Ga0307414_10260298 3300032004 Bacteria 1447
457 Ga0307411_10060301 3300032005 Bacteria 2519
458 Ga0373940_0031800 3300035088 Unclassified 1411
459 Ga0373951_0003577 3300035091 Bacteria 3748
460 Ga0373931_0009694 3300035691 Bacteria 4612
461 Ga0395900_0105383 3300037418 Unclassified 2897
462 Ga0395900_0252888 3300037418 Unclassified 1763
463 Ga0395900_0339980 3300037418 Unclassified 1477
464 Ga0395905_0092456 3300037471 Unclassified 2837
465 Ga0395905_0186854 3300037471 Bacteria 1945
466 Ga0453683_0260944 3300044673 Unclassified 1105
467 Ga0495580_0064183 3300046472 Bacteria 2575
468 Ga0495664_0155050 3300046477 Bacteria 1389
469 Ga0495663_0000187 3300046525 Bacteria 24698
470 Ga0495598_0000782 3300046537 Bacteria 6070
471 Ga0495621_0001591 3300046539 Bacteria 5925
472 Ga0495621_0011755 3300046539 Bacteria 2718
473 Ga0495636_0064330 3300047318 Bacteria 1556
474 Ga0495672_0073787 3300047320 Unclassified 1923
475 Ga0495684_0210301 3300047471 Bacteria 1431
476 Ga0495615_0003457 3300048090 Bacteria 2648
477 Ga0496102_0046948 3300048905 Unclassified 3923
478 Ga0496102_0349694 3300048905 Bacteria 1392
479 Ga0496102_0367650 3300048905 Unclassified 1354
480 Ga0496103_0049953 3300048906 Unclassified 2587
481 Ga0496106_0014896 3300048909 Bacteria 5752
482 Ga0496106_0022691 3300048909 Bacteria 4664
483 Ga0496106_0111784 3300048909 Unclassified 2128
484 Ga0496106_0127488 3300048909 Bacteria 1993
485 Ga0496109_0485174 3300048912 Unclassified 1167
486 Ga0496112_0192968 3300048915 Bacteria 1998
487 Ga0496112_0219813 3300048915 Bacteria 1856
488 Ga0496112_0370070 3300048915 Bacteria 1375
489 Ga0496125_0210600 3300048928 Bacteria 1263
490 Ga0501291_016173 3300049514 Bacteria 1136
491 Ga0501297_000605 3300049520 Unclassified 3237
492 Ga0501298_004459 3300049521 Bacteria 2207
493 Ga0501207_010322 3300049654 Bacteria 1376
494 Ga0501209_017192 3300049656 Bacteria 1647
495 Ga0501216_009323 3300049660 Bacteria 1562
496 Ga0501217_010705 3300049661 Bacteria 2015
497 Ga0501233_025840 3300049668 Bacteria 1293
498 Ga0501243_013659 3300049675 Bacteria 1292
499 Ga0501256_001283 3300049685 Unclassified 1827
500 Ga0501257_012090 3300049686 Bacteria 1973
501 Ga0501257_034889 3300049686 Unclassified 1222
502 Ga0501258_008444 3300049687 Bacteria 1059
503 Ga0501225_0005324 3300049705 Bacteria 3779
504 Ga0501225_0029694 3300049705 Bacteria 1502
505 Ga0501229_010159 3300049706 Bacteria 1187
506 Ga0501234_005060 3300049707 Unclassified 2068
507 Ga0501272_005008 3300049769 Unclassified 1388
508 Ga0501035_0000041 3300049822 Bacteria 155712
509 Ga0501212_002369 3300049851 Bacteria 2265
510 nmdc:mga05p37_118944_c1 3300050507 Bacteria 3246
511 nmdc:mga05p37_155429_c1 3300050507 Bacteria 2795
512 nmdc:mga05p37_190347_c1 3300050507 Bacteria 2491
513 nmdc:mga05p37_229849_c1 3300050507 Bacteria 1472
514 nmdc:mga05p37_332235_c1 3300050507 Archaea 1795
515 nmdc:mga05p37_4221_c1 3300050507 Bacteria 16786
516 nmdc:mga09592_373825_c1 3300050508 Bacteria 1233
517 nmdc:mga06r32_96730_c1 3300050510 Bacteria 2892
518 nmdc:mga08y16_1248_c1 3300050511 Bacteria 25203
519 nmdc:mga08y16_260258_c1 3300050511 Bacteria 1792
520 nmdc:mga08y16_41282_c1 3300050511 Bacteria 4834
521 nmdc:mga0n895_135431_c1 3300050512 Bacteria 2490
522 nmdc:mga0n895_34179_c1 3300050512 Bacteria 4892
523 nmdc:mga0n895_427002_c1 3300050512 Bacteria 1339
524 nmdc:mga0rr50_153364_c1 3300050513 Unclassified 1864
525 nmdc:mga0rr50_743_c2 3300050513 Bacteria 12899
526 nmdc:mga08x19_27_c1 3300050514 Bacteria 226652
527 nmdc:mga0a205_34461_c1 3300050515 Bacteria 3415
528 nmdc:mga0a205_43651_c1 3300050515 Bacteria 4322
529 nmdc:mga0a205_8891_c1 3300050515 Bacteria 9153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10182747 Ga0207674_101827472 271
2 3300046472 Ga0495580_0064183 Ga0495580_0064183_1003_1884 279
3 3300005364 Ga0070673_100158712 Ga0070673_1001587122 281
4 3300009177 Ga0105248_10024473 Ga0105248_100244737 281
5 3300031995 Ga0307409_100294390 Ga0307409_1002943902 281
6 3300032002 Ga0307416_100245773 Ga0307416_1002457733 281
7 3300049514 Ga0501291_016173 Ga0501291_016173_201_1085 281
8 3300049656 Ga0501209_017192 Ga0501209_017192_181_1065 281
9 3300049686 Ga0501257_012090 Ga0501257_012090_639_1523 281
10 3300049705 Ga0501225_0029694 Ga0501225_0029694_18_902 281
11 3300005290 Ga0065712_10004634 Ga0065712_100046343 282
12 3300005330 Ga0070690_100070791 Ga0070690_1000707913 282
13 3300005343 Ga0070687_100003666 Ga0070687_1000036662 282
14 3300005345 Ga0070692_10198747 Ga0070692_101987471 282
15 3300005364 Ga0070673_100230295 Ga0070673_1002302952 282
16 3300005441 Ga0070700_100001687 Ga0070700_1000016876 282
17 3300005544 Ga0070686_100004746 Ga0070686_1000047467 282
18 3300005545 Ga0070695_100142286 Ga0070695_1001422862 282
19 3300005617 Ga0068859_100019484 Ga0068859_1000194846 282
20 3300005617 Ga0068859_100297632 Ga0068859_1002976322 282
21 3300005842 Ga0068858_100156139 Ga0068858_1001561392 282
22 3300006844 Ga0075428_100109034 Ga0075428_1001090342 282
23 3300006844 Ga0075428_100144458 Ga0075428_1001444583 282
24 3300006931 Ga0097620_100019484 Ga0097620_1000194846 282
25 3300006931 Ga0097620_100297641 Ga0097620_1002976412 282
26 3300009093 Ga0105240_10078704 Ga0105240_100787043 282
27 3300009098 Ga0105245_10556075 Ga0105245_105560752 282
28 3300009147 Ga0114129_10176384 Ga0114129_101763842 282
29 3300009147 Ga0114129_10520626 Ga0114129_105206262 282
30 3300009177 Ga0105248_10002561 Ga0105248_100025615 282
31 3300013306 Ga0163162_10313029 Ga0163162_103130292 282
32 3300013307 Ga0157372_10050817 Ga0157372_100508175 282
33 3300026075 Ga0207708_10003823 Ga0207708_100038236 282
34 3300026088 Ga0207641_10294083 Ga0207641_102940832 282
35 3300031824 Ga0307413_10108361 Ga0307413_101083612 282
36 3300032004 Ga0307414_10260298 Ga0307414_102602982 282
37 3300035088 Ga0373940_0031800 Ga0373940_0031800_51_905 282
38 3300035691 Ga0373931_0009694 Ga0373931_0009694_3629_4483 282
39 3300049654 Ga0501207_010322 Ga0501207_010322_457_1317 282
40 3300049661 Ga0501217_010705 Ga0501217_010705_1006_1866 282
41 3300049685 Ga0501256_001283 Ga0501256_001283_870_1724 282
42 3300049686 Ga0501257_034889 Ga0501257_034889_237_1169 282
43 3300049687 Ga0501258_008444 Ga0501258_008444_23_883 282
44 3300049706 Ga0501229_010159 Ga0501229_010159_62_922 282
45 3300049707 Ga0501234_005060 Ga0501234_005060_992_1846 282
46 3300002074 JGI24748J21848_1000014 JGI24748J21848_100001423 283
47 3300002239 JGI24034J26672_10000012 JGI24034J26672_10000012101 283
48 3300005290 Ga0065712_10086626 Ga0065712_100866262 283
49 3300005295 Ga0065707_10011478 Ga0065707_100114781 283
50 3300005330 Ga0070690_100027211 Ga0070690_1000272111 283
51 3300005334 Ga0068869_100030759 Ga0068869_1000307595 283
52 3300005334 Ga0068869_100088511 Ga0068869_1000885113 283
53 3300005337 Ga0070682_100001105 Ga0070682_1000011059 283
54 3300005338 Ga0068868_100075379 Ga0068868_1000753792 283
55 3300005340 Ga0070689_100209559 Ga0070689_1002095591 283
56 3300005343 Ga0070687_100028930 Ga0070687_1000289302 283
57 3300005344 Ga0070661_100084754 Ga0070661_1000847542 283
58 3300005347 Ga0070668_100001395 Ga0070668_1000013956 283
59 3300005347 Ga0070668_100521724 Ga0070668_1005217241 283
60 3300005353 Ga0070669_100013173 Ga0070669_1000131732 283
61 3300005353 Ga0070669_100065198 Ga0070669_1000651982 283
62 3300005355 Ga0070671_100052525 Ga0070671_1000525252 283
63 3300005356 Ga0070674_100010156 Ga0070674_1000101562 283
64 3300005365 Ga0070688_100019588 Ga0070688_1000195883 283
65 3300005366 Ga0070659_100055617 Ga0070659_1000556173 283
66 3300005367 Ga0070667_100079734 Ga0070667_1000797342 283
67 3300005438 Ga0070701_10040403 Ga0070701_100404032 283
68 3300005440 Ga0070705_100026535 Ga0070705_1000265352 283
69 3300005441 Ga0070700_100058987 Ga0070700_1000589873 283
70 3300005444 Ga0070694_100002499 Ga0070694_1000024992 283
71 3300005444 Ga0070694_100063472 Ga0070694_1000634722 283
72 3300005455 Ga0070663_100474896 Ga0070663_1004748961 283
73 3300005456 Ga0070678_100017457 Ga0070678_1000174573 283
74 3300005457 Ga0070662_100160298 Ga0070662_1001602981 283
75 3300005459 Ga0068867_100047767 Ga0068867_1000477672 283
76 3300005466 Ga0070685_10007588 Ga0070685_100075882 283
77 3300005467 Ga0070706_100004816 Ga0070706_1000048162 283
78 3300005468 Ga0070707_100000284 Ga0070707_10000028415 283
79 3300005471 Ga0070698_100001091 Ga0070698_10000109117 283
80 3300005471 Ga0070698_100063822 Ga0070698_1000638221 283
81 3300005471 Ga0070698_100303294 Ga0070698_1003032941 283
82 3300005518 Ga0070699_100042744 Ga0070699_1000427442 283
83 3300005518 Ga0070699_100059446 Ga0070699_1000594462 283
84 3300005530 Ga0070679_100017594 Ga0070679_1000175944 283
85 3300005535 Ga0070684_100093833 Ga0070684_1000938333 283
86 3300005536 Ga0070697_100032772 Ga0070697_1000327724 283
87 3300005536 Ga0070697_100051794 Ga0070697_1000517944 283
88 3300005546 Ga0070696_100051480 Ga0070696_1000514803 283
89 3300005546 Ga0070696_100057373 Ga0070696_1000573733 283
90 3300005546 Ga0070696_100080925 Ga0070696_1000809252 283
91 3300005549 Ga0070704_100137245 Ga0070704_1001372452 283
92 3300005564 Ga0070664_100000982 Ga0070664_10000098213 283
93 3300005577 Ga0068857_100000684 Ga0068857_10000068412 283
94 3300005578 Ga0068854_100011088 Ga0068854_1000110886 283
95 3300005578 Ga0068854_100157952 Ga0068854_1001579522 283
96 3300005578 Ga0068854_100274349 Ga0068854_1002743491 283
97 3300005615 Ga0070702_100006355 Ga0070702_1000063552 283
98 3300005615 Ga0070702_100051597 Ga0070702_1000515972 283
99 3300005617 Ga0068859_100119894 Ga0068859_1001198944 283
100 3300005617 Ga0068859_100141186 Ga0068859_1001411862 283
101 3300005617 Ga0068859_100562227 Ga0068859_1005622272 283
102 3300005718 Ga0068866_10045175 Ga0068866_100451752 283
103 3300005719 Ga0068861_100331666 Ga0068861_1003316662 283
104 3300005840 Ga0068870_10100822 Ga0068870_101008222 283
105 3300005841 Ga0068863_100109177 Ga0068863_1001091773 283
106 3300005842 Ga0068858_100007933 Ga0068858_1000079338 283
107 3300005842 Ga0068858_100012441 Ga0068858_1000124419 283
108 3300005842 Ga0068858_100095242 Ga0068858_1000952423 283
109 3300005843 Ga0068860_100021224 Ga0068860_1000212242 283
110 3300005843 Ga0068860_100082577 Ga0068860_1000825774 283
111 3300005844 Ga0068862_100025782 Ga0068862_1000257825 283
112 3300005844 Ga0068862_100037085 Ga0068862_1000370854 283
113 3300006163 Ga0070715_10000017 Ga0070715_1000001767 283
114 3300006237 Ga0097621_100002178 Ga0097621_1000021789 283
115 3300006237 Ga0097621_100415138 Ga0097621_1004151382 283
116 3300006358 Ga0068871_100008713 Ga0068871_1000087132 283
117 3300006844 Ga0075428_100739794 Ga0075428_1007397942 283
118 3300006852 Ga0075433_10451907 Ga0075433_104519072 283
119 3300006871 Ga0075434_100022506 Ga0075434_1000225066 283
120 3300006881 Ga0068865_100008322 Ga0068865_1000083226 283
121 3300006931 Ga0097620_100119889 Ga0097620_1001198894 283
122 3300006931 Ga0097620_100141181 Ga0097620_1001411814 283
123 3300006931 Ga0097620_100562247 Ga0097620_1005622472 283
124 3300009094 Ga0111539_10095015 Ga0111539_100950152 283
125 3300009098 Ga0105245_10053384 Ga0105245_100533842 283
126 3300009098 Ga0105245_10171986 Ga0105245_101719861 283
127 3300009101 Ga0105247_10000050 Ga0105247_1000005023 283
128 3300009147 Ga0114129_10072705 Ga0114129_100727052 283
129 3300009148 Ga0105243_10000112 Ga0105243_1000011213 283
130 3300009148 Ga0105243_10001558 Ga0105243_1000155816 283
131 3300009174 Ga0105241_10077748 Ga0105241_100777482 283
132 3300009176 Ga0105242_10000013 Ga0105242_10000013104 283
133 3300009176 Ga0105242_10001346 Ga0105242_1000134610 283
134 3300009177 Ga0105248_10014161 Ga0105248_100141617 283
135 3300009177 Ga0105248_10023953 Ga0105248_100239534 283
136 3300009553 Ga0105249_10000025 Ga0105249_10000025203 283
137 3300009553 Ga0105249_10058224 Ga0105249_100582242 283
138 3300009553 Ga0105249_10081906 Ga0105249_100819063 283
139 3300010375 Ga0105239_10017438 Ga0105239_100174387 283
140 3300010375 Ga0105239_10318664 Ga0105239_103186642 283
141 3300011119 Ga0105246_10003721 Ga0105246_100037218 283
142 3300013100 Ga0157373_10024905 Ga0157373_100249053 283
143 3300013297 Ga0157378_10000001 Ga0157378_1000000142 283
144 3300013297 Ga0157378_10008709 Ga0157378_100087093 283
145 3300013297 Ga0157378_10175051 Ga0157378_101750512 283
146 3300013297 Ga0157378_10230749 Ga0157378_102307491 283
147 3300013306 Ga0163162_10000002 Ga0163162_10000002387 283
148 3300013306 Ga0163162_10210647 Ga0163162_102106472 283
149 3300013306 Ga0163162_10328007 Ga0163162_103280073 283
150 3300013308 Ga0157375_10257202 Ga0157375_102572021 283
151 3300014325 Ga0163163_10003677 Ga0163163_1000367712 283
152 3300014325 Ga0163163_10017537 Ga0163163_100175374 283
153 3300014325 Ga0163163_10045316 Ga0163163_100453163 283
154 3300014326 Ga0157380_10028901 Ga0157380_100289013 283
155 3300014326 Ga0157380_10214533 Ga0157380_102145332 283
156 3300014968 Ga0157379_10348610 Ga0157379_103486101 283
157 3300014969 Ga0157376_10003648 Ga0157376_100036485 283
158 3300025899 Ga0207642_10027013 Ga0207642_100270133 283
159 3300025903 Ga0207680_10096154 Ga0207680_100961542 283
160 3300025908 Ga0207643_10116663 Ga0207643_101166632 283
161 3300025910 Ga0207684_10009666 Ga0207684_100096667 283
162 3300025912 Ga0207707_10038799 Ga0207707_100387994 283
163 3300025918 Ga0207662_10003048 Ga0207662_100030485 283
164 3300025918 Ga0207662_10003743 Ga0207662_100037433 283
165 3300025920 Ga0207649_10050554 Ga0207649_100505542 283
166 3300025922 Ga0207646_10094761 Ga0207646_100947614 283
167 3300025923 Ga0207681_10074869 Ga0207681_100748693 283
168 3300025926 Ga0207659_10152426 Ga0207659_101524262 283
169 3300025931 Ga0207644_10059021 Ga0207644_100590213 283
170 3300025932 Ga0207690_10263467 Ga0207690_102634672 283
171 3300025933 Ga0207706_10442336 Ga0207706_104423362 283
172 3300025935 Ga0207709_10005717 Ga0207709_100057172 283
173 3300025935 Ga0207709_10090217 Ga0207709_100902171 283
174 3300025937 Ga0207669_10017108 Ga0207669_100171084 283
175 3300025940 Ga0207691_10009958 Ga0207691_100099585 283
176 3300025941 Ga0207711_10253376 Ga0207711_102533761 283
177 3300025942 Ga0207689_10003279 Ga0207689_100032798 283
178 3300025942 Ga0207689_10142067 Ga0207689_101420672 283
179 3300025945 Ga0207679_10003867 Ga0207679_100038675 283
180 3300025961 Ga0207712_10142753 Ga0207712_101427532 283
181 3300026023 Ga0207677_10045310 Ga0207677_100453103 283
182 3300026035 Ga0207703_10049020 Ga0207703_100490202 283
183 3300026041 Ga0207639_10019046 Ga0207639_100190463 283
184 3300026075 Ga0207708_10014853 Ga0207708_100148534 283
185 3300026089 Ga0207648_10065633 Ga0207648_100656332 283
186 3300026095 Ga0207676_10054576 Ga0207676_100545763 283
187 3300026116 Ga0207674_10000037 Ga0207674_1000003714 283
188 3300026118 Ga0207675_100061543 Ga0207675_1000615432 283
189 3300026121 Ga0207683_10003301 Ga0207683_1000330112 283
190 3300048090 Ga0495615_0003457 Ga0495615_0003457_974_1843 283
191 3300048909 Ga0496106_0022691 Ga0496106_0022691_1331_2230 283
192 3300048928 Ga0496125_0210600 Ga0496125_0210600_302_1180 283
193 3300049822 Ga0501035_0000041 Ga0501035_0000041_95653_96534 283
194 3300002459 JGI24751J29686_10000008 JGI24751J29686_1000000829 284
195 3300005330 Ga0070690_100063075 Ga0070690_1000630752 284
196 3300005331 Ga0070670_100000937 Ga0070670_1000009377 284
197 3300005331 Ga0070670_100388856 Ga0070670_1003888561 284
198 3300005406 Ga0070703_10000806 Ga0070703_100008065 284
199 3300005434 Ga0070709_10111562 Ga0070709_101115622 284
200 3300005444 Ga0070694_100017132 Ga0070694_1000171322 284
201 3300005467 Ga0070706_100343415 Ga0070706_1003434152 284
202 3300005536 Ga0070697_100072138 Ga0070697_1000721382 284
203 3300005577 Ga0068857_100046215 Ga0068857_1000462155 284
204 3300005617 Ga0068859_100551067 Ga0068859_1005510671 284
205 3300005618 Ga0068864_100019740 Ga0068864_1000197405 284
206 3300005840 Ga0068870_10143818 Ga0068870_101438182 284
207 3300005842 Ga0068858_100056136 Ga0068858_1000561362 284
208 3300006173 Ga0070716_100170456 Ga0070716_1001704562 284
209 3300006914 Ga0075436_100000101 Ga0075436_10000010141 284
210 3300006931 Ga0097620_100551059 Ga0097620_1005510592 284
211 3300007076 Ga0075435_100009232 Ga0075435_1000092323 284
212 3300009101 Ga0105247_10000686 Ga0105247_1000068613 284
213 3300009176 Ga0105242_10000636 Ga0105242_1000063619 284
214 3300009553 Ga0105249_10002819 Ga0105249_100028192 284
215 3300013306 Ga0163162_10037544 Ga0163162_100375443 284
216 3300014325 Ga0163163_10000576 Ga0163163_1000057614 284
217 3300014325 Ga0163163_10507334 Ga0163163_105073342 284
218 3300025885 Ga0207653_10000035 Ga0207653_1000003534 284
219 3300025900 Ga0207710_10000555 Ga0207710_1000055514 284
220 3300025906 Ga0207699_10149925 Ga0207699_101499251 284
221 3300025908 Ga0207643_10111851 Ga0207643_101118512 284
222 3300025914 Ga0207671_10160247 Ga0207671_101602472 284
223 3300025925 Ga0207650_10000001 Ga0207650_100000011261 284
224 3300025931 Ga0207644_10000093 Ga0207644_1000009342 284
225 3300025931 Ga0207644_10132229 Ga0207644_101322292 284
226 3300025934 Ga0207686_10000012 Ga0207686_10000012105 284
227 3300025939 Ga0207665_10146302 Ga0207665_101463022 284
228 3300025942 Ga0207689_10546278 Ga0207689_105462781 284
229 3300025961 Ga0207712_10017941 Ga0207712_100179412 284
230 3300026035 Ga0207703_10011188 Ga0207703_100111883 284
231 3300026095 Ga0207676_10049721 Ga0207676_100497212 284
232 3300026116 Ga0207674_10035677 Ga0207674_100356773 284
233 3300044673 Ga0453683_0260944 Ga0453683_0260944_68_922 284
234 3300046477 Ga0495664_0155050 Ga0495664_0155050_342_1196 284
235 3300047318 Ga0495636_0064330 Ga0495636_0064330_323_1177 284
236 3300047471 Ga0495684_0210301 Ga0495684_0210301_284_1138 284
237 3300048905 Ga0496102_0367650 Ga0496102_0367650_74_931 284
238 3300048915 Ga0496112_0192968 Ga0496112_0192968_393_1253 284
239 3300050507 nmdc:mga05p37_190347_c1 nmdc:mga05p37_190347_c1_655_1509 284
240 3300050513 nmdc:mga0rr50_743_c2 nmdc:mga0rr50_743_c2_2271_3128 284
241 3300050514 nmdc:mga08x19_27_c1 nmdc:mga08x19_27_c1_140683_141540 284
242 3300005340 Ga0070689_100185107 Ga0070689_1001851072 285
243 3300025936 Ga0207670_10154990 Ga0207670_101549902 285
244 3300032002 Ga0307416_100492580 Ga0307416_1004925802 285
245 3300032005 Ga0307411_10060301 Ga0307411_100603013 285
246 3300048915 Ga0496112_0370070 Ga0496112_0370070_150_1016 285
247 3300050511 nmdc:mga08y16_260258_c1 nmdc:mga08y16_260258_c1_760_1677 285
248 3300005293 Ga0065715_10147351 Ga0065715_101473512 286
249 3300005331 Ga0070670_100017381 Ga0070670_1000173813 286
250 3300005366 Ga0070659_100055212 Ga0070659_1000552123 286
251 3300005545 Ga0070695_100237475 Ga0070695_1002374752 286
252 3300005617 Ga0068859_100099576 Ga0068859_1000995764 286
253 3300005617 Ga0068859_100164803 Ga0068859_1001648032 286
254 3300005617 Ga0068859_100171322 Ga0068859_1001713222 286
255 3300005719 Ga0068861_100096084 Ga0068861_1000960842 286
256 3300005843 Ga0068860_100445850 Ga0068860_1004458502 286
257 3300006358 Ga0068871_100053522 Ga0068871_1000535224 286
258 3300006931 Ga0097620_100099577 Ga0097620_1000995774 286
259 3300006931 Ga0097620_100164801 Ga0097620_1001648012 286
260 3300006931 Ga0097620_100171306 Ga0097620_1001713062 286
261 3300009101 Ga0105247_10273915 Ga0105247_102739151 286
262 3300009147 Ga0114129_10000855 Ga0114129_1000085520 286
263 3300025904 Ga0207647_10003679 Ga0207647_100036792 286
264 3300025925 Ga0207650_10014456 Ga0207650_100144564 286
265 3300025932 Ga0207690_10014227 Ga0207690_100142273 286
266 3300025942 Ga0207689_10026211 Ga0207689_100262113 286
267 3300025960 Ga0207651_10496820 Ga0207651_104968202 286
268 3300026035 Ga0207703_10403155 Ga0207703_104031552 286
269 3300026118 Ga0207675_100099270 Ga0207675_1000992702 286
270 3300026118 Ga0207675_100144926 Ga0207675_1001449263 286
271 3300048909 Ga0496106_0014896 Ga0496106_0014896_4791_5705 286
272 3300049675 Ga0501243_013659 Ga0501243_013659_297_1169 286
273 3300050507 nmdc:mga05p37_4221_c1 nmdc:mga05p37_4221_c1_14408_15304 286
274 3300005441 Ga0070700_100026564 Ga0070700_1000265644 287
275 3300005467 Ga0070706_100058337 Ga0070706_1000583372 287
276 3300005719 Ga0068861_100035636 Ga0068861_1000356365 287
277 3300005842 Ga0068858_100024559 Ga0068858_1000245592 287
278 3300009093 Ga0105240_10733360 Ga0105240_107333601 287
279 3300009148 Ga0105243_10046055 Ga0105243_100460554 287
280 3300013308 Ga0157375_10015021 Ga0157375_100150215 287
281 3300025935 Ga0207709_10395120 Ga0207709_103951201 287
282 3300025940 Ga0207691_10251097 Ga0207691_102510971 287
283 3300026035 Ga0207703_10111220 Ga0207703_101112202 287
284 3300026075 Ga0207708_10012215 Ga0207708_100122155 287
285 3300026118 Ga0207675_100032851 Ga0207675_1000328512 287
286 3300031456 Ga0307513_10246402 Ga0307513_102464022 287
287 3300031548 Ga0307408_100288360 Ga0307408_1002883602 287
288 3300047320 Ga0495672_0073787 Ga0495672_0073787_552_1616 287
289 3300048909 Ga0496106_0127488 Ga0496106_0127488_953_1855 287
290 3300049520 Ga0501297_000605 Ga0501297_000605_2118_3044 287
291 3300049521 Ga0501298_004459 Ga0501298_004459_467_1393 287
292 3300049660 Ga0501216_009323 Ga0501216_009323_98_1024 287
293 3300049668 Ga0501233_025840 Ga0501233_025840_272_1198 287
294 3300049705 Ga0501225_0005324 Ga0501225_0005324_327_1253 287
295 3300005289 Ga0065704_10101934 Ga0065704_101019342 288
296 3300005289 Ga0065704_10105465 Ga0065704_101054652 288
297 3300005290 Ga0065712_10000112 Ga0065712_10000112193 288
298 3300005293 Ga0065715_10090657 Ga0065715_100906572 288
299 3300005295 Ga0065707_10116447 Ga0065707_101164473 288
300 3300005295 Ga0065707_10136531 Ga0065707_101365312 288
301 3300005330 Ga0070690_100155847 Ga0070690_1001558472 288
302 3300005331 Ga0070670_100000136 Ga0070670_10000013639 288
303 3300005331 Ga0070670_100158605 Ga0070670_1001586052 288
304 3300005334 Ga0068869_100037825 Ga0068869_1000378253 288
305 3300005334 Ga0068869_100060950 Ga0068869_1000609503 288
306 3300005334 Ga0068869_100204609 Ga0068869_1002046092 288
307 3300005335 Ga0070666_10011117 Ga0070666_100111174 288
308 3300005336 Ga0070680_100000420 Ga0070680_10000042022 288
309 3300005337 Ga0070682_100024420 Ga0070682_1000244202 288
310 3300005338 Ga0068868_100055295 Ga0068868_1000552953 288
311 3300005340 Ga0070689_100082922 Ga0070689_1000829222 288
312 3300005345 Ga0070692_10089445 Ga0070692_100894452 288
313 3300005353 Ga0070669_100000969 Ga0070669_10000096910 288
314 3300005353 Ga0070669_100001076 Ga0070669_10000107619 288
315 3300005355 Ga0070671_100035787 Ga0070671_1000357872 288
316 3300005355 Ga0070671_100175850 Ga0070671_1001758501 288
317 3300005355 Ga0070671_100257104 Ga0070671_1002571043 288
318 3300005364 Ga0070673_100004235 Ga0070673_1000042357 288
319 3300005364 Ga0070673_100162718 Ga0070673_1001627183 288
320 3300005367 Ga0070667_100014772 Ga0070667_1000147724 288
321 3300005438 Ga0070701_10035393 Ga0070701_100353932 288
322 3300005440 Ga0070705_100018607 Ga0070705_1000186071 288
323 3300005441 Ga0070700_100070810 Ga0070700_1000708101 288
324 3300005444 Ga0070694_100044809 Ga0070694_1000448094 288
325 3300005444 Ga0070694_100058888 Ga0070694_1000588883 288
326 3300005444 Ga0070694_100060154 Ga0070694_1000601542 288
327 3300005444 Ga0070694_100415162 Ga0070694_1004151621 288
328 3300005445 Ga0070708_100087716 Ga0070708_1000877161 288
329 3300005445 Ga0070708_100123407 Ga0070708_1001234072 288
330 3300005457 Ga0070662_100101385 Ga0070662_1001013852 288
331 3300005457 Ga0070662_100283928 Ga0070662_1002839281 288
332 3300005458 Ga0070681_10000329 Ga0070681_1000032922 288
333 3300005467 Ga0070706_100000425 Ga0070706_10000042530 288
334 3300005467 Ga0070706_100197969 Ga0070706_1001979692 288
335 3300005468 Ga0070707_100009698 Ga0070707_1000096983 288
336 3300005468 Ga0070707_100116861 Ga0070707_1001168613 288
337 3300005468 Ga0070707_100586756 Ga0070707_1005867561 288
338 3300005471 Ga0070698_100004056 Ga0070698_1000040567 288
339 3300005471 Ga0070698_100004176 Ga0070698_10000417613 288
340 3300005471 Ga0070698_100052477 Ga0070698_1000524774 288
341 3300005471 Ga0070698_100100902 Ga0070698_1001009023 288
342 3300005518 Ga0070699_100008590 Ga0070699_1000085903 288
343 3300005518 Ga0070699_100053023 Ga0070699_1000530234 288
344 3300005518 Ga0070699_100170714 Ga0070699_1001707142 288
345 3300005518 Ga0070699_100677188 Ga0070699_1006771881 288
346 3300005530 Ga0070679_100000439 Ga0070679_10000043915 288
347 3300005536 Ga0070697_100000109 Ga0070697_10000010945 288
348 3300005536 Ga0070697_100001077 Ga0070697_10000107717 288
349 3300005536 Ga0070697_100001462 Ga0070697_1000014627 288
350 3300005536 Ga0070697_100015843 Ga0070697_1000158434 288
351 3300005536 Ga0070697_100040488 Ga0070697_1000404885 288
352 3300005543 Ga0070672_100176648 Ga0070672_1001766482 288
353 3300005543 Ga0070672_100192975 Ga0070672_1001929752 288
354 3300005545 Ga0070695_100029852 Ga0070695_1000298524 288
355 3300005545 Ga0070695_100360760 Ga0070695_1003607601 288
356 3300005546 Ga0070696_100062289 Ga0070696_1000622893 288
357 3300005546 Ga0070696_100096512 Ga0070696_1000965123 288
358 3300005546 Ga0070696_100206812 Ga0070696_1002068122 288
359 3300005546 Ga0070696_100314864 Ga0070696_1003148641 288
360 3300005547 Ga0070693_100031399 Ga0070693_1000313992 288
361 3300005548 Ga0070665_100099841 Ga0070665_1000998413 288
362 3300005549 Ga0070704_100038506 Ga0070704_1000385064 288
363 3300005549 Ga0070704_100084027 Ga0070704_1000840272 288
364 3300005616 Ga0068852_100621344 Ga0068852_1006213441 288
365 3300005617 Ga0068859_100119678 Ga0068859_1001196782 288
366 3300005617 Ga0068859_100131200 Ga0068859_1001312002 288
367 3300005618 Ga0068864_100050832 Ga0068864_1000508324 288
368 3300005618 Ga0068864_100096934 Ga0068864_1000969342 288
369 3300005618 Ga0068864_100155785 Ga0068864_1001557853 288
370 3300005618 Ga0068864_100407793 Ga0068864_1004077932 288
371 3300005719 Ga0068861_100020934 Ga0068861_1000209343 288
372 3300005834 Ga0068851_10001024 Ga0068851_100010244 288
373 3300005834 Ga0068851_10206260 Ga0068851_102062601 288
374 3300005840 Ga0068870_10018530 Ga0068870_100185304 288
375 3300005841 Ga0068863_100203860 Ga0068863_1002038602 288
376 3300005841 Ga0068863_100284895 Ga0068863_1002848952 288
377 3300005841 Ga0068863_100336387 Ga0068863_1003363872 288
378 3300005843 Ga0068860_100281779 Ga0068860_1002817792 288
379 3300005844 Ga0068862_100026551 Ga0068862_1000265511 288
380 3300005844 Ga0068862_100047182 Ga0068862_1000471823 288
381 3300005983 Ga0081540_1070204 Ga0081540_10702042 288
382 3300005985 Ga0081539_10000804 Ga0081539_1000080419 288
383 3300006237 Ga0097621_100198904 Ga0097621_1001989041 288
384 3300006358 Ga0068871_100022655 Ga0068871_1000226554 288
385 3300006846 Ga0075430_100019131 Ga0075430_1000191312 288
386 3300006847 Ga0075431_100020724 Ga0075431_1000207247 288
387 3300006847 Ga0075431_100256275 Ga0075431_1002562752 288
388 3300006852 Ga0075433_10057418 Ga0075433_100574182 288
389 3300006852 Ga0075433_10066074 Ga0075433_100660743 288
390 3300006852 Ga0075433_10319110 Ga0075433_103191102 288
391 3300006852 Ga0075433_10438038 Ga0075433_104380382 288
392 3300006871 Ga0075434_100258220 Ga0075434_1002582202 288
393 3300006871 Ga0075434_100539843 Ga0075434_1005398432 288
394 3300006871 Ga0075434_100751945 Ga0075434_1007519451 288
395 3300006931 Ga0097620_100119676 Ga0097620_1001196763 288
396 3300006931 Ga0097620_100131209 Ga0097620_1001312092 288
397 3300006931 Ga0097620_100211936 Ga0097620_1002119362 288
398 3300007076 Ga0075435_100083743 Ga0075435_1000837431 288
399 3300007076 Ga0075435_100153919 Ga0075435_1001539192 288
400 3300009094 Ga0111539_10032289 Ga0111539_100322893 288
401 3300009094 Ga0111539_10233903 Ga0111539_102339032 288
402 3300009098 Ga0105245_10468360 Ga0105245_104683601 288
403 3300009147 Ga0114129_10004324 Ga0114129_1000432416 288
404 3300009147 Ga0114129_10071035 Ga0114129_100710353 288
405 3300009147 Ga0114129_10128215 Ga0114129_101282155 288
406 3300009147 Ga0114129_10141398 Ga0114129_101413984 288
407 3300009148 Ga0105243_10001700 Ga0105243_100017008 288
408 3300009174 Ga0105241_10238151 Ga0105241_102381512 288
409 3300009176 Ga0105242_10009681 Ga0105242_100096818 288
410 3300009176 Ga0105242_10155642 Ga0105242_101556422 288
411 3300009177 Ga0105248_10062938 Ga0105248_100629384 288
412 3300009545 Ga0105237_10001019 Ga0105237_100010198 288
413 3300009545 Ga0105237_10022465 Ga0105237_100224655 288
414 3300010375 Ga0105239_10688841 Ga0105239_106888411 288
415 3300011119 Ga0105246_10264610 Ga0105246_102646102 288
416 3300013100 Ga0157373_10012338 Ga0157373_100123384 288
417 3300013102 Ga0157371_10188962 Ga0157371_101889622 288
418 3300013296 Ga0157374_10149966 Ga0157374_101499663 288
419 3300013297 Ga0157378_10006891 Ga0157378_100068913 288
420 3300013297 Ga0157378_10078117 Ga0157378_100781172 288
421 3300013297 Ga0157378_10192206 Ga0157378_101922062 288
422 3300013297 Ga0157378_10197738 Ga0157378_101977382 288
423 3300013306 Ga0163162_10000610 Ga0163162_1000061018 288
424 3300013306 Ga0163162_10072567 Ga0163162_100725674 288
425 3300013306 Ga0163162_10232871 Ga0163162_102328713 288
426 3300013307 Ga0157372_10490195 Ga0157372_104901952 288
427 3300013308 Ga0157375_10025566 Ga0157375_100255664 288
428 3300013308 Ga0157375_10209586 Ga0157375_102095862 288
429 3300014325 Ga0163163_10007052 Ga0163163_100070525 288
430 3300014325 Ga0163163_10017153 Ga0163163_100171535 288
431 3300014325 Ga0163163_10050037 Ga0163163_100500372 288
432 3300014325 Ga0163163_10163004 Ga0163163_101630043 288
433 3300014326 Ga0157380_10006958 Ga0157380_100069583 288
434 3300014326 Ga0157380_10017149 Ga0157380_100171496 288
435 3300014326 Ga0157380_10392876 Ga0157380_103928761 288
436 3300014745 Ga0157377_10036090 Ga0157377_100360903 288
437 3300014969 Ga0157376_10230384 Ga0157376_102303842 288
438 3300025321 Ga0207656_10000933 Ga0207656_100009334 288
439 3300025885 Ga0207653_10014489 Ga0207653_100144891 288
440 3300025910 Ga0207684_10000168 Ga0207684_1000016834 288
441 3300025910 Ga0207684_10001178 Ga0207684_100011785 288
442 3300025910 Ga0207684_10090170 Ga0207684_100901702 288
443 3300025910 Ga0207684_10431476 Ga0207684_104314761 288
444 3300025912 Ga0207707_10000037 Ga0207707_1000003752 288
445 3300025912 Ga0207707_10052721 Ga0207707_100527215 288
446 3300025914 Ga0207671_10002920 Ga0207671_100029209 288
447 3300025917 Ga0207660_10001157 Ga0207660_100011575 288
448 3300025918 Ga0207662_10164971 Ga0207662_101649712 288
449 3300025921 Ga0207652_10000417 Ga0207652_1000041714 288
450 3300025923 Ga0207681_10001089 Ga0207681_100010893 288
451 3300025924 Ga0207694_10001601 Ga0207694_1000160117 288
452 3300025925 Ga0207650_10001194 Ga0207650_1000119418 288
453 3300025925 Ga0207650_10142757 Ga0207650_101427572 288
454 3300025925 Ga0207650_10393330 Ga0207650_103933301 288
455 3300025931 Ga0207644_10006469 Ga0207644_100064693 288
456 3300025931 Ga0207644_10048222 Ga0207644_100482222 288
457 3300025932 Ga0207690_10344231 Ga0207690_103442312 288
458 3300025933 Ga0207706_10109954 Ga0207706_101099542 288
459 3300025933 Ga0207706_10122593 Ga0207706_101225932 288
460 3300025933 Ga0207706_10364038 Ga0207706_103640381 288
461 3300025935 Ga0207709_10000636 Ga0207709_1000063614 288
462 3300025936 Ga0207670_10000374 Ga0207670_100003742 288
463 3300025936 Ga0207670_10020488 Ga0207670_100204882 288
464 3300025941 Ga0207711_10062723 Ga0207711_100627234 288
465 3300025942 Ga0207689_10053412 Ga0207689_100534123 288
466 3300025942 Ga0207689_10055598 Ga0207689_100555982 288
467 3300025960 Ga0207651_10078505 Ga0207651_100785053 288
468 3300025961 Ga0207712_10033113 Ga0207712_100331132 288
469 3300025981 Ga0207640_10034775 Ga0207640_100347754 288
470 3300025986 Ga0207658_10081460 Ga0207658_100814603 288
471 3300026041 Ga0207639_10507421 Ga0207639_105074211 288
472 3300026075 Ga0207708_10138715 Ga0207708_101387152 288
473 3300026075 Ga0207708_10200307 Ga0207708_102003072 288
474 3300026075 Ga0207708_10230098 Ga0207708_102300982 288
475 3300026088 Ga0207641_10090099 Ga0207641_100900993 288
476 3300026088 Ga0207641_10181490 Ga0207641_101814902 288
477 3300026088 Ga0207641_10208934 Ga0207641_102089342 288
478 3300026089 Ga0207648_10009538 Ga0207648_100095381 288
479 3300026095 Ga0207676_10014954 Ga0207676_100149542 288
480 3300026095 Ga0207676_10016390 Ga0207676_100163903 288
481 3300026095 Ga0207676_10229982 Ga0207676_102299822 288
482 3300026095 Ga0207676_10318106 Ga0207676_103181062 288
483 3300026116 Ga0207674_10625716 Ga0207674_106257161 288
484 3300026118 Ga0207675_100026615 Ga0207675_1000266153 288
485 3300026142 Ga0207698_10030827 Ga0207698_100308272 288
486 3300026142 Ga0207698_10374339 Ga0207698_103743392 288
487 3300027907 Ga0207428_10033151 Ga0207428_100331513 288
488 3300028379 Ga0268266_10158104 Ga0268266_101581042 288
489 3300028380 Ga0268265_10251229 Ga0268265_102512292 288
490 3300028381 Ga0268264_10140265 Ga0268264_101402653 288
491 3300028381 Ga0268264_10447071 Ga0268264_104470712 288
492 3300031548 Ga0307408_100116793 Ga0307408_1001167932 288
493 3300031731 Ga0307405_10309919 Ga0307405_103099192 288
494 3300031911 Ga0307412_10283015 Ga0307412_102830151 288
495 3300032002 Ga0307416_100144837 Ga0307416_1001448373 288
496 3300035091 Ga0373951_0003577 Ga0373951_0003577_318_1199 288
497 3300037418 Ga0395900_0105383 Ga0395900_0105383_784_1656 288
498 3300037418 Ga0395900_0252888 Ga0395900_0252888_417_1289 288
499 3300037418 Ga0395900_0339980 Ga0395900_0339980_44_916 288
500 3300037471 Ga0395905_0092456 Ga0395905_0092456_232_1104 288
501 3300037471 Ga0395905_0186854 Ga0395905_0186854_741_1652 288
502 3300046525 Ga0495663_0000187 Ga0495663_0000187_13388_14263 288
503 3300046537 Ga0495598_0000782 Ga0495598_0000782_612_1487 288
504 3300046539 Ga0495621_0001591 Ga0495621_0001591_1552_2427 288
505 3300046539 Ga0495621_0011755 Ga0495621_0011755_1548_2477 288
506 3300048905 Ga0496102_0046948 Ga0496102_0046948_1344_2339 288
507 3300048905 Ga0496102_0349694 Ga0496102_0349694_326_1267 288
508 3300048906 Ga0496103_0049953 Ga0496103_0049953_70_1065 288
509 3300048909 Ga0496106_0111784 Ga0496106_0111784_1063_2058 288
510 3300048912 Ga0496109_0485174 Ga0496109_0485174_109_1104 288
511 3300048915 Ga0496112_0219813 Ga0496112_0219813_796_1677 288
512 3300049769 Ga0501272_005008 Ga0501272_005008_292_1173 288
513 3300049851 Ga0501212_002369 Ga0501212_002369_21_926 288
514 3300050507 nmdc:mga05p37_118944_c1 nmdc:mga05p37_118944_c1_1471_2346 288
515 3300050507 nmdc:mga05p37_155429_c1 nmdc:mga05p37_155429_c1_1282_2160 288
516 3300050507 nmdc:mga05p37_229849_c1 nmdc:mga05p37_229849_c1_535_1407 288
517 3300050507 nmdc:mga05p37_332235_c1 nmdc:mga05p37_332235_c1_578_1450 288
518 3300050508 nmdc:mga09592_373825_c1 nmdc:mga09592_373825_c1_181_1053 288
519 3300050510 nmdc:mga06r32_96730_c1 nmdc:mga06r32_96730_c1_372_1244 288
520 3300050511 nmdc:mga08y16_1248_c1 nmdc:mga08y16_1248_c1_15282_16151 288
521 3300050511 nmdc:mga08y16_41282_c1 nmdc:mga08y16_41282_c1_3940_4824 288
522 3300050512 nmdc:mga0n895_135431_c1 nmdc:mga0n895_135431_c1_1291_2205 288
523 3300050512 nmdc:mga0n895_34179_c1 nmdc:mga0n895_34179_c1_3506_4393 288
524 3300050512 nmdc:mga0n895_427002_c1 nmdc:mga0n895_427002_c1_263_1177 288
525 3300050513 nmdc:mga0rr50_153364_c1 nmdc:mga0rr50_153364_c1_291_1166 288
526 3300050515 nmdc:mga0a205_34461_c1 nmdc:mga0a205_34461_c1_1171_2046 288
527 3300050515 nmdc:mga0a205_43651_c1 nmdc:mga0a205_43651_c1_474_1388 288
528 3300050515 nmdc:mga0a205_8891_c1 nmdc:mga0a205_8891_c1_667_1578 288
529 3300000532 CNAas_1000769 CNAas_10007692 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01351

RNase_HII

Ribonuclease HII

146

324

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uwe-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex 0.8637 78 263
7uwe-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex 0.8422 78 263
7uwh-assembly1.cif.gz_C cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex bound to ribonucleotide substrate 0.8386 79 267
2etj-assembly1.cif.gz_A crystal structure of ribonuclease hii (ec 3.1.26.4) (rnase hii) (tm0915) from thermotoga maritima at 1.74 a resolution 0.8384 72 263
3o3h-assembly1.cif.gz_A t. maritima rnase h2 d107n in complex with nucleic acid substrate and manganese ions 0.8383 72 262
ID Description Score Start End Superfamily
af_Q2FZ38_49_255_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8538 58 262 3.30.420.10
af_P10442_2_197_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.847 78 267 3.30.420.10
af_Q2FZ38_49_255_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8384 58 262 3.30.420.10
2etjA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8233 72 263 3.30.420.10
af_P9WH01_18_234_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8216 65 272 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A350BNY8-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9398 69 235 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A7V4LCL3-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9349 70 220 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A5N9A3S9-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9312 67 238 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A0S7ZEB6-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9299 67 211 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872
AF-A0A1F8LU88-F1-model_v4 Ribonuclease (EC 3.1.26.4) 0.9294 67 237 GO:0003723
GO:0004523
GO:0005737
GO:0006298
GO:0032299
GO:0043137
GO:0046872

Feature Viewer

pLDDT pTM Quality
77.53 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map