F459845

General Info

Members Datasets Scaffolds Average Seq Length
529 317 1058 281

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0017606|Ga0495638_0017606_3423_4361
Length 312
Sequence MCVMPQEHPDRSSASRKAPLRRPDASMSLLTNVMEHSLDDGYAEAAARRGETGTSRMPRTPRGKLTLAVGLVLAAVVVTLGGAQAQVAAPTLAKERQKLIDRIESETAAADGLQKSVDKLRDDVSARQREALKDQGVPGAELVSLLAGATAVTGPGVKLVVDDAKEATSGGGSNPRTSSDFSDTGRVRDRDMQRVVNGLWSSGAEAISVNGQRLTALSAIRAAGDAILVDNKPLAPPYTVLAIGDGQRLSTAFQDSDDGQYLHVLEENYGIRASISAQSRLELPAAPSLIVRSASPAPSAGKSAAKTGKGTN

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
15 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
36 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
40 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
41 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
52 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
55 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
56 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
59 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
60 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
61 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
62 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
199 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
204 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
211 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
212 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
213 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
214 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
215 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
221 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
222 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
223 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
224 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
225 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
226 2643221548 Streptomyces sp. Root55 Isolate Unclassified
227 2643221578 Streptomyces sp. Root63 Isolate Unclassified
228 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
229 2643221647 Streptomyces sp. Root369 Isolate Unclassified
230 2643221670 Streptomyces sp. Root431 Isolate Unclassified
231 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
232 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
233 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
234 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
235 2643221714 Streptomyces sp. Root264 Isolate Unclassified
236 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
237 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
238 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
239 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
240 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
241 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
242 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
243 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
244 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
245 2808606448 Streptomyces sp. 193411 Isolate Unclassified
246 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
247 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
248 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
249 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
250 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
251 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
252 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
253 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
254 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
255 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
256 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
257 2862574272 Streptomyces sp. AcE210 Isolate Nodule
258 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
259 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
260 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
261 2867369537 Streptomyces sp. Z26 Isolate Unclassified
262 2867428634 Streptomyces sp. RP5T Isolate Unclassified
263 2867475112 Streptomyces sp. TM32 Isolate Unclassified
264 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
265 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
266 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
267 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
268 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
269 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
270 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
271 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
272 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
273 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
274 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
275 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
276 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
277 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
278 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
279 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
280 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
281 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
282 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
283 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
284 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
285 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
286 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
287 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
288 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
289 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
290 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
291 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
292 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
293 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
294 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
295 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
296 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
297 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
298 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
299 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
300 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
301 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
302 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
303 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
304 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
305 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
306 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
307 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
308 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
309 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
310 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
311 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
312 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
313 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
314 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
315 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
316 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
317 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.47
Metatranscriptomes 0
Isolates 18.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.86
Nodule 0.76
Rhizoplane 0.95
Rhizosphere 79.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0017606 3300046460 Bacteria 4759
2 JGI24740J21852_10033677 3300001979 Bacteria 1623
3 JGI24740J21852_10039496 3300001979 Bacteria 1439
4 JGI24739J22299_10001443 3300001989 Bacteria 8960
5 JGI24739J22299_10082641 3300001989 Bacteria 985
6 JGI24737J22298_10003330 3300001990 Bacteria 5685
7 JGI24737J22298_10063287 3300001990 Bacteria 1111
8 JGI24735J21928_10011363 3300002067 Bacteria 2826
9 rootH2_10017275 3300003320 Bacteria 4833
10 rootH1_10088192 3300003323 Bacteria 2175
11 Ga0068857_100157945 3300005577 Bacteria 2056
12 Ga0068854_100263048 3300005578 Bacteria 1382
13 Ga0068864_100466418 3300005618 Bacteria 1210
14 Ga0081455_10167140 3300005937 Bacteria 1679
15 Ga0075367_10007402 3300006178 Bacteria 5617
16 Ga0075370_10137867 3300006353 Bacteria 1426
17 Ga0099826_10058874 3300006948 Bacteria 2516
18 Ga0105249_10651538 3300009553 Bacteria 1111
19 Ga0105239_10072749 3300010375 Bacteria 3780
20 Ga0105246_10377576 3300011119 Bacteria 1170
21 Ga0157369_10178167 3300013105 Bacteria 2237
22 Ga0182008_10003052 3300014497 Bacteria 10279
23 Ga0182007_10002246 3300015262 Bacteria 9746
24 Ga0182005_1036209 3300015265 Bacteria 1342
25 Ga0183367_1003 3300015688 Bacteria 814276
26 Ga0209758_1011831 3300025297 Bacteria 4983
27 Ga0207426_1004336 3300025302 Bacteria 6980
28 Ga0207426_1007413 3300025302 Bacteria 4599
29 Ga0207426_1009221 3300025302 Bacteria 3922
30 Ga0207647_10007825 3300025904 Bacteria 7693
31 Ga0207647_10019912 3300025904 Bacteria 4505
32 Ga0207694_10506906 3300025924 Bacteria 1011
33 Ga0207668_10141015 3300025972 Bacteria 1854
34 Ga0207640_10084665 3300025981 Bacteria 2178
35 Ga0207639_10152740 3300026041 Bacteria 1936
36 Ga0207674_10066709 3300026116 Bacteria 3624
37 Ga0209371_1024826 3300027312 Bacteria 1388
38 Ga0268266_10023641 3300028379 Bacteria 5231
39 Ga0307517_10019375 3300028786 Bacteria 8734
40 Ga0307517_10020694 3300028786 Bacteria 8363
41 Ga0307515_10010397 3300028794 Bacteria 17833
42 Ga0307515_10123150 3300028794 Bacteria 2919
43 Ga0307515_10253512 3300028794 Bacteria 1508
44 Ga0268256_1028239 3300030500 Bacteria 1388
45 Ga0307511_10037021 3300030521 Bacteria 4224
46 Ga0307511_10076963 3300030521 Bacteria 2379
47 Ga0307512_10002110 3300030522 Bacteria 26116
48 Ga0307512_10060866 3300030522 Bacteria 2914
49 Ga0307513_10010672 3300031456 Bacteria 11494
50 Ga0307513_10032151 3300031456 Bacteria 5922
51 Ga0307509_10093593 3300031507 Bacteria 3066
52 Ga0307509_10247402 3300031507 Bacteria 1569
53 Ga0307508_10001235 3300031616 Bacteria 29188
54 Ga0307508_10027978 3300031616 Bacteria 5100
55 Ga0307508_10108588 3300031616 Bacteria 2374
56 Ga0307514_10023923 3300031649 Bacteria 4949
57 Ga0307514_10051925 3300031649 Bacteria 3174
58 Ga0307514_10143365 3300031649 Bacteria 1619
59 Ga0307514_10230571 3300031649 Bacteria 1123
60 Ga0307516_10009713 3300031730 Bacteria 10685
61 Ga0307516_10039962 3300031730 Bacteria 4672
62 Ga0307516_10068201 3300031730 Bacteria 3426
63 Ga0307516_10198884 3300031730 Bacteria 1725
64 Ga0307516_10245126 3300031730 Bacteria 1489
65 Ga0307518_10072661 3300031838 Bacteria 2490
66 Ga0307416_100216949 3300032002 Bacteria 1831
67 Ga0307510_10049102 3300033180 Bacteria 4493
68 Ga0395899_0483503 3300037312 Bacteria 806
69 Ga0395900_0309186 3300037418 Bacteria 1564
70 Ga0395900_0384420 3300037418 Bacteria 1371
71 Ga0395898_0002926 3300037466 Bacteria 19415
72 Ga0395898_0008650 3300037466 Bacteria 10739
73 Ga0395905_0050922 3300037471 Bacteria 3879
74 Ga0395905_0307721 3300037471 Bacteria 1473
75 Ga0395901_0195439 3300038443 Bacteria 2121
76 Ga0439436_0004809 3300041404 Bacteria 4141
77 Ga0439436_0007832 3300041404 Bacteria 3282
78 Ga0439436_0035109 3300041404 Bacteria 1449
79 Ga0439439_0062478 3300041406 Bacteria 990
80 Ga0451853_0170457 3300041512 Bacteria 10302
81 Ga0451853_1512916 3300041512 Bacteria 3156
82 Ga0439433_0001111 3300041999 Bacteria 5488
83 Ga0439449_0004810 3300042007 Bacteria 5208
84 Ga0439449_0008466 3300042007 Bacteria 3910
85 Ga0439449_0019483 3300042007 Bacteria 2543
86 Ga0439455_0010486 3300042012 Bacteria 2039
87 Ga0439455_0025944 3300042012 Bacteria 1428
88 Ga0439457_000050 3300042014 Bacteria 24506
89 Ga0439457_001276 3300042014 Bacteria 7557
90 Ga0439462_0002176 3300042015 Bacteria 4517
91 Ga0450894_000402 3300042131 Bacteria 7411
92 Ga0450903_000797 3300042138 Bacteria 6152
93 Ga0450906_007880 3300042145 Bacteria 2087
94 Ga0439458_0006796 3300042157 Bacteria 2547
95 Ga0466969_0032128 3300044656 Bacteria 2669
96 Ga0466972_0001383 3300044658 Bacteria 11769
97 Ga0466972_0007258 3300044658 Bacteria 5565
98 Ga0466972_0046708 3300044658 Bacteria 2095
99 Ga0466965_0001744 3300044683 Bacteria 8971
100 Ga0466965_0266755 3300044683 Bacteria 921
101 Ga0466966_0005617 3300044684 Bacteria 8244
102 Ga0466966_0059069 3300044684 Bacteria 2422
103 Ga0466961_0014898 3300044693 Bacteria 4994
104 Ga0466961_0024964 3300044693 Bacteria 3846
105 Ga0466961_0053016 3300044693 Bacteria 2589
106 Ga0466963_0002952 3300044694 Bacteria 9611
107 Ga0466964_0059076 3300044706 Bacteria 1591
108 Ga0466971_0002834 3300044719 Bacteria 7346
109 Ga0466971_0078395 3300044719 Bacteria 1505
110 Ga0466970_0002112 3300044765 Bacteria 9598
111 Ga0466970_0006676 3300044765 Bacteria 5770
112 Ga0466970_0205140 3300044765 Bacteria 1097
113 Ga0466957_0002224 3300044842 Bacteria 10399
114 Ga0466957_0327914 3300044842 Bacteria 1034
115 Ga0466960_0009062 3300044901 Bacteria 4093
116 Ga0466959_0004316 3300045049 Bacteria 9490
117 Ga0466959_0110523 3300045049 Bacteria 1962
118 Ga0466958_0002184 3300045836 Bacteria 9743
119 Ga0466967_0024495 3300045976 Bacteria 4963
120 Ga0466967_0038602 3300045976 Bacteria 4097
121 Ga0466967_0133449 3300045976 Bacteria 2307
122 Ga0495617_036878 3300046452 Bacteria 1638
123 Ga0495592_0010796 3300046454 Bacteria 6886
124 Ga0495592_0014844 3300046454 Bacteria 5914
125 Ga0495592_0022400 3300046454 Bacteria 4806
126 Ga0495592_0043066 3300046454 Bacteria 3379
127 Ga0495603_0000602 3300046455 Bacteria 20226
128 Ga0495603_0004007 3300046455 Bacteria 8768
129 Ga0495603_0004346 3300046455 Bacteria 8453
130 Ga0495603_0006734 3300046455 Bacteria 6897
131 Ga0495603_0008687 3300046455 Bacteria 6139
132 Ga0495629_0002606 3300046459 Bacteria 13822
133 Ga0495629_0008929 3300046459 Bacteria 7367
134 Ga0495629_0018772 3300046459 Bacteria 4943
135 Ga0495629_0020977 3300046459 Bacteria 4663
136 Ga0495629_0061359 3300046459 Bacteria 2627
137 Ga0495629_0110651 3300046459 Bacteria 1915
138 Ga0495629_0207612 3300046459 Bacteria 1353
139 Ga0495629_0422527 3300046459 Bacteria 904
140 Ga0495638_0062171 3300046460 Bacteria 2305
141 Ga0495651_0017149 3300046462 Bacteria 5611
142 Ga0495651_0017662 3300046462 Bacteria 5521
143 Ga0495651_0022940 3300046462 Bacteria 4854
144 Ga0495650_0093985 3300046471 Bacteria 1136
145 Ga0495580_0055417 3300046472 Bacteria 2794
146 Ga0495605_0016124 3300046474 Bacteria 4049
147 Ga0495662_0000530 3300046476 Bacteria 17444
148 Ga0495662_0002146 3300046476 Bacteria 9900
149 Ga0495662_0030211 3300046476 Bacteria 2616
150 Ga0495664_0000797 3300046477 Bacteria 16119
151 Ga0495584_0057438 3300046491 Bacteria 1958
152 Ga0495585_0060468 3300046492 Bacteria 2085
153 Ga0495585_0065269 3300046492 Bacteria 1995
154 Ga0495594_0056151 3300046499 Bacteria 2172
155 Ga0495594_0069701 3300046499 Bacteria 1953
156 Ga0495594_0127473 3300046499 Bacteria 1440
157 Ga0495596_0076928 3300046500 Bacteria 1296
158 Ga0495583_0066760 3300046506 Bacteria 1590
159 Ga0495583_0100128 3300046506 Bacteria 1238
160 Ga0495583_0143335 3300046506 Bacteria 993
161 Ga0495606_0017777 3300046507 Bacteria 5359
162 Ga0495608_0055393 3300046511 Bacteria 2621
163 Ga0495616_0007914 3300046513 Bacteria 6338
164 Ga0495618_0045690 3300046514 Bacteria 2763
165 Ga0495620_0118038 3300046515 Bacteria 1047
166 Ga0495628_0020754 3300046516 Bacteria 5413
167 Ga0495628_0108459 3300046516 Bacteria 2137
168 Ga0495630_0007342 3300046517 Bacteria 7871
169 Ga0495630_0020398 3300046517 Bacteria 4886
170 Ga0495631_0143419 3300046518 Bacteria 1025
171 Ga0495632_0045031 3300046519 Bacteria 2200
172 Ga0495637_0046159 3300046520 Bacteria 1844
173 Ga0495637_0087235 3300046520 Bacteria 1236
174 Ga0495643_0003665 3300046522 Bacteria 11147
175 Ga0495643_0010290 3300046522 Bacteria 5760
176 Ga0495644_0097810 3300046523 Bacteria 1110
177 Ga0495648_0087820 3300046524 Bacteria 1749
178 Ga0495648_0093943 3300046524 Bacteria 1671
179 Ga0495666_0008690 3300046526 Bacteria 5090
180 Ga0495666_0011441 3300046526 Bacteria 4422
181 Ga0495652_0019363 3300046529 Bacteria 6063
182 Ga0495652_0027774 3300046529 Bacteria 4984
183 Ga0495652_0040316 3300046529 Bacteria 4036
184 Ga0495652_0054085 3300046529 Bacteria 3420
185 Ga0495654_0051187 3300046530 Bacteria 2016
186 Ga0495665_0010157 3300046531 Bacteria 5102
187 Ga0495640_0001343 3300046533 Bacteria 19357
188 Ga0495640_0007906 3300046533 Bacteria 8361
189 Ga0495586_0112687 3300046535 Bacteria 1515
190 Ga0495587_0005154 3300046536 Bacteria 8543
191 Ga0495587_0021595 3300046536 Bacteria 3970
192 Ga0495609_0008304 3300046538 Bacteria 5091
193 Ga0495597_0074164 3300046542 Bacteria 1461
194 Ga0495645_0007617 3300046543 Bacteria 7534
195 Ga0495645_0020313 3300046543 Bacteria 4789
196 Ga0495622_0004638 3300046557 Bacteria 6365
197 Ga0495622_0029906 3300046557 Bacteria 2545
198 Ga0495633_0007859 3300046558 Bacteria 6086
199 Ga0495668_0020084 3300046616 Bacteria 3842
200 Ga0495668_0210519 3300046616 Bacteria 1064
201 Ga0495634_0006115 3300046642 Bacteria 9168
202 Ga0495634_0026081 3300046642 Bacteria 4081
203 Ga0495634_0055224 3300046642 Bacteria 2656
204 Ga0495611_0043124 3300046648 Bacteria 2016
205 Ga0495611_0122626 3300046648 Bacteria 1212
206 Ga0495625_0069468 3300046660 Bacteria 2475
207 Ga0495625_0108162 3300046660 Bacteria 1902
208 Ga0495625_0143251 3300046660 Bacteria 1611
209 Ga0495635_0038785 3300046663 Bacteria 3297
210 Ga0495635_0380836 3300046663 Bacteria 939
211 Ga0495661_0017676 3300046665 Bacteria 4704
212 Ga0495588_0002418 3300046674 Bacteria 7985
213 Ga0495588_0017413 3300046674 Bacteria 3489
214 Ga0495657_0000391 3300046675 Bacteria 40728
215 Ga0495657_0007696 3300046675 Bacteria 8293
216 Ga0495657_0058682 3300046675 Bacteria 2554
217 Ga0495657_0069403 3300046675 Bacteria 2306
218 Ga0495657_0082671 3300046675 Bacteria 2074
219 Ga0495623_0023639 3300046679 Bacteria 3964
220 Ga0495646_0011026 3300046680 Bacteria 5741
221 Ga0495646_0022524 3300046680 Bacteria 3972
222 Ga0495658_0021694 3300046683 Bacteria 3389
223 Ga0495658_0159885 3300046683 Bacteria 1389
224 Ga0495613_0001133 3300046689 Bacteria 20309
225 Ga0495613_0001445 3300046689 Bacteria 18147
226 Ga0495613_0003465 3300046689 Bacteria 11799
227 Ga0495613_0009323 3300046689 Bacteria 7284
228 Ga0495613_0044814 3300046689 Bacteria 3271
229 Ga0495613_0066530 3300046689 Bacteria 2631
230 Ga0495613_0117244 3300046689 Bacteria 1914
231 Ga0495613_0124595 3300046689 Bacteria 1848
232 Ga0495613_0194500 3300046689 Bacteria 1432
233 Ga0495624_0013665 3300046690 Bacteria 5528
234 Ga0495624_0047129 3300046690 Bacteria 2739
235 Ga0495624_0063855 3300046690 Bacteria 2301
236 Ga0495670_0009702 3300046691 Bacteria 4730
237 Ga0495670_0029319 3300046691 Bacteria 2731
238 Ga0495670_0178981 3300046691 Bacteria 1119
239 Ga0495670_0197663 3300046691 Bacteria 1064
240 Ga0495671_0023820 3300046692 Bacteria 3196
241 Ga0495671_0087369 3300046692 Bacteria 1527
242 Ga0495649_0050327 3300046694 Bacteria 2261
243 Ga0495589_0002834 3300046794 Bacteria 9592
244 Ga0495589_0009617 3300046794 Bacteria 5027
245 Ga0495589_0012540 3300046794 Bacteria 4388
246 Ga0495589_0018946 3300046794 Bacteria 3530
247 Ga0495600_0005699 3300046809 Bacteria 7524
248 Ga0495600_0025505 3300046809 Bacteria 3810
249 Ga0495600_0051183 3300046809 Bacteria 2696
250 Ga0495660_0057932 3300046810 Bacteria 2088
251 Ga0495581_0001622 3300047315 Bacteria 12532
252 Ga0495581_0131487 3300047315 Bacteria 1458
253 Ga0495604_0000717 3300047317 Bacteria 28071
254 Ga0495604_0004550 3300047317 Bacteria 10982
255 Ga0495604_0011211 3300047317 Bacteria 7116
256 Ga0495604_0046406 3300047317 Bacteria 3387
257 Ga0495604_0116431 3300047317 Bacteria 1940
258 Ga0495636_0005011 3300047318 Bacteria 5198
259 Ga0495636_0011721 3300047318 Bacteria 3473
260 Ga0495636_0066054 3300047318 Bacteria 1537
261 Ga0495674_0060295 3300047319 Bacteria 3311
262 Ga0495676_0002482 3300047321 Bacteria 16411
263 Ga0495676_0004276 3300047321 Bacteria 13029
264 Ga0495676_0010521 3300047321 Bacteria 8385
265 Ga0495676_0017946 3300047321 Bacteria 6244
266 Ga0495676_0018902 3300047321 Bacteria 6071
267 Ga0495676_0032816 3300047321 Bacteria 4379
268 Ga0495676_0332529 3300047321 Bacteria 1018
269 Ga0495687_001837 3300047443 Bacteria 18639
270 Ga0495687_005491 3300047443 Bacteria 8054
271 Ga0495687_020843 3300047443 Bacteria 3187
272 Ga0495687_044109 3300047443 Bacteria 1940
273 Ga0495687_055826 3300047443 Bacteria 1649
274 Ga0495687_082926 3300047443 Bacteria 1250
275 Ga0495687_084218 3300047443 Bacteria 1236
276 Ga0495675_0007126 3300047444 Bacteria 6881
277 Ga0495675_0012537 3300047444 Bacteria 5335
278 Ga0495675_0033528 3300047444 Bacteria 3277
279 Ga0495675_0178222 3300047444 Bacteria 1302
280 Ga0495675_0231004 3300047444 Bacteria 1116
281 Ga0495677_0060572 3300047445 Bacteria 1403
282 Ga0495677_0063571 3300047445 Bacteria 1371
283 Ga0495679_038059 3300047446 Bacteria 1509
284 Ga0495685_000639 3300047447 Bacteria 10709
285 Ga0495685_004671 3300047447 Bacteria 4443
286 Ga0495685_006732 3300047447 Bacteria 3774
287 Ga0495685_030849 3300047447 Bacteria 1843
288 Ga0495685_031531 3300047447 Bacteria 1821
289 Ga0495685_086056 3300047447 Bacteria 1044
290 Ga0495685_092406 3300047447 Bacteria 1002
291 Ga0495681_0004700 3300047470 Bacteria 9262
292 Ga0495681_0007467 3300047470 Bacteria 6978
293 Ga0495681_0038064 3300047470 Bacteria 2362
294 Ga0495684_0056325 3300047471 Bacteria 2997
295 Ga0495686_0073074 3300047472 Bacteria 2107
296 Ga0495593_0001387 3300047673 Bacteria 14189
297 Ga0495593_0044086 3300047673 Bacteria 2388
298 Ga0495593_0223534 3300047673 Bacteria 944
299 Ga0495602_0028570 3300048088 Bacteria 5333
300 Ga0495614_0000686 3300048089 Bacteria 14242
301 Ga0495614_0009183 3300048089 Bacteria 4380
302 Ga0495614_0076636 3300048089 Bacteria 1445
303 Ga0495614_0160786 3300048089 Bacteria 1005
304 Ga0495626_0013567 3300048091 Bacteria 4232
305 Ga0496104_0251823 3300048907 Bacteria 1679
306 Ga0496108_0079926 3300048911 Bacteria 2769
307 Ga0496109_0014032 3300048912 Bacteria 6965
308 Ga0496115_0462860 3300048918 Bacteria 1023
309 Ga0495678_063413 3300049459 Bacteria 1380
310 Ga0495682_0097687 3300049460 Bacteria 1054
311 Ga0501031_0003313 3300049568 Bacteria 10337
312 Ga0501031_0005622 3300049568 Bacteria 8168
313 Ga0501031_0145427 3300049568 Bacteria 1549
314 Ga0501031_0166997 3300049568 Bacteria 1438
315 Ga0501032_0001000 3300049569 Bacteria 22764
316 Ga0501032_0015007 3300049569 Bacteria 5477
317 Ga0501032_0032225 3300049569 Bacteria 3591
318 Ga0501033_0033372 3300049570 Bacteria 3864
319 Ga0501033_0033436 3300049570 Bacteria 3859
320 Ga0501033_0042616 3300049570 Bacteria 3383
321 Ga0501033_0067183 3300049570 Bacteria 2636
322 Ga0501033_0100027 3300049570 Bacteria 2116
323 Ga0501034_0006380 3300049571 Bacteria 12704
324 Ga0501034_0027557 3300049571 Bacteria 5779
325 Ga0501034_0036599 3300049571 Bacteria 4970
326 Ga0501034_0132504 3300049571 Bacteria 2475
327 Ga0501034_0147604 3300049571 Bacteria 2328
328 Ga0501034_0192787 3300049571 Bacteria 1999
329 Ga0501036_0004477 3300049572 Bacteria 11296
330 Ga0501036_0020929 3300049572 Bacteria 5493
331 Ga0501036_0032656 3300049572 Bacteria 4400
332 Ga0501036_0104395 3300049572 Bacteria 2396
333 Ga0501037_0003586 3300049573 Bacteria 11266
334 Ga0501037_0042261 3300049573 Bacteria 3350
335 Ga0501037_0333472 3300049573 Bacteria 1048
336 Ga0501038_0005459 3300049574 Bacteria 11813
337 Ga0501038_0020150 3300049574 Bacteria 6001
338 Ga0501038_0058002 3300049574 Bacteria 3321
339 Ga0501038_0067229 3300049574 Bacteria 3049
340 Ga0501039_0009980 3300049575 Bacteria 7239
341 Ga0501039_0027902 3300049575 Bacteria 4342
342 Ga0501039_0035183 3300049575 Bacteria 3864
343 Ga0501039_0119656 3300049575 Bacteria 2063
344 Ga0501040_0025944 3300049576 Bacteria 3942
345 Ga0501041_0002576 3300049577 Bacteria 10336
346 Ga0501042_0010403 3300049578 Bacteria 6237
347 Ga0501042_0038818 3300049578 Bacteria 3381
348 Ga0501042_0306914 3300049578 Bacteria 1146
349 Ga0501043_0001369 3300049579 Bacteria 21371
350 Ga0501043_0002836 3300049579 Bacteria 14492
351 Ga0501043_0003192 3300049579 Bacteria 13560
352 Ga0501043_0094641 3300049579 Bacteria 2348
353 Ga0501043_0209419 3300049579 Bacteria 1511
354 Ga0501046_0002449 3300049580 Bacteria 17400
355 Ga0501046_0009078 3300049580 Bacteria 8619
356 Ga0501046_0130408 3300049580 Bacteria 1907
357 Ga0501047_0000191 3300049581 Bacteria 74396
358 Ga0501047_0003295 3300049581 Bacteria 15296
359 Ga0501047_0033333 3300049581 Bacteria 4970
360 Ga0501047_0074133 3300049581 Bacteria 3276
361 Ga0501047_0174583 3300049581 Bacteria 2017
362 Ga0501047_0554450 3300049581 Bacteria 973
363 Ga0501048_0011437 3300049582 Bacteria 6621
364 Ga0501048_0064672 3300049582 Bacteria 2586
365 Ga0501067_0017988 3300049583 Bacteria 3913
366 Ga0501068_0000777 3300049584 Bacteria 16465
367 Ga0501068_0036599 3300049584 Bacteria 2936
368 Ga0501069_0007606 3300049585 Bacteria 5686
369 Ga0501070_0000195 3300049586 Bacteria 56683
370 Ga0501070_0086214 3300049586 Bacteria 2599
371 Ga0501070_0241375 3300049586 Bacteria 1479
372 Ga0501071_0002969 3300049587 Bacteria 10484
373 Ga0501072_0005901 3300049588 Bacteria 9329
374 Ga0501073_0089070 3300049589 Bacteria 2145
375 Ga0501074_0017586 3300049590 Bacteria 5191
376 Ga0501074_0101418 3300049590 Bacteria 2060
377 Ga0501076_0021809 3300049592 Bacteria 4917
378 Ga0501077_0005523 3300049593 Bacteria 7694
379 Ga0501079_0029625 3300049741 Bacteria 4203
380 Ga0501080_0023161 3300049742 Bacteria 5758
381 Ga0501080_0031855 3300049742 Bacteria 4913
382 Ga0501083_0020414 3300049744 Bacteria 4609
383 Ga0501035_0001194 3300049822 Bacteria 27050
384 Ga0501035_0002948 3300049822 Bacteria 16372
385 Ga0501035_0021923 3300049822 Bacteria 5869
386 Ga0501035_0147500 3300049822 Bacteria 2042
387 Ga0501035_0341103 3300049822 Bacteria 1255
388 Ga0501044_0002251 3300049823 Bacteria 22046
389 Ga0501044_0011203 3300049823 Bacteria 9724
390 Ga0501044_0040970 3300049823 Bacteria 4823
391 Ga0501044_0068446 3300049823 Bacteria 3616
392 Ga0501044_0106072 3300049823 Bacteria 2822
393 Ga0501044_0198266 3300049823 Bacteria 1966
394 Ga0501044_0212615 3300049823 Bacteria 1887
395 Ga0501044_0238779 3300049823 Bacteria 1761
396 Ga0501044_0363731 3300049823 Bacteria 1364
397 Ga0501044_0437578 3300049823 Bacteria 1216
398 Ga0501044_0536389 3300049823 Bacteria 1068
399 Ga0501045_0134055 3300049824 Bacteria 1841
400 nmdc:mga03n38_477_c1 3300050490 Bacteria 10014
401 nmdc:mga0yw44_130712_c1 3300050492 Bacteria 1625
402 nmdc:mga06z11_11001_c1 3300050494 Bacteria 3881
403 Ga0495601_0011311 3300053077 Bacteria 5333
404 Ga0495612_0059386 3300053078 Bacteria 1581
405 Ga0495619_0011288 3300053085 Bacteria 5621
406 Ga0500578_0026354 3300053086 Bacteria 3729
407 Ga0500578_0176366 3300053086 Bacteria 1319
408 Ga0500644_0006713 3300053088 Bacteria 2962
409 Ga0500646_0041110 3300053090 Bacteria 1302
410 Ga0500647_0200204 3300053091 Bacteria 906
411 Ga0500566_0128429 3300053094 Bacteria 1359
412 Ga0500640_004881 3300053095 Bacteria 4927
413 Ga0500641_0145163 3300053096 Bacteria 1025
414 Ga0500654_126822 3300053099 Bacteria 981
415 Ga0500560_015936 3300053107 Bacteria 2040
416 Ga0500569_016261 3300053109 Bacteria 1881
417 Ga0500614_016722 3300053123 Bacteria 1650
418 Ga0500628_008127 3300053129 Bacteria 1816
419 Ga0500652_004574 3300053131 Bacteria 4289
420 Ga0500658_0004535 3300053134 Bacteria 5178
421 Ga0500573_0019983 3300053140 Bacteria 3836
422 Ga0500600_0007156 3300053149 Bacteria 6697
423 Ga0500624_011914 3300053157 Bacteria 1277
424 Ga0500633_0007106 3300053160 Bacteria 2797
425 Ga0500634_0019561 3300053161 Bacteria 3649
426 Ga0500634_0087790 3300053161 Bacteria 1587
427 Ga0500587_005883 3300053739 Bacteria 1639
428 Ga0501084_0030685 3300054114 Bacteria 4494
429 Ga0501082_0025324 3300060353 Bacteria 5112
430 Ga0466962_0003210 3300061719 Bacteria 7767
431 Ga0530510_0048999 3300061734 Bacteria 3053
432 2547409235 2547132111 Bacteria 8013147
433 2554259657 2554235005 Bacteria 6457341
434 2585297863 2582581312 Bacteria 7308206
435 2585310921 2582581313 Bacteria 10042643
436 2616703007 2616644814 Bacteria 11555299
437 2616905331 2616644941 Bacteria 8510691
438 2643764565 2643221548 Bacteria 8053412
439 2643905222 2643221578 Bacteria 9213798
440 2643942721 2643221587 Bacteria 7586415
441 2644264155 2643221647 Bacteria 10741251
442 2644385887 2643221670 Bacteria 6497041
443 2644403280 2643221673 Bacteria 9196637
444 2644430180 2643221677 Bacteria 7584031
445 2644438172 2643221678 Bacteria 9540101
446 2644458376 2643221682 Bacteria 6743283
447 2644629904 2643221714 Bacteria 9015452
448 2768643830 2767802112 Bacteria 6465194
449 2784586634 2784132148 Bacteria 8627943
450 2785345864 2784746763 Bacteria 9783172
451 2785367025 2784746768 Bacteria 10036182
452 2786668062 2786546132 Bacteria 10419719
453 2793983331 2791355406 Bacteria 11364898
454 2804843617 2802429296 Bacteria 7227771
455 2808847528 2808606359 Bacteria 9866990
456 2808918260 2808606375 Bacteria 9466072
457 2809230161 2808606448 Bacteria 8656184
458 2811846851 2808606982 Bacteria 7791042
459 2812360440 2811994879 Bacteria 9313447
460 2812482533 2811994917 Bacteria 7761064
461 2816425548 2816332119 Bacteria 8120218
462 2819699774 2818991463 Bacteria 7948711
463 2852643299 2852635781 Bacteria 8251373
464 2862181426 2862178590 Bacteria 8583590
465 2862289785 2862281513 Bacteria 9621493
466 2862294122 2862290372 Bacteria 7471434
467 2862392546 2862382967 Bacteria 10317375
468 2862508467 2862507626 Bacteria 9425308
469 2862580101 2862574272 Bacteria 10567477
470 2862709639 2862705112 Bacteria 6563286
471 2863407095 2863404153 Bacteria 9672205
472 2867346708 2867346516 Bacteria 7608576
473 2867375224 2867369537 Bacteria 6501581
474 2867435055 2867428634 Bacteria 9590268
475 2867475994 2867475112 Bacteria 6909112
476 2873157802 2873151551 Bacteria 8625867
477 2875392586 2875391855 Bacteria 7600475
478 2877683518 2877676314 Bacteria 9512378
479 2912722628 2912715099 Bacteria 9460473
480 2912726310 2912723979 Bacteria 8557534
481 2912758727 2912757875 Bacteria 7940295
482 2918502396 2918501144 Bacteria 8668083
483 2919474484 2919468124 Bacteria 9133025
484 2935394171 2935390628 Bacteria 7043367
485 2946052130 2946045630 Bacteria 8527308
486 2946065449 2946064051 Bacteria 8957905
487 2946073812 2946072368 Bacteria 8999607
488 2947231958 2947224130 Bacteria 9938529
489 2954008975 2954002825 Bacteria 9173742
490 2954388774 2954380949 Bacteria 10050426
491 2954674350 2954673503 Bacteria 9685905
492 2954689781 2954682443 Bacteria 9862841
493 2954699565 2954691527 Bacteria 10720516
494 2954702652 2954701450 Bacteria 10834262
495 2954718503 2954711539 Bacteria 10867210
496 2954728474 2954721474 Bacteria 10456478
497 2954733336 2954731030 Bacteria 10243860
498 2954747370 2954740390 Bacteria 10229294
499 2954752219 2954749733 Bacteria 10366972
500 2954766484 2954759201 Bacteria 9358192
501 2966604545 2966598605 Bacteria 7676064
502 2990045456 2990044586 Bacteria 6603797
503 2990060259 2990059506 Bacteria 9321252
504 2990093383 2990088156 Bacteria 6657676
505 2997451916 2997451912 Bacteria 8492419
506 2997603426 2997600082 Bacteria 9896405
507 3006327561 3006321560 Bacteria 8247479
508 3006399456 3006393351 Bacteria 6615579
509 3006430707 3006425503 Bacteria 6491253
510 3006489358 3006486233 Bacteria 8157040
511 3006498346 3006493962 Bacteria 8825450
512 8008486930 8008485437 Bacteria 7198341
513 8008561186 8008558824 Bacteria 10610750
514 8008580868 8008574985 Bacteria 7815457
515 8023630935 8023623736 Bacteria 8593882
516 8025418332 8025413630 Bacteria 7014048
517 8025482367 8025478263 Bacteria 8209203
518 8025526187 8025524527 Bacteria 7197316
519 8025533895 8025530807 Bacteria 8495698
520 8047901207 8047893842 Bacteria 11723082
521 8048135609 8048127548 Bacteria 11053136
522 8048357694 8048356638 Bacteria 11044339
523 8048378147 8048369669 Bacteria 11666822
524 8048387245 8048379754 Bacteria 11877923
525 8048409971 8048406513 Bacteria 8936924
526 8054166911 8054160619 Bacteria 7783213
527 8056454227 8056447290 Bacteria 7680491
528 8056670095 8056667051 Bacteria 6953971
529 8056832439 8056829672 Bacteria 9045328
530 Ga0495638_0017606
531 JGI24740J21852_10033677
532 JGI24740J21852_10039496
533 JGI24739J22299_10001443
534 JGI24739J22299_10082641
535 JGI24737J22298_10003330
536 JGI24737J22298_10063287
537 JGI24735J21928_10011363
538 rootH2_10017275
539 rootH1_10088192
540 Ga0068857_100157945
541 Ga0068854_100263048
542 Ga0068864_100466418
543 Ga0081455_10167140
544 Ga0075367_10007402
545 Ga0075370_10137867
546 Ga0099826_10058874
547 Ga0105249_10651538
548 Ga0105239_10072749
549 Ga0105246_10377576
550 Ga0157369_10178167
551 Ga0182008_10003052
552 Ga0182007_10002246
553 Ga0182005_1036209
554 Ga0183367_1003
555 Ga0209758_1011831
556 Ga0207426_1004336
557 Ga0207426_1007413
558 Ga0207426_1009221
559 Ga0207647_10007825
560 Ga0207647_10019912
561 Ga0207694_10506906
562 Ga0207668_10141015
563 Ga0207640_10084665
564 Ga0207639_10152740
565 Ga0207674_10066709
566 Ga0209371_1024826
567 Ga0268266_10023641
568 Ga0307517_10019375
569 Ga0307517_10020694
570 Ga0307515_10010397
571 Ga0307515_10123150
572 Ga0307515_10253512
573 Ga0268256_1028239
574 Ga0307511_10037021
575 Ga0307511_10076963
576 Ga0307512_10002110
577 Ga0307512_10060866
578 Ga0307513_10010672
579 Ga0307513_10032151
580 Ga0307509_10093593
581 Ga0307509_10247402
582 Ga0307508_10001235
583 Ga0307508_10027978
584 Ga0307508_10108588
585 Ga0307514_10023923
586 Ga0307514_10051925
587 Ga0307514_10143365
588 Ga0307514_10230571
589 Ga0307516_10009713
590 Ga0307516_10039962
591 Ga0307516_10068201
592 Ga0307516_10198884
593 Ga0307516_10245126
594 Ga0307518_10072661
595 Ga0307416_100216949
596 Ga0307510_10049102
597 Ga0395899_0483503
598 Ga0395900_0309186
599 Ga0395900_0384420
600 Ga0395898_0002926
601 Ga0395898_0008650
602 Ga0395905_0050922
603 Ga0395905_0307721
604 Ga0395901_0195439
605 Ga0439436_0004809
606 Ga0439436_0007832
607 Ga0439436_0035109
608 Ga0439439_0062478
609 Ga0451853_0170457
610 Ga0451853_1512916
611 Ga0439433_0001111
612 Ga0439449_0004810
613 Ga0439449_0008466
614 Ga0439449_0019483
615 Ga0439455_0010486
616 Ga0439455_0025944
617 Ga0439457_000050
618 Ga0439457_001276
619 Ga0439462_0002176
620 Ga0450894_000402
621 Ga0450903_000797
622 Ga0450906_007880
623 Ga0439458_0006796
624 Ga0466969_0032128
625 Ga0466972_0001383
626 Ga0466972_0007258
627 Ga0466972_0046708
628 Ga0466965_0001744
629 Ga0466965_0266755
630 Ga0466966_0005617
631 Ga0466966_0059069
632 Ga0466961_0014898
633 Ga0466961_0024964
634 Ga0466961_0053016
635 Ga0466963_0002952
636 Ga0466964_0059076
637 Ga0466971_0002834
638 Ga0466971_0078395
639 Ga0466970_0002112
640 Ga0466970_0006676
641 Ga0466970_0205140
642 Ga0466957_0002224
643 Ga0466957_0327914
644 Ga0466960_0009062
645 Ga0466959_0004316
646 Ga0466959_0110523
647 Ga0466958_0002184
648 Ga0466967_0024495
649 Ga0466967_0038602
650 Ga0466967_0133449
651 Ga0495617_036878
652 Ga0495592_0010796
653 Ga0495592_0014844
654 Ga0495592_0022400
655 Ga0495592_0043066
656 Ga0495603_0000602
657 Ga0495603_0004007
658 Ga0495603_0004346
659 Ga0495603_0006734
660 Ga0495603_0008687
661 Ga0495629_0002606
662 Ga0495629_0008929
663 Ga0495629_0018772
664 Ga0495629_0020977
665 Ga0495629_0061359
666 Ga0495629_0110651
667 Ga0495629_0207612
668 Ga0495629_0422527
669 Ga0495638_0062171
670 Ga0495651_0017149
671 Ga0495651_0017662
672 Ga0495651_0022940
673 Ga0495650_0093985
674 Ga0495580_0055417
675 Ga0495605_0016124
676 Ga0495662_0000530
677 Ga0495662_0002146
678 Ga0495662_0030211
679 Ga0495664_0000797
680 Ga0495584_0057438
681 Ga0495585_0060468
682 Ga0495585_0065269
683 Ga0495594_0056151
684 Ga0495594_0069701
685 Ga0495594_0127473
686 Ga0495596_0076928
687 Ga0495583_0066760
688 Ga0495583_0100128
689 Ga0495583_0143335
690 Ga0495606_0017777
691 Ga0495608_0055393
692 Ga0495616_0007914
693 Ga0495618_0045690
694 Ga0495620_0118038
695 Ga0495628_0020754
696 Ga0495628_0108459
697 Ga0495630_0007342
698 Ga0495630_0020398
699 Ga0495631_0143419
700 Ga0495632_0045031
701 Ga0495637_0046159
702 Ga0495637_0087235
703 Ga0495643_0003665
704 Ga0495643_0010290
705 Ga0495644_0097810
706 Ga0495648_0087820
707 Ga0495648_0093943
708 Ga0495666_0008690
709 Ga0495666_0011441
710 Ga0495652_0019363
711 Ga0495652_0027774
712 Ga0495652_0040316
713 Ga0495652_0054085
714 Ga0495654_0051187
715 Ga0495665_0010157
716 Ga0495640_0001343
717 Ga0495640_0007906
718 Ga0495586_0112687
719 Ga0495587_0005154
720 Ga0495587_0021595
721 Ga0495609_0008304
722 Ga0495597_0074164
723 Ga0495645_0007617
724 Ga0495645_0020313
725 Ga0495622_0004638
726 Ga0495622_0029906
727 Ga0495633_0007859
728 Ga0495668_0020084
729 Ga0495668_0210519
730 Ga0495634_0006115
731 Ga0495634_0026081
732 Ga0495634_0055224
733 Ga0495611_0043124
734 Ga0495611_0122626
735 Ga0495625_0069468
736 Ga0495625_0108162
737 Ga0495625_0143251
738 Ga0495635_0038785
739 Ga0495635_0380836
740 Ga0495661_0017676
741 Ga0495588_0002418
742 Ga0495588_0017413
743 Ga0495657_0000391
744 Ga0495657_0007696
745 Ga0495657_0058682
746 Ga0495657_0069403
747 Ga0495657_0082671
748 Ga0495623_0023639
749 Ga0495646_0011026
750 Ga0495646_0022524
751 Ga0495658_0021694
752 Ga0495658_0159885
753 Ga0495613_0001133
754 Ga0495613_0001445
755 Ga0495613_0003465
756 Ga0495613_0009323
757 Ga0495613_0044814
758 Ga0495613_0066530
759 Ga0495613_0117244
760 Ga0495613_0124595
761 Ga0495613_0194500
762 Ga0495624_0013665
763 Ga0495624_0047129
764 Ga0495624_0063855
765 Ga0495670_0009702
766 Ga0495670_0029319
767 Ga0495670_0178981
768 Ga0495670_0197663
769 Ga0495671_0023820
770 Ga0495671_0087369
771 Ga0495649_0050327
772 Ga0495589_0002834
773 Ga0495589_0009617
774 Ga0495589_0012540
775 Ga0495589_0018946
776 Ga0495600_0005699
777 Ga0495600_0025505
778 Ga0495600_0051183
779 Ga0495660_0057932
780 Ga0495581_0001622
781 Ga0495581_0131487
782 Ga0495604_0000717
783 Ga0495604_0004550
784 Ga0495604_0011211
785 Ga0495604_0046406
786 Ga0495604_0116431
787 Ga0495636_0005011
788 Ga0495636_0011721
789 Ga0495636_0066054
790 Ga0495674_0060295
791 Ga0495676_0002482
792 Ga0495676_0004276
793 Ga0495676_0010521
794 Ga0495676_0017946
795 Ga0495676_0018902
796 Ga0495676_0032816
797 Ga0495676_0332529
798 Ga0495687_001837
799 Ga0495687_005491
800 Ga0495687_020843
801 Ga0495687_044109
802 Ga0495687_055826
803 Ga0495687_082926
804 Ga0495687_084218
805 Ga0495675_0007126
806 Ga0495675_0012537
807 Ga0495675_0033528
808 Ga0495675_0178222
809 Ga0495675_0231004
810 Ga0495677_0060572
811 Ga0495677_0063571
812 Ga0495679_038059
813 Ga0495685_000639
814 Ga0495685_004671
815 Ga0495685_006732
816 Ga0495685_030849
817 Ga0495685_031531
818 Ga0495685_086056
819 Ga0495685_092406
820 Ga0495681_0004700
821 Ga0495681_0007467
822 Ga0495681_0038064
823 Ga0495684_0056325
824 Ga0495686_0073074
825 Ga0495593_0001387
826 Ga0495593_0044086
827 Ga0495593_0223534
828 Ga0495602_0028570
829 Ga0495614_0000686
830 Ga0495614_0009183
831 Ga0495614_0076636
832 Ga0495614_0160786
833 Ga0495626_0013567
834 Ga0496104_0251823
835 Ga0496108_0079926
836 Ga0496109_0014032
837 Ga0496115_0462860
838 Ga0495678_063413
839 Ga0495682_0097687
840 Ga0501031_0003313
841 Ga0501031_0005622
842 Ga0501031_0145427
843 Ga0501031_0166997
844 Ga0501032_0001000
845 Ga0501032_0015007
846 Ga0501032_0032225
847 Ga0501033_0033372
848 Ga0501033_0033436
849 Ga0501033_0042616
850 Ga0501033_0067183
851 Ga0501033_0100027
852 Ga0501034_0006380
853 Ga0501034_0027557
854 Ga0501034_0036599
855 Ga0501034_0132504
856 Ga0501034_0147604
857 Ga0501034_0192787
858 Ga0501036_0004477
859 Ga0501036_0020929
860 Ga0501036_0032656
861 Ga0501036_0104395
862 Ga0501037_0003586
863 Ga0501037_0042261
864 Ga0501037_0333472
865 Ga0501038_0005459
866 Ga0501038_0020150
867 Ga0501038_0058002
868 Ga0501038_0067229
869 Ga0501039_0009980
870 Ga0501039_0027902
871 Ga0501039_0035183
872 Ga0501039_0119656
873 Ga0501040_0025944
874 Ga0501041_0002576
875 Ga0501042_0010403
876 Ga0501042_0038818
877 Ga0501042_0306914
878 Ga0501043_0001369
879 Ga0501043_0002836
880 Ga0501043_0003192
881 Ga0501043_0094641
882 Ga0501043_0209419
883 Ga0501046_0002449
884 Ga0501046_0009078
885 Ga0501046_0130408
886 Ga0501047_0000191
887 Ga0501047_0003295
888 Ga0501047_0033333
889 Ga0501047_0074133
890 Ga0501047_0174583
891 Ga0501047_0554450
892 Ga0501048_0011437
893 Ga0501048_0064672
894 Ga0501067_0017988
895 Ga0501068_0000777
896 Ga0501068_0036599
897 Ga0501069_0007606
898 Ga0501070_0000195
899 Ga0501070_0086214
900 Ga0501070_0241375
901 Ga0501071_0002969
902 Ga0501072_0005901
903 Ga0501073_0089070
904 Ga0501074_0017586
905 Ga0501074_0101418
906 Ga0501076_0021809
907 Ga0501077_0005523
908 Ga0501079_0029625
909 Ga0501080_0023161
910 Ga0501080_0031855
911 Ga0501083_0020414
912 Ga0501035_0001194
913 Ga0501035_0002948
914 Ga0501035_0021923
915 Ga0501035_0147500
916 Ga0501035_0341103
917 Ga0501044_0002251
918 Ga0501044_0011203
919 Ga0501044_0040970
920 Ga0501044_0068446
921 Ga0501044_0106072
922 Ga0501044_0198266
923 Ga0501044_0212615
924 Ga0501044_0238779
925 Ga0501044_0363731
926 Ga0501044_0437578
927 Ga0501044_0536389
928 Ga0501045_0134055
929 nmdc:mga03n38_477_c1
930 nmdc:mga0yw44_130712_c1
931 nmdc:mga06z11_11001_c1
932 Ga0495601_0011311
933 Ga0495612_0059386
934 Ga0495619_0011288
935 Ga0500578_0026354
936 Ga0500578_0176366
937 Ga0500644_0006713
938 Ga0500646_0041110
939 Ga0500647_0200204
940 Ga0500566_0128429
941 Ga0500640_004881
942 Ga0500641_0145163
943 Ga0500654_126822
944 Ga0500560_015936
945 Ga0500569_016261
946 Ga0500614_016722
947 Ga0500628_008127
948 Ga0500652_004574
949 Ga0500658_0004535
950 Ga0500573_0019983
951 Ga0500600_0007156
952 Ga0500624_011914
953 Ga0500633_0007106
954 Ga0500634_0019561
955 Ga0500634_0087790
956 Ga0500587_005883
957 Ga0501084_0030685
958 Ga0501082_0025324
959 Ga0466962_0003210
960 Ga0530510_0048999
961 2547409235
962 2554259657
963 2585297863
964 2585310921
965 2616703007
966 2616905331
967 2643764565
968 2643905222
969 2643942721
970 2644264155
971 2644385887
972 2644403280
973 2644430180
974 2644438172
975 2644458376
976 2644629904
977 2768643830
978 2784586634
979 2785345864
980 2785367025
981 2786668062
982 2793983331
983 2804843617
984 2808847528
985 2808918260
986 2809230161
987 2811846851
988 2812360440
989 2812482533
990 2816425548
991 2819699774
992 2852643299
993 2862181426
994 2862289785
995 2862294122
996 2862392546
997 2862508467
998 2862580101
999 2862709639
1000 2863407095
1001 2867346708
1002 2867375224
1003 2867435055
1004 2867475994
1005 2873157802
1006 2875392586
1007 2877683518
1008 2912722628
1009 2912726310
1010 2912758727
1011 2918502396
1012 2919474484
1013 2935394171
1014 2946052130
1015 2946065449
1016 2946073812
1017 2947231958
1018 2954008975
1019 2954388774
1020 2954674350
1021 2954689781
1022 2954699565
1023 2954702652
1024 2954718503
1025 2954728474
1026 2954733336
1027 2954747370
1028 2954752219
1029 2954766484
1030 2966604545
1031 2990045456
1032 2990060259
1033 2990093383
1034 2997451916
1035 2997603426
1036 3006327561
1037 3006399456
1038 3006430707
1039 3006489358
1040 3006498346
1041 8008486930
1042 8008561186
1043 8008580868
1044 8023630935
1045 8025418332
1046 8025482367
1047 8025526187
1048 8025533895
1049 8047901207
1050 8048135609
1051 8048357694
1052 8048378147
1053 8048387245
1054 8048409971
1055 8054166911
1056 8056454227
1057 8056670095
1058 8056832439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05949

DUF881

Bacterial protein of unknown function (DUF881)

140

294

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gmg-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein from mycobacterium tuberculosis 0.8162 126 271
3gmg-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein from mycobacterium tuberculosis 0.8057 126 271
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.6494 139 251
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.644 136 253
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.6287 136 253
ID Description Score Start End Superfamily
af_P9WFG1_148_306_3.30.70.1880 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.8714 126 272 3.30.70.1880
3gmgB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.8162 126 271 3.30.70.1880
3gmgB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.8057 126 271 3.30.70.1880
af_P9WFG1_148_306_3.30.70.1880 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.8045 126 272 3.30.70.1880
af_L0T243_102_259_3.30.70.1880 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function DUF881 0.7944 125 273 3.30.70.1880
ID Description Score Start End GO Terms
AF-A0A351H8D9-F1-model_v4 Uncharacterized protein 0.9058 137 259
AF-A0A7V2JRE3-F1-model_v4 DUF881 domain-containing protein 0.9056 131 261
AF-A0A4D4KSU2-F1-model_v4 DUF881 domain-containing protein 0.8966 139 273 GO:0005886
AF-A0A644YW37-F1-model_v4 DUF881 domain-containing protein 0.8928 161 273 GO:0005886
AF-A0A372JT49-F1-model_v4 DUF881 domain-containing protein 0.8909 125 273 GO:0005886

Map