F459857

General Info

Members Datasets Scaffolds Average Seq Length
529 295 1058 204

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0137298|Ga0495674_0137298_45_731
Length 228
Sequence MRYSTTSSPRVFSPPSIQKRSAPMNRFEQAVYDCMIPTAELLERTTEPLHRAILLNFWRHVHLEGAGEYERILAPDMMVDEPVYRVTWGANPAVIEGKEGVLAFYNSVGESVLWHSDDRLAVGDWGICDEITFHQLARGADLRAVGYDVDDADALYHAASRQAFVWPYDSRARLAGEHLYEDKTSLTIEEVSPDEAITPSRVREIHREQLAKLEAERGDRFWVLAAGS

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
284 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
285 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
286 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
287 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 7.75
Rhizosphere 87.52
Stem 0
Stem Tuber 0
Unclassified 17.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0137298 3300047319 Unclassified 2057
2 Ga0070658_10065070 3300005327 Bacteria 2975
3 Ga0070676_10111731 3300005328 Bacteria 1702
4 Ga0070683_100042759 3300005329 Bacteria 4173
5 Ga0070683_100128334 3300005329 Bacteria 2398
6 Ga0070683_100179325 3300005329 Bacteria 2011
7 Ga0070683_100213762 3300005329 Bacteria 1832
8 Ga0070690_100037446 3300005330 Bacteria 3057
9 Ga0070677_10189885 3300005333 Bacteria 984
10 Ga0070666_10490999 3300005335 Unclassified 889
11 Ga0070680_100000170 3300005336 Bacteria 41524
12 Ga0070680_100030770 3300005336 Bacteria 4312
13 Ga0070680_100262128 3300005336 Bacteria 1462
14 Ga0070680_100680214 3300005336 Unclassified 885
15 Ga0070680_100804101 3300005336 Unclassified 810
16 Ga0070682_100136246 3300005337 Bacteria 1668
17 Ga0070689_100004441 3300005340 Bacteria 9476
18 Ga0070691_10188358 3300005341 Bacteria 1078
19 Ga0070687_100386404 3300005343 Unclassified 914
20 Ga0070661_100205097 3300005344 Bacteria 1508
21 Ga0070661_100656385 3300005344 Bacteria 852
22 Ga0070692_10129218 3300005345 Unclassified 1418
23 Ga0070668_100031458 3300005347 Bacteria 4037
24 Ga0070668_100194697 3300005347 Bacteria 1662
25 Ga0070669_100765755 3300005353 Bacteria 819
26 Ga0070675_100090453 3300005354 Bacteria 2563
27 Ga0070671_100269065 3300005355 Unclassified 1448
28 Ga0070674_100279869 3300005356 Bacteria 1322
29 Ga0070674_100807442 3300005356 Bacteria 811
30 Ga0070659_100047682 3300005366 Bacteria 3362
31 Ga0070667_100076333 3300005367 Bacteria 2861
32 Ga0070667_100237933 3300005367 Bacteria 1625
33 Ga0070709_10047142 3300005434 Bacteria 2683
34 Ga0070709_10680702 3300005434 Unclassified 799
35 Ga0070714_100017486 3300005435 Bacteria 5808
36 Ga0070714_101066626 3300005435 Bacteria 787
37 Ga0070713_100001732 3300005436 Bacteria 14043
38 Ga0070713_100071220 3300005436 Unclassified 2937
39 Ga0070713_100111796 3300005436 Unclassified 2383
40 Ga0070713_100233961 3300005436 Bacteria 1671
41 Ga0070713_100509668 3300005436 Bacteria 1136
42 Ga0070710_10067904 3300005437 Bacteria 2047
43 Ga0070710_10101958 3300005437 Bacteria 1711
44 Ga0070710_10463568 3300005437 Bacteria 861
45 Ga0070701_10037624 3300005438 Bacteria 2444
46 Ga0070711_100005288 3300005439 Bacteria 7706
47 Ga0070700_100024570 3300005441 Unclassified 3540
48 Ga0070700_100384210 3300005441 Unclassified 1051
49 Ga0070708_100003363 3300005445 Bacteria 12528
50 Ga0070663_100069126 3300005455 Bacteria 2565
51 Ga0070678_100051642 3300005456 Bacteria 2981
52 Ga0070678_100060413 3300005456 Bacteria 2790
53 Ga0070678_100080401 3300005456 Bacteria 2468
54 Ga0070678_100125963 3300005456 Bacteria 2028
55 Ga0070662_100082233 3300005457 Bacteria 2401
56 Ga0070662_100253449 3300005457 Bacteria 1416
57 Ga0070681_10002419 3300005458 Bacteria 17076
58 Ga0070681_10017256 3300005458 Bacteria 7215
59 Ga0070681_10060493 3300005458 Bacteria 3764
60 Ga0070681_10065518 3300005458 Bacteria 3601
61 Ga0070681_10254125 3300005458 Bacteria 1670
62 Ga0070681_10547347 3300005458 Unclassified 1071
63 Ga0068867_100042701 3300005459 Bacteria 3318
64 Ga0068867_100444908 3300005459 Bacteria 1103
65 Ga0070685_10330195 3300005466 Bacteria 1037
66 Ga0070706_100002919 3300005467 Bacteria 17017
67 Ga0070707_100021121 3300005468 Bacteria 6150
68 Ga0070707_101117707 3300005468 Bacteria 754
69 Ga0070698_100734690 3300005471 Bacteria 930
70 Ga0070699_100000663 3300005518 Bacteria 32166
71 Ga0070699_100329710 3300005518 Bacteria 1373
72 Ga0070679_100000758 3300005530 Bacteria 27984
73 Ga0070679_100003414 3300005530 Bacteria 14546
74 Ga0070679_100073153 3300005530 Unclassified 3420
75 Ga0070679_100113527 3300005530 Unclassified 2694
76 Ga0070679_100190363 3300005530 Bacteria 2021
77 Ga0070684_100041549 3300005535 Bacteria 3965
78 Ga0070684_100115639 3300005535 Unclassified 2409
79 Ga0070684_100132000 3300005535 Bacteria 2253
80 Ga0070684_100435171 3300005535 Bacteria 1211
81 Ga0070684_101297935 3300005535 Bacteria 685
82 Ga0070697_100076840 3300005536 Bacteria 2746
83 Ga0068853_100032285 3300005539 Bacteria 4434
84 Ga0070672_100039351 3300005543 Bacteria 3621
85 Ga0070672_100065934 3300005543 Bacteria 2865
86 Ga0070672_100137759 3300005543 Unclassified 2011
87 Ga0070672_100167169 3300005543 Bacteria 1827
88 Ga0070686_100600163 3300005544 Unclassified 867
89 Ga0070696_100181060 3300005546 Bacteria 1563
90 Ga0070693_100169895 3300005547 Bacteria 1396
91 Ga0070665_100002322 3300005548 Bacteria 21122
92 Ga0070665_100068938 3300005548 Bacteria 3545
93 Ga0070665_100817435 3300005548 Unclassified 945
94 Ga0070704_100109430 3300005549 Bacteria 2099
95 Ga0070704_100280223 3300005549 Bacteria 1381
96 Ga0068855_100000681 3300005563 Bacteria 41540
97 Ga0068855_100003758 3300005563 Bacteria 18557
98 Ga0070664_100805492 3300005564 Bacteria 878
99 Ga0068857_100147513 3300005577 Bacteria 2129
100 Ga0068857_100333248 3300005577 Bacteria 1403
101 Ga0068857_100603528 3300005577 Bacteria 1038
102 Ga0068856_100034427 3300005614 Bacteria 4961
103 Ga0068856_100203411 3300005614 Bacteria 1995
104 Ga0068856_100952860 3300005614 Bacteria 877
105 Ga0068852_100252467 3300005616 Bacteria 1690
106 Ga0068859_100029003 3300005617 Bacteria 5552
107 Ga0068864_100115772 3300005618 Bacteria 2391
108 Ga0068864_100132912 3300005618 Bacteria 2237
109 Ga0068866_10109448 3300005718 Bacteria 1539
110 Ga0068861_100032049 3300005719 Bacteria 3866
111 Ga0068861_100049864 3300005719 Bacteria 3171
112 Ga0068851_10084257 3300005834 Bacteria 1665
113 Ga0068870_10025140 3300005840 Bacteria 2954
114 Ga0068870_10211607 3300005840 Unclassified 1181
115 Ga0068863_100026126 3300005841 Bacteria 5571
116 Ga0068858_100126406 3300005842 Bacteria 2394
117 Ga0068860_100361347 3300005843 Bacteria 1430
118 Ga0068860_100750388 3300005843 Unclassified 987
119 Ga0068862_100589899 3300005844 Bacteria 1066
120 Ga0081455_10069579 3300005937 Bacteria 2926
121 Ga0081455_10109789 3300005937 Bacteria 2194
122 Ga0081455_10125101 3300005937 Bacteria 2019
123 Ga0081455_10284919 3300005937 Bacteria 1192
124 Ga0081538_10012251 3300005981 Bacteria 6887
125 Ga0081538_10183370 3300005981 Bacteria 891
126 Ga0081538_10216600 3300005981 Bacteria 765
127 Ga0070717_10022478 3300006028 Bacteria 4984
128 Ga0070717_10335821 3300006028 Bacteria 1348
129 Ga0070715_10022181 3300006163 Bacteria 2473
130 Ga0070716_100028482 3300006173 Bacteria 3009
131 Ga0070712_100003488 3300006175 Bacteria 9675
132 Ga0070712_100106186 3300006175 Unclassified 2087
133 Ga0070712_100808481 3300006175 Bacteria 805
134 Ga0097621_100035818 3300006237 Bacteria 3967
135 Ga0097621_100042676 3300006237 Unclassified 3654
136 Ga0068871_100886337 3300006358 Bacteria 826
137 Ga0075428_100837439 3300006844 Bacteria 977
138 Ga0075430_100021322 3300006846 Bacteria 5509
139 Ga0075431_100140697 3300006847 Bacteria 2487
140 Ga0075434_100263787 3300006871 Bacteria 1742
141 Ga0075429_100157012 3300006880 Bacteria 1992
142 Ga0068865_100007882 3300006881 Bacteria 6572
143 Ga0068865_100131226 3300006881 Unclassified 1877
144 Ga0068865_100155022 3300006881 Bacteria 1741
145 Ga0068865_100369709 3300006881 Bacteria 1166
146 Ga0097620_100029002 3300006931 Bacteria 5552
147 Ga0097620_100037884 3300006931 Bacteria 4839
148 Ga0075435_100388835 3300007076 Bacteria 1199
149 Ga0105240_10003178 3300009093 Bacteria 25815
150 Ga0105240_10003789 3300009093 Bacteria 23359
151 Ga0105240_10006771 3300009093 Bacteria 16763
152 Ga0111539_10196438 3300009094 Bacteria 2353
153 Ga0111539_10218196 3300009094 Bacteria 2221
154 Ga0111539_10524694 3300009094 Bacteria 1380
155 Ga0111539_10611294 3300009094 Bacteria 1269
156 Ga0105245_10162132 3300009098 Bacteria 2123
157 Ga0114129_10161818 3300009147 Bacteria 3057
158 Ga0105243_10071828 3300009148 Bacteria 2800
159 Ga0105243_10081388 3300009148 Bacteria 2644
160 Ga0105241_10044351 3300009174 Bacteria 3369
161 Ga0105242_10010731 3300009176 Bacteria 7033
162 Ga0105242_10055935 3300009176 Bacteria 3228
163 Ga0105242_10097859 3300009176 Bacteria 2481
164 Ga0105242_10175918 3300009176 Bacteria 1884
165 Ga0105248_10208493 3300009177 Unclassified 2202
166 Ga0105248_10437676 3300009177 Unclassified 1473
167 Ga0105248_11278288 3300009177 Bacteria 830
168 Ga0105237_10020129 3300009545 Bacteria 6887
169 Ga0105237_10024499 3300009545 Bacteria 6173
170 Ga0105237_10506347 3300009545 Unclassified 1214
171 Ga0105238_10007218 3300009551 Bacteria 11121
172 Ga0105238_10024063 3300009551 Bacteria 6209
173 Ga0105238_10026615 3300009551 Bacteria 5897
174 Ga0105238_10089533 3300009551 Bacteria 3064
175 Ga0105238_10311206 3300009551 Unclassified 1560
176 Ga0105238_10354958 3300009551 Bacteria 1455
177 Ga0105249_10231213 3300009553 Bacteria 1824
178 Ga0105249_10950655 3300009553 Unclassified 927
179 Ga0105239_10097517 3300010375 Bacteria 3249
180 Ga0105239_10183075 3300010375 Bacteria 2344
181 Ga0105246_10197461 3300011119 Bacteria 1562
182 Ga0105246_10367432 3300011119 Unclassified 1184
183 Ga0157373_10266343 3300013100 Bacteria 1213
184 Ga0157370_10002871 3300013104 Bacteria 20536
185 Ga0157370_10028113 3300013104 Bacteria 5537
186 Ga0157369_10020115 3300013105 Bacteria 7466
187 Ga0157369_10060047 3300013105 Unclassified 4101
188 Ga0157369_10158396 3300013105 Bacteria 2391
189 Ga0157369_10278746 3300013105 Bacteria 1741
190 Ga0157378_10615963 3300013297 Unclassified 1098
191 Ga0157378_10758298 3300013297 Unclassified 994
192 Ga0163162_10098988 3300013306 Bacteria 3006
193 Ga0163162_10191083 3300013306 Unclassified 2175
194 Ga0163162_10279312 3300013306 Bacteria 1802
195 Ga0163162_10919506 3300013306 Unclassified 987
196 Ga0163162_11313560 3300013306 Bacteria 822
197 Ga0157372_10138957 3300013307 Bacteria 2798
198 Ga0157372_10438038 3300013307 Unclassified 1523
199 Ga0157375_10261748 3300013308 Bacteria 1891
200 Ga0163163_10158193 3300014325 Bacteria 2310
201 Ga0163163_10812129 3300014325 Unclassified 999
202 Ga0163163_10890780 3300014325 Unclassified 953
203 Ga0157380_10013450 3300014326 Bacteria 5966
204 Ga0157380_10014878 3300014326 Bacteria 5702
205 Ga0157377_10040439 3300014745 Bacteria 2582
206 Ga0157377_10348388 3300014745 Bacteria 993
207 Ga0157377_10418635 3300014745 Unclassified 917
208 Ga0157379_10109566 3300014968 Bacteria 2480
209 Ga0157379_10112679 3300014968 Bacteria 2445
210 Ga0157379_10425860 3300014968 Unclassified 1223
211 Ga0157376_10012812 3300014969 Bacteria 6236
212 Ga0157376_10116677 3300014969 Bacteria 2359
213 Ga0157376_10176728 3300014969 Bacteria 1948
214 Ga0157376_10636124 3300014969 Unclassified 1066
215 Ga0157376_11312939 3300014969 Bacteria 754
216 Ga0163161_10066786 3300017792 Bacteria 2626
217 Ga0163161_10375418 3300017792 Unclassified 1135
218 Ga0213874_10079528 3300021377 Unclassified 1060
219 Ga0213876_10027802 3300021384 Bacteria 2982
220 Ga0209233_1027225 3300025261 Bacteria 1387
221 Ga0207682_10164747 3300025893 Unclassified 1006
222 Ga0207692_10316935 3300025898 Bacteria 953
223 Ga0207692_10440901 3300025898 Bacteria 818
224 Ga0207642_10021073 3300025899 Unclassified 2559
225 Ga0207688_10034162 3300025901 Bacteria 2815
226 Ga0207680_10458071 3300025903 Bacteria 906
227 Ga0207685_10037864 3300025905 Bacteria 1779
228 Ga0207699_10150006 3300025906 Unclassified 1542
229 Ga0207645_10003273 3300025907 Bacteria 12366
230 Ga0207643_10021524 3300025908 Bacteria 3543
231 Ga0207643_10036163 3300025908 Bacteria 2769
232 Ga0207705_10261653 3300025909 Bacteria 1321
233 Ga0207684_10278959 3300025910 Bacteria 1441
234 Ga0207707_10002390 3300025912 Bacteria 16893
235 Ga0207707_10005249 3300025912 Bacteria 11351
236 Ga0207707_10020114 3300025912 Bacteria 5826
237 Ga0207707_10360660 3300025912 Unclassified 1251
238 Ga0207707_10400931 3300025912 Unclassified 1177
239 Ga0207695_10006425 3300025913 Bacteria 15265
240 Ga0207695_10007412 3300025913 Bacteria 13974
241 Ga0207695_10234494 3300025913 Unclassified 1738
242 Ga0207671_10180465 3300025914 Bacteria 1643
243 Ga0207693_10008764 3300025915 Bacteria 8268
244 Ga0207693_10257778 3300025915 Bacteria 1368
245 Ga0207693_10426310 3300025915 Bacteria 1037
246 Ga0207660_10004178 3300025917 Bacteria 9396
247 Ga0207660_10047130 3300025917 Bacteria 3045
248 Ga0207660_10121511 3300025917 Bacteria 1978
249 Ga0207660_10198553 3300025917 Bacteria 1566
250 Ga0207660_10316489 3300025917 Bacteria 1245
251 Ga0207662_10266001 3300025918 Unclassified 1130
252 Ga0207657_10890237 3300025919 Unclassified 686
253 Ga0207649_10249119 3300025920 Unclassified 1279
254 Ga0207652_10009887 3300025921 Bacteria 7676
255 Ga0207652_10034597 3300025921 Bacteria 4259
256 Ga0207652_10052334 3300025921 Unclassified 3504
257 Ga0207652_10099351 3300025921 Bacteria 2568
258 Ga0207652_10324720 3300025921 Bacteria 1389
259 Ga0207646_10237093 3300025922 Bacteria 1648
260 Ga0207646_10348580 3300025922 Bacteria 1338
261 Ga0207694_10018721 3300025924 Bacteria 5234
262 Ga0207694_10053782 3300025924 Unclassified 3123
263 Ga0207694_10148176 3300025924 Bacteria 1890
264 Ga0207694_11064665 3300025924 Bacteria 684
265 Ga0207650_10001237 3300025925 Bacteria 18593
266 Ga0207659_10013778 3300025926 Bacteria 5194
267 Ga0207659_10796938 3300025926 Bacteria 811
268 Ga0207687_10201573 3300025927 Bacteria 1556
269 Ga0207687_10471129 3300025927 Unclassified 1044
270 Ga0207700_10042257 3300025928 Unclassified 3341
271 Ga0207700_10093592 3300025928 Unclassified 2378
272 Ga0207664_10013889 3300025929 Bacteria 5801
273 Ga0207690_10193599 3300025932 Bacteria 1539
274 Ga0207706_10009305 3300025933 Bacteria 9020
275 Ga0207686_10185466 3300025934 Bacteria 1479
276 Ga0207686_10355987 3300025934 Unclassified 1103
277 Ga0207686_10552761 3300025934 Bacteria 900
278 Ga0207686_10785500 3300025934 Unclassified 762
279 Ga0207709_10226480 3300025935 Bacteria 1352
280 Ga0207709_10330084 3300025935 Bacteria 1145
281 Ga0207709_10361057 3300025935 Unclassified 1100
282 Ga0207670_10091703 3300025936 Bacteria 2149
283 Ga0207669_10011538 3300025937 Bacteria 4305
284 Ga0207669_10074209 3300025937 Bacteria 2150
285 Ga0207704_10027407 3300025938 Bacteria 3143
286 Ga0207704_10440924 3300025938 Bacteria 1037
287 Ga0207691_10000451 3300025940 Bacteria 40686
288 Ga0207691_10052782 3300025940 Bacteria 3712
289 Ga0207691_10102491 3300025940 Bacteria 2553
290 Ga0207691_10172365 3300025940 Bacteria 1894
291 Ga0207711_10281650 3300025941 Bacteria 1531
292 Ga0207711_10972347 3300025941 Unclassified 788
293 Ga0207689_10090095 3300025942 Bacteria 2520
294 Ga0207689_10712941 3300025942 Unclassified 846
295 Ga0207661_10155986 3300025944 Bacteria 1977
296 Ga0207661_10625116 3300025944 Bacteria 989
297 Ga0207679_10123103 3300025945 Bacteria 2068
298 Ga0207667_10005525 3300025949 Bacteria 15426
299 Ga0207712_10406909 3300025961 Unclassified 1145
300 Ga0207658_10190982 3300025986 Bacteria 1702
301 Ga0207658_10353210 3300025986 Bacteria 1281
302 Ga0207677_10064507 3300026023 Bacteria 2551
303 Ga0207703_10533325 3300026035 Bacteria 1105
304 Ga0207678_10286808 3300026067 Bacteria 1414
305 Ga0207708_10002190 3300026075 Bacteria 14428
306 Ga0207708_10130119 3300026075 Bacteria 1968
307 Ga0207708_10169798 3300026075 Unclassified 1726
308 Ga0207702_10063449 3300026078 Bacteria 3159
309 Ga0207702_10172914 3300026078 Bacteria 1982
310 Ga0207648_10007006 3300026089 Bacteria 11149
311 Ga0207648_10071982 3300026089 Bacteria 3013
312 Ga0207648_10085509 3300026089 Unclassified 2751
313 Ga0207676_10233511 3300026095 Unclassified 1646
314 Ga0207674_10014381 3300026116 Bacteria 8743
315 Ga0207674_10048926 3300026116 Bacteria 4325
316 Ga0207674_10182776 3300026116 Bacteria 2048
317 Ga0207675_100004914 3300026118 Bacteria 12878
318 Ga0207675_100449265 3300026118 Bacteria 1277
319 Ga0207683_10026980 3300026121 Bacteria 4963
320 Ga0207683_10031664 3300026121 Bacteria 4590
321 Ga0207683_10282615 3300026121 Unclassified 1516
322 Ga0207698_10014141 3300026142 Bacteria 5293
323 Ga0207698_10228137 3300026142 Bacteria 1688
324 Ga0207698_10456238 3300026142 Bacteria 1235
325 Ga0209967_1010485 3300027364 Bacteria 1292
326 Ga0209983_1007816 3300027665 Unclassified 2188
327 Ga0209971_1042676 3300027682 Unclassified 1092
328 Ga0209966_1004401 3300027695 Unclassified 2386
329 Ga0209998_10001692 3300027717 Bacteria 5267
330 Ga0209974_10001096 3300027876 Bacteria 9594
331 Ga0207428_10050253 3300027907 Bacteria 3337
332 Ga0268266_10102832 3300028379 Bacteria 2520
333 Ga0307515_10326877 3300028794 Unclassified 1195
334 Ga0265338_10010486 3300028800 Bacteria 10853
335 Ga0265320_10160905 3300031240 Bacteria 1011
336 Ga0265340_10006627 3300031247 Bacteria 6354
337 Ga0265340_10023345 3300031247 Bacteria 3155
338 Ga0265339_10102843 3300031249 Bacteria 1485
339 Ga0265327_10001836 3300031251 Bacteria 24743
340 Ga0265316_10116153 3300031344 Bacteria 2023
341 Ga0307509_10000038 3300031507 Bacteria 188458
342 Ga0307415_100591685 3300032126 Unclassified 986
343 Ga0373948_0060886 3300034817 Bacteria 829
344 Ga0373940_0054035 3300035088 Bacteria 1135
345 Ga0373952_0074618 3300035092 Bacteria 855
346 Ga0373939_0083125 3300035114 Bacteria 1067
347 Ga0373941_0152078 3300035115 Bacteria 850
348 Ga0373957_0115197 3300035120 Bacteria 1085
349 Ga0373943_0253032 3300035170 Unclassified 990
350 Ga0373955_0138012 3300035172 Bacteria 1428
351 Ga0373955_0328949 3300035172 Bacteria 924
352 Ga0373927_0056989 3300035695 Bacteria 2527
353 Ga0373933_0532567 3300035724 Unclassified 770
354 Ga0373937_0035342 3300036401 Bacteria 4548
355 Ga0373937_0042876 3300036401 Bacteria 4129
356 Ga0373937_0054498 3300036401 Bacteria 3670
357 Ga0373937_0255805 3300036401 Bacteria 1651
358 Ga0373937_0913054 3300036401 Bacteria 827
359 Ga0373925_0130100 3300037068 Bacteria 1962
360 Ga0395905_0216591 3300037471 Bacteria 1793
361 Ga0395905_0436699 3300037471 Bacteria 1206
362 Ga0395905_0464120 3300037471 Bacteria 1165
363 Ga0436364_0967422 3300037853 Bacteria 4197
364 Ga0395901_0642607 3300038443 Bacteria 1065
365 Ga0436365_0184729 3300039437 Bacteria 53150
366 Ga0436365_0882381 3300039437 Bacteria 918
367 Ga0436363_0003398 3300039450 Bacteria 1995
368 Ga0436363_0700794 3300039450 Unclassified 1282
369 Ga0466963_0015930 3300044694 Bacteria 4667
370 Ga0466963_0232698 3300044694 Bacteria 1291
371 Ga0466964_0064429 3300044706 Unclassified 1533
372 Ga0466964_0208412 3300044706 Bacteria 943
373 Ga0466957_0039000 3300044842 Bacteria 2865
374 Ga0466959_0011210 3300045049 Bacteria 6430
375 Ga0466967_0057988 3300045976 Bacteria 3420
376 Ga0466967_0076332 3300045976 Bacteria 3014
377 Ga0466967_0213168 3300045976 Bacteria 1832
378 Ga0466967_0236172 3300045976 Bacteria 1742
379 Ga0466967_0500728 3300045976 Bacteria 1192
380 Ga0466967_0769401 3300045976 Bacteria 955
381 Ga0495603_0005231 3300046455 Bacteria 7738
382 Ga0495629_0336516 3300046459 Bacteria 1031
383 Ga0495651_0366263 3300046462 Bacteria 948
384 Ga0495653_0150404 3300046463 Bacteria 1627
385 Ga0495580_0002434 3300046472 Bacteria 16269
386 Ga0495580_0070117 3300046472 Bacteria 2449
387 Ga0495664_0464242 3300046477 Bacteria 758
388 Ga0495618_0241897 3300046514 Bacteria 1134
389 Ga0495618_0420470 3300046514 Bacteria 815
390 Ga0495618_0525245 3300046514 Bacteria 711
391 Ga0495630_0463407 3300046517 Bacteria 971
392 Ga0495630_0503753 3300046517 Unclassified 928
393 Ga0495652_0082988 3300046529 Bacteria 2639
394 Ga0495622_0045361 3300046557 Bacteria 2042
395 Ga0495633_0339838 3300046558 Unclassified 681
396 Ga0495667_0102261 3300046559 Bacteria 1853
397 Ga0495667_0168943 3300046559 Bacteria 1405
398 Ga0495634_0057704 3300046642 Bacteria 2590
399 Ga0495611_0216398 3300046648 Unclassified 892
400 Ga0495611_0265590 3300046648 Unclassified 794
401 Ga0495625_0005142 3300046660 Bacteria 12072
402 Ga0495635_0035118 3300046663 Bacteria 3476
403 Ga0495635_0210248 3300046663 Bacteria 1318
404 Ga0495657_0130259 3300046675 Bacteria 1576
405 Ga0495657_0167870 3300046675 Bacteria 1353
406 Ga0495657_0259854 3300046675 Bacteria 1044
407 Ga0495599_0025988 3300046678 Bacteria 3668
408 Ga0495599_0125241 3300046678 Bacteria 1597
409 Ga0495623_0007286 3300046679 Bacteria 7178
410 Ga0495646_0097894 3300046680 Bacteria 1685
411 Ga0495646_0116637 3300046680 Unclassified 1515
412 Ga0495613_0002661 3300046689 Bacteria 13410
413 Ga0495613_0212527 3300046689 Bacteria 1360
414 Ga0495624_0043799 3300046690 Bacteria 2854
415 Ga0495670_0502479 3300046691 Archaea 658
416 Ga0495604_0036259 3300047317 Bacteria 3888
417 Ga0495674_0208799 3300047319 Bacteria 1618
418 Ga0495680_0012724 3300047322 Bacteria 7384
419 Ga0495675_0295700 3300047444 Bacteria 963
420 Ga0495684_0163833 3300047471 Bacteria 1657
421 Ga0495684_0164190 3300047471 Bacteria 1655
422 Ga0495602_0031700 3300048088 Bacteria 4992
423 Ga0496100_0117023 3300048903 Bacteria 1860
424 Ga0496100_0134798 3300048903 Bacteria 1743
425 Ga0496100_0236370 3300048903 Unclassified 1347
426 Ga0496101_0193362 3300048904 Unclassified 1571
427 Ga0496102_0661392 3300048905 Unclassified 968
428 Ga0496102_0668512 3300048905 Bacteria 962
429 Ga0496102_0727897 3300048905 Unclassified 915
430 Ga0496104_0189734 3300048907 Bacteria 1966
431 Ga0496104_0199370 3300048907 Unclassified 1913
432 Ga0496104_0204103 3300048907 Bacteria 1888
433 Ga0496105_0061411 3300048908 Bacteria 3101
434 Ga0496105_0095057 3300048908 Bacteria 2461
435 Ga0496105_0114981 3300048908 Bacteria 2219
436 Ga0496106_0024183 3300048909 Bacteria 4514
437 Ga0496106_0145385 3300048909 Bacteria 1867
438 Ga0496106_0198263 3300048909 Bacteria 1597
439 Ga0496107_0073703 3300048910 Bacteria 2483
440 Ga0496107_0095901 3300048910 Bacteria 2170
441 Ga0496107_0805793 3300048910 Unclassified 687
442 Ga0496108_0053595 3300048911 Bacteria 3382
443 Ga0496108_0488590 3300048911 Bacteria 1075
444 Ga0496109_0106939 3300048912 Bacteria 2598
445 Ga0496109_0183083 3300048912 Bacteria 1968
446 Ga0496109_0475023 3300048912 Bacteria 1180
447 Ga0496109_0625106 3300048912 Bacteria 1013
448 Ga0496110_0017936 3300048913 Bacteria 5928
449 Ga0496110_0053032 3300048913 Bacteria 3564
450 Ga0496110_0078179 3300048913 Bacteria 2945
451 Ga0496111_0020214 3300048914 Bacteria 4632
452 Ga0496111_0046014 3300048914 Bacteria 3141
453 Ga0496111_0130723 3300048914 Bacteria 1858
454 Ga0496112_0089527 3300048915 Bacteria 3046
455 Ga0496112_0290161 3300048915 Bacteria 1582
456 Ga0496113_0204633 3300048916 Bacteria 1570
457 Ga0496113_0251073 3300048916 Bacteria 1412
458 Ga0496114_0117584 3300048917 Bacteria 2283
459 Ga0496114_0150409 3300048917 Bacteria 2019
460 Ga0496114_0192662 3300048917 Bacteria 1784
461 Ga0496115_0017588 3300048918 Bacteria 5470
462 Ga0496115_0240722 3300048918 Bacteria 1491
463 Ga0496115_0330878 3300048918 Unclassified 1245
464 Ga0496118_0037307 3300048921 Bacteria 3914
465 Ga0496122_0000768 3300048925 Bacteria 61953
466 Ga0496123_0000335 3300048926 Bacteria 89251
467 Ga0496126_0014018 3300048929 Bacteria 8124
468 Ga0496126_0180847 3300048929 Bacteria 1791
469 Ga0501032_0020048 3300049569 Bacteria 4663
470 Ga0501033_0006308 3300049570 Bacteria 9291
471 Ga0501036_0024459 3300049572 Bacteria 5091
472 Ga0501037_0316909 3300049573 Bacteria 1080
473 Ga0501038_0049584 3300049574 Bacteria 3630
474 Ga0501039_0112845 3300049575 Bacteria 2125
475 Ga0501041_0231828 3300049577 Bacteria 1159
476 Ga0501042_0023290 3300049578 Bacteria 4332
477 Ga0501042_0526219 3300049578 Unclassified 859
478 Ga0501046_0040764 3300049580 Bacteria 3709
479 Ga0501048_0063540 3300049582 Bacteria 2611
480 Ga0501067_0048202 3300049583 Bacteria 2363
481 Ga0501067_0136004 3300049583 Bacteria 1368
482 Ga0501068_0040250 3300049584 Bacteria 2805
483 Ga0501068_0081093 3300049584 Bacteria 1991
484 Ga0501069_0043752 3300049585 Bacteria 2479
485 Ga0501069_0230096 3300049585 Bacteria 1079
486 Ga0501071_0017079 3300049587 Bacteria 4999
487 Ga0501071_0831375 3300049587 Bacteria 712
488 Ga0501072_0373579 3300049588 Bacteria 1131
489 Ga0501074_0027473 3300049590 Bacteria 4126
490 Ga0501075_0031112 3300049591 Bacteria 3959
491 Ga0501077_0211887 3300049593 Bacteria 1231
492 Ga0501080_0081871 3300049742 Bacteria 2998
493 Ga0501080_0961190 3300049742 Unclassified 742
494 Ga0501081_0013646 3300049743 Bacteria 5341
495 Ga0501269_009881 3300049766 Bacteria 1157
496 Ga0501035_0062983 3300049822 Bacteria 3299
497 Ga0501044_0182463 3300049823 Bacteria 2065
498 Ga0501045_0051851 3300049824 Bacteria 2994
499 nmdc:mga05p37_34139_c1 3300050507 Bacteria 6231
500 nmdc:mga05p37_888226_c1 3300050507 Unclassified 963
501 nmdc:mga06r32_1065653_c1 3300050510 Bacteria 759
502 nmdc:mga08y16_331587_c1 3300050511 Bacteria 1565
503 nmdc:mga08y16_383979_c1 3300050511 Unclassified 1439
504 nmdc:mga08y16_767324_c1 3300050511 Unclassified 959
505 nmdc:mga08y16_86162_c1 3300050511 Bacteria 3274
506 nmdc:mga0n895_1210649_c1 3300050512 Bacteria 729
507 nmdc:mga0rr50_318428_c1 3300050513 Bacteria 1303
508 nmdc:mga0a205_89119_c1 3300050515 Bacteria 2982
509 Ga0495601_0014881 3300053077 Unclassified 4697
510 Ga0495612_0097170 3300053078 Bacteria 1252
511 Ga0495655_0043945 3300053083 Bacteria 1154
512 Ga0495619_0131457 3300053085 Bacteria 1720
513 Ga0495619_0167149 3300053085 Bacteria 1520
514 Ga0495619_0642770 3300053085 Bacteria 724
515 Ga0500643_004047 3300053087 Bacteria 6765
516 Ga0500647_0000576 3300053091 Bacteria 10347
517 Ga0500556_0000013 3300053104 Bacteria 243797
518 Ga0500572_000091 3300053111 Bacteria 29333
519 Ga0500642_0000002 3300053130 Bacteria 795093
520 Ga0500604_0000003 3300053151 Bacteria 148800
521 Ga0500616_0008314 3300053153 Bacteria 6460
522 Ga0500622_0055779 3300053156 Bacteria 2024
523 Ga0500637_0008876 3300053178 Bacteria 5092
524 Ga0500645_000575 3300053730 Bacteria 23790
525 Ga0501082_0560856 3300060353 Bacteria 999
526 Ga0501082_0689788 3300060353 Bacteria 894
527 Ga0466962_0090389 3300061719 Bacteria 1467
528 Ga0466962_0136266 3300061719 Bacteria 1188
529 Ga0530510_0004456 3300061734 Bacteria 9691
530 Ga0495674_0137298
531 Ga0070658_10065070
532 Ga0070676_10111731
533 Ga0070683_100042759
534 Ga0070683_100128334
535 Ga0070683_100179325
536 Ga0070683_100213762
537 Ga0070690_100037446
538 Ga0070677_10189885
539 Ga0070666_10490999
540 Ga0070680_100000170
541 Ga0070680_100030770
542 Ga0070680_100262128
543 Ga0070680_100680214
544 Ga0070680_100804101
545 Ga0070682_100136246
546 Ga0070689_100004441
547 Ga0070691_10188358
548 Ga0070687_100386404
549 Ga0070661_100205097
550 Ga0070661_100656385
551 Ga0070692_10129218
552 Ga0070668_100031458
553 Ga0070668_100194697
554 Ga0070669_100765755
555 Ga0070675_100090453
556 Ga0070671_100269065
557 Ga0070674_100279869
558 Ga0070674_100807442
559 Ga0070659_100047682
560 Ga0070667_100076333
561 Ga0070667_100237933
562 Ga0070709_10047142
563 Ga0070709_10680702
564 Ga0070714_100017486
565 Ga0070714_101066626
566 Ga0070713_100001732
567 Ga0070713_100071220
568 Ga0070713_100111796
569 Ga0070713_100233961
570 Ga0070713_100509668
571 Ga0070710_10067904
572 Ga0070710_10101958
573 Ga0070710_10463568
574 Ga0070701_10037624
575 Ga0070711_100005288
576 Ga0070700_100024570
577 Ga0070700_100384210
578 Ga0070708_100003363
579 Ga0070663_100069126
580 Ga0070678_100051642
581 Ga0070678_100060413
582 Ga0070678_100080401
583 Ga0070678_100125963
584 Ga0070662_100082233
585 Ga0070662_100253449
586 Ga0070681_10002419
587 Ga0070681_10017256
588 Ga0070681_10060493
589 Ga0070681_10065518
590 Ga0070681_10254125
591 Ga0070681_10547347
592 Ga0068867_100042701
593 Ga0068867_100444908
594 Ga0070685_10330195
595 Ga0070706_100002919
596 Ga0070707_100021121
597 Ga0070707_101117707
598 Ga0070698_100734690
599 Ga0070699_100000663
600 Ga0070699_100329710
601 Ga0070679_100000758
602 Ga0070679_100003414
603 Ga0070679_100073153
604 Ga0070679_100113527
605 Ga0070679_100190363
606 Ga0070684_100041549
607 Ga0070684_100115639
608 Ga0070684_100132000
609 Ga0070684_100435171
610 Ga0070684_101297935
611 Ga0070697_100076840
612 Ga0068853_100032285
613 Ga0070672_100039351
614 Ga0070672_100065934
615 Ga0070672_100137759
616 Ga0070672_100167169
617 Ga0070686_100600163
618 Ga0070696_100181060
619 Ga0070693_100169895
620 Ga0070665_100002322
621 Ga0070665_100068938
622 Ga0070665_100817435
623 Ga0070704_100109430
624 Ga0070704_100280223
625 Ga0068855_100000681
626 Ga0068855_100003758
627 Ga0070664_100805492
628 Ga0068857_100147513
629 Ga0068857_100333248
630 Ga0068857_100603528
631 Ga0068856_100034427
632 Ga0068856_100203411
633 Ga0068856_100952860
634 Ga0068852_100252467
635 Ga0068859_100029003
636 Ga0068864_100115772
637 Ga0068864_100132912
638 Ga0068866_10109448
639 Ga0068861_100032049
640 Ga0068861_100049864
641 Ga0068851_10084257
642 Ga0068870_10025140
643 Ga0068870_10211607
644 Ga0068863_100026126
645 Ga0068858_100126406
646 Ga0068860_100361347
647 Ga0068860_100750388
648 Ga0068862_100589899
649 Ga0081455_10069579
650 Ga0081455_10109789
651 Ga0081455_10125101
652 Ga0081455_10284919
653 Ga0081538_10012251
654 Ga0081538_10183370
655 Ga0081538_10216600
656 Ga0070717_10022478
657 Ga0070717_10335821
658 Ga0070715_10022181
659 Ga0070716_100028482
660 Ga0070712_100003488
661 Ga0070712_100106186
662 Ga0070712_100808481
663 Ga0097621_100035818
664 Ga0097621_100042676
665 Ga0068871_100886337
666 Ga0075428_100837439
667 Ga0075430_100021322
668 Ga0075431_100140697
669 Ga0075434_100263787
670 Ga0075429_100157012
671 Ga0068865_100007882
672 Ga0068865_100131226
673 Ga0068865_100155022
674 Ga0068865_100369709
675 Ga0097620_100029002
676 Ga0097620_100037884
677 Ga0075435_100388835
678 Ga0105240_10003178
679 Ga0105240_10003789
680 Ga0105240_10006771
681 Ga0111539_10196438
682 Ga0111539_10218196
683 Ga0111539_10524694
684 Ga0111539_10611294
685 Ga0105245_10162132
686 Ga0114129_10161818
687 Ga0105243_10071828
688 Ga0105243_10081388
689 Ga0105241_10044351
690 Ga0105242_10010731
691 Ga0105242_10055935
692 Ga0105242_10097859
693 Ga0105242_10175918
694 Ga0105248_10208493
695 Ga0105248_10437676
696 Ga0105248_11278288
697 Ga0105237_10020129
698 Ga0105237_10024499
699 Ga0105237_10506347
700 Ga0105238_10007218
701 Ga0105238_10024063
702 Ga0105238_10026615
703 Ga0105238_10089533
704 Ga0105238_10311206
705 Ga0105238_10354958
706 Ga0105249_10231213
707 Ga0105249_10950655
708 Ga0105239_10097517
709 Ga0105239_10183075
710 Ga0105246_10197461
711 Ga0105246_10367432
712 Ga0157373_10266343
713 Ga0157370_10002871
714 Ga0157370_10028113
715 Ga0157369_10020115
716 Ga0157369_10060047
717 Ga0157369_10158396
718 Ga0157369_10278746
719 Ga0157378_10615963
720 Ga0157378_10758298
721 Ga0163162_10098988
722 Ga0163162_10191083
723 Ga0163162_10279312
724 Ga0163162_10919506
725 Ga0163162_11313560
726 Ga0157372_10138957
727 Ga0157372_10438038
728 Ga0157375_10261748
729 Ga0163163_10158193
730 Ga0163163_10812129
731 Ga0163163_10890780
732 Ga0157380_10013450
733 Ga0157380_10014878
734 Ga0157377_10040439
735 Ga0157377_10348388
736 Ga0157377_10418635
737 Ga0157379_10109566
738 Ga0157379_10112679
739 Ga0157379_10425860
740 Ga0157376_10012812
741 Ga0157376_10116677
742 Ga0157376_10176728
743 Ga0157376_10636124
744 Ga0157376_11312939
745 Ga0163161_10066786
746 Ga0163161_10375418
747 Ga0213874_10079528
748 Ga0213876_10027802
749 Ga0209233_1027225
750 Ga0207682_10164747
751 Ga0207692_10316935
752 Ga0207692_10440901
753 Ga0207642_10021073
754 Ga0207688_10034162
755 Ga0207680_10458071
756 Ga0207685_10037864
757 Ga0207699_10150006
758 Ga0207645_10003273
759 Ga0207643_10021524
760 Ga0207643_10036163
761 Ga0207705_10261653
762 Ga0207684_10278959
763 Ga0207707_10002390
764 Ga0207707_10005249
765 Ga0207707_10020114
766 Ga0207707_10360660
767 Ga0207707_10400931
768 Ga0207695_10006425
769 Ga0207695_10007412
770 Ga0207695_10234494
771 Ga0207671_10180465
772 Ga0207693_10008764
773 Ga0207693_10257778
774 Ga0207693_10426310
775 Ga0207660_10004178
776 Ga0207660_10047130
777 Ga0207660_10121511
778 Ga0207660_10198553
779 Ga0207660_10316489
780 Ga0207662_10266001
781 Ga0207657_10890237
782 Ga0207649_10249119
783 Ga0207652_10009887
784 Ga0207652_10034597
785 Ga0207652_10052334
786 Ga0207652_10099351
787 Ga0207652_10324720
788 Ga0207646_10237093
789 Ga0207646_10348580
790 Ga0207694_10018721
791 Ga0207694_10053782
792 Ga0207694_10148176
793 Ga0207694_11064665
794 Ga0207650_10001237
795 Ga0207659_10013778
796 Ga0207659_10796938
797 Ga0207687_10201573
798 Ga0207687_10471129
799 Ga0207700_10042257
800 Ga0207700_10093592
801 Ga0207664_10013889
802 Ga0207690_10193599
803 Ga0207706_10009305
804 Ga0207686_10185466
805 Ga0207686_10355987
806 Ga0207686_10552761
807 Ga0207686_10785500
808 Ga0207709_10226480
809 Ga0207709_10330084
810 Ga0207709_10361057
811 Ga0207670_10091703
812 Ga0207669_10011538
813 Ga0207669_10074209
814 Ga0207704_10027407
815 Ga0207704_10440924
816 Ga0207691_10000451
817 Ga0207691_10052782
818 Ga0207691_10102491
819 Ga0207691_10172365
820 Ga0207711_10281650
821 Ga0207711_10972347
822 Ga0207689_10090095
823 Ga0207689_10712941
824 Ga0207661_10155986
825 Ga0207661_10625116
826 Ga0207679_10123103
827 Ga0207667_10005525
828 Ga0207712_10406909
829 Ga0207658_10190982
830 Ga0207658_10353210
831 Ga0207677_10064507
832 Ga0207703_10533325
833 Ga0207678_10286808
834 Ga0207708_10002190
835 Ga0207708_10130119
836 Ga0207708_10169798
837 Ga0207702_10063449
838 Ga0207702_10172914
839 Ga0207648_10007006
840 Ga0207648_10071982
841 Ga0207648_10085509
842 Ga0207676_10233511
843 Ga0207674_10014381
844 Ga0207674_10048926
845 Ga0207674_10182776
846 Ga0207675_100004914
847 Ga0207675_100449265
848 Ga0207683_10026980
849 Ga0207683_10031664
850 Ga0207683_10282615
851 Ga0207698_10014141
852 Ga0207698_10228137
853 Ga0207698_10456238
854 Ga0209967_1010485
855 Ga0209983_1007816
856 Ga0209971_1042676
857 Ga0209966_1004401
858 Ga0209998_10001692
859 Ga0209974_10001096
860 Ga0207428_10050253
861 Ga0268266_10102832
862 Ga0307515_10326877
863 Ga0265338_10010486
864 Ga0265320_10160905
865 Ga0265340_10006627
866 Ga0265340_10023345
867 Ga0265339_10102843
868 Ga0265327_10001836
869 Ga0265316_10116153
870 Ga0307509_10000038
871 Ga0307415_100591685
872 Ga0373948_0060886
873 Ga0373940_0054035
874 Ga0373952_0074618
875 Ga0373939_0083125
876 Ga0373941_0152078
877 Ga0373957_0115197
878 Ga0373943_0253032
879 Ga0373955_0138012
880 Ga0373955_0328949
881 Ga0373927_0056989
882 Ga0373933_0532567
883 Ga0373937_0035342
884 Ga0373937_0042876
885 Ga0373937_0054498
886 Ga0373937_0255805
887 Ga0373937_0913054
888 Ga0373925_0130100
889 Ga0395905_0216591
890 Ga0395905_0436699
891 Ga0395905_0464120
892 Ga0436364_0967422
893 Ga0395901_0642607
894 Ga0436365_0184729
895 Ga0436365_0882381
896 Ga0436363_0003398
897 Ga0436363_0700794
898 Ga0466963_0015930
899 Ga0466963_0232698
900 Ga0466964_0064429
901 Ga0466964_0208412
902 Ga0466957_0039000
903 Ga0466959_0011210
904 Ga0466967_0057988
905 Ga0466967_0076332
906 Ga0466967_0213168
907 Ga0466967_0236172
908 Ga0466967_0500728
909 Ga0466967_0769401
910 Ga0495603_0005231
911 Ga0495629_0336516
912 Ga0495651_0366263
913 Ga0495653_0150404
914 Ga0495580_0002434
915 Ga0495580_0070117
916 Ga0495664_0464242
917 Ga0495618_0241897
918 Ga0495618_0420470
919 Ga0495618_0525245
920 Ga0495630_0463407
921 Ga0495630_0503753
922 Ga0495652_0082988
923 Ga0495622_0045361
924 Ga0495633_0339838
925 Ga0495667_0102261
926 Ga0495667_0168943
927 Ga0495634_0057704
928 Ga0495611_0216398
929 Ga0495611_0265590
930 Ga0495625_0005142
931 Ga0495635_0035118
932 Ga0495635_0210248
933 Ga0495657_0130259
934 Ga0495657_0167870
935 Ga0495657_0259854
936 Ga0495599_0025988
937 Ga0495599_0125241
938 Ga0495623_0007286
939 Ga0495646_0097894
940 Ga0495646_0116637
941 Ga0495613_0002661
942 Ga0495613_0212527
943 Ga0495624_0043799
944 Ga0495670_0502479
945 Ga0495604_0036259
946 Ga0495674_0208799
947 Ga0495680_0012724
948 Ga0495675_0295700
949 Ga0495684_0163833
950 Ga0495684_0164190
951 Ga0495602_0031700
952 Ga0496100_0117023
953 Ga0496100_0134798
954 Ga0496100_0236370
955 Ga0496101_0193362
956 Ga0496102_0661392
957 Ga0496102_0668512
958 Ga0496102_0727897
959 Ga0496104_0189734
960 Ga0496104_0199370
961 Ga0496104_0204103
962 Ga0496105_0061411
963 Ga0496105_0095057
964 Ga0496105_0114981
965 Ga0496106_0024183
966 Ga0496106_0145385
967 Ga0496106_0198263
968 Ga0496107_0073703
969 Ga0496107_0095901
970 Ga0496107_0805793
971 Ga0496108_0053595
972 Ga0496108_0488590
973 Ga0496109_0106939
974 Ga0496109_0183083
975 Ga0496109_0475023
976 Ga0496109_0625106
977 Ga0496110_0017936
978 Ga0496110_0053032
979 Ga0496110_0078179
980 Ga0496111_0020214
981 Ga0496111_0046014
982 Ga0496111_0130723
983 Ga0496112_0089527
984 Ga0496112_0290161
985 Ga0496113_0204633
986 Ga0496113_0251073
987 Ga0496114_0117584
988 Ga0496114_0150409
989 Ga0496114_0192662
990 Ga0496115_0017588
991 Ga0496115_0240722
992 Ga0496115_0330878
993 Ga0496118_0037307
994 Ga0496122_0000768
995 Ga0496123_0000335
996 Ga0496126_0014018
997 Ga0496126_0180847
998 Ga0501032_0020048
999 Ga0501033_0006308
1000 Ga0501036_0024459
1001 Ga0501037_0316909
1002 Ga0501038_0049584
1003 Ga0501039_0112845
1004 Ga0501041_0231828
1005 Ga0501042_0023290
1006 Ga0501042_0526219
1007 Ga0501046_0040764
1008 Ga0501048_0063540
1009 Ga0501067_0048202
1010 Ga0501067_0136004
1011 Ga0501068_0040250
1012 Ga0501068_0081093
1013 Ga0501069_0043752
1014 Ga0501069_0230096
1015 Ga0501071_0017079
1016 Ga0501071_0831375
1017 Ga0501072_0373579
1018 Ga0501074_0027473
1019 Ga0501075_0031112
1020 Ga0501077_0211887
1021 Ga0501080_0081871
1022 Ga0501080_0961190
1023 Ga0501081_0013646
1024 Ga0501269_009881
1025 Ga0501035_0062983
1026 Ga0501044_0182463
1027 Ga0501045_0051851
1028 nmdc:mga05p37_34139_c1
1029 nmdc:mga05p37_888226_c1
1030 nmdc:mga06r32_1065653_c1
1031 nmdc:mga08y16_331587_c1
1032 nmdc:mga08y16_383979_c1
1033 nmdc:mga08y16_767324_c1
1034 nmdc:mga08y16_86162_c1
1035 nmdc:mga0n895_1210649_c1
1036 nmdc:mga0rr50_318428_c1
1037 nmdc:mga0a205_89119_c1
1038 Ga0495601_0014881
1039 Ga0495612_0097170
1040 Ga0495655_0043945
1041 Ga0495619_0131457
1042 Ga0495619_0167149
1043 Ga0495619_0642770
1044 Ga0500643_004047
1045 Ga0500647_0000576
1046 Ga0500556_0000013
1047 Ga0500572_000091
1048 Ga0500642_0000002
1049 Ga0500604_0000003
1050 Ga0500616_0008314
1051 Ga0500622_0055779
1052 Ga0500637_0008876
1053 Ga0500645_000575
1054 Ga0501082_0560856
1055 Ga0501082_0689788
1056 Ga0466962_0090389
1057 Ga0466962_0136266
1058 Ga0530510_0004456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p44-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d38n mutant from mycobacterium hassiacum (mhksi) bound to 3,4-dinitrophenol 0.6303 33 162
6p3l-assembly1.cif.gz_B crystal structure of ketosteroid isomerase from mycobacterium hassiacum (mhksi) 0.6252 33 162
5cxo-assembly1.cif.gz_A intriguing role of epoxide hydrolase/cyclase-like enzyme salbiii in pyran ring formation in polyether salinomycin 0.607 38 164
3i0y-assembly1.cif.gz_B crystal structure of a putative polyketide cyclase (xcc0381) from xanthomonas campestris pv. campestris at 1.50 a resolution 0.5963 32 162
6w3f-assembly2.cif.gz_B rd1ntf2_05_i64f_a80g_t94p_d101k_l106w 0.589 41 146
ID Description Score Start End Superfamily
5cxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.607 38 164 3.10.450.50
3kkgA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5755 27 146 3.10.450.50
af_A0A178V9P2_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5598 49 117 3.10.450.50
3f14A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5528 38 164 3.10.450.50
af_G5ECA7_6_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5418 16 146 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7Y9J3T0-F1-model_v4 SnoaL-like protein 0.913 6 115
AF-A0A223E1B2-F1-model_v4 Uncharacterized protein 0.8854 6 198
AF-A0A423PQ02-F1-model_v4 Uncharacterized protein 0.8719 6 191
AF-A0A223E1B2-F1-model_v4 Uncharacterized protein 0.8388 6 198
AF-A0A7Y9J3T0-F1-model_v4 SnoaL-like protein 0.835 6 115

Map