F459813

General Info

Members Datasets Scaffolds Average Seq Length
529 230 1058 262

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_11135879|Ga0157375_111358791
Length 279
Sequence MSPGTGGRSVQQEALMTRSRRDFLKLGGIAAASTAMGTPLLAGAGDPALGLIFPPLNYPIPPDAKLLYPTGVEFLSGGVGLPGGMTLAGYDEAIPRVLPAAEALAKQGAKVISVFGSSLTFYKGAKFNEELIQKVSKATGLPATTQSNGLVDGLKVANAKRVALATAYTDTVTERLKLFLEEYGFQVTAAKGLGYERLPDSVPQDVLVKLGAEAYAMSKRADAVVMSCGGLRTLNVIVPLEGEIKVPVVSSTPHGLMNGVRLLGISPRSQGYGMVLAKA

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.84
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 21.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_11135879 3300013308 Unclassified 915
2 JGI25406J46586_10001197 3300003203 Bacteria 12210
3 JGI25406J46586_10003315 3300003203 Bacteria 7580
4 Ga0065714_10071231 3300005288 Unclassified 3632
5 Ga0065714_10179521 3300005288 Unclassified 969
6 Ga0065712_10071586 3300005290 Bacteria 5171
7 Ga0065712_10136838 3300005290 Bacteria 1489
8 Ga0065715_10023200 3300005293 Bacteria 2475
9 Ga0065715_10030918 3300005293 Bacteria 1338
10 Ga0065715_10112283 3300005293 Bacteria 2527
11 Ga0065707_10100049 3300005295 Bacteria 2959
12 Ga0065707_10152063 3300005295 Bacteria 1648
13 Ga0070676_10007975 3300005328 Bacteria 5693
14 Ga0070676_10079370 3300005328 Bacteria 1987
15 Ga0070683_100379814 3300005329 Bacteria 1346
16 Ga0070690_100005069 3300005330 Bacteria 7382
17 Ga0070690_100240418 3300005330 Bacteria 1276
18 Ga0070690_100316567 3300005330 Bacteria 1123
19 Ga0070670_100015147 3300005331 Bacteria 6617
20 Ga0070670_100025770 3300005331 Bacteria 5060
21 Ga0070670_100140037 3300005331 Unclassified 2092
22 Ga0070677_10001817 3300005333 Bacteria 6737
23 Ga0070677_10042907 3300005333 Bacteria 1794
24 Ga0068869_100132058 3300005334 Bacteria 1920
25 Ga0068869_100218402 3300005334 Bacteria 1510
26 Ga0070666_10007897 3300005335 Bacteria 6575
27 Ga0070666_10010958 3300005335 Bacteria 5681
28 Ga0070666_10070155 3300005335 Bacteria 2384
29 Ga0070680_100228128 3300005336 Unclassified 1572
30 Ga0070660_100386709 3300005339 Bacteria 1155
31 Ga0070689_100008281 3300005340 Bacteria 7316
32 Ga0070689_100188965 3300005340 Bacteria 1676
33 Ga0070687_100089063 3300005343 Bacteria 1703
34 Ga0070687_100112125 3300005343 Unclassified 1545
35 Ga0070661_100083105 3300005344 Bacteria 2365
36 Ga0070668_100014243 3300005347 Bacteria 5942
37 Ga0070669_100001320 3300005353 Bacteria 17879
38 Ga0070669_100031473 3300005353 Unclassified 3832
39 Ga0070669_100050823 3300005353 Bacteria 3028
40 Ga0070675_100001103 3300005354 Bacteria 19465
41 Ga0070675_100025428 3300005354 Unclassified 4747
42 Ga0070675_100028614 3300005354 Bacteria 4485
43 Ga0070675_100063715 3300005354 Unclassified 3048
44 Ga0070675_100107174 3300005354 Bacteria 2359
45 Ga0070675_100128752 3300005354 Bacteria 2155
46 Ga0070674_100000189 3300005356 Bacteria 29310
47 Ga0070673_100001241 3300005364 Bacteria 14792
48 Ga0070673_100006233 3300005364 Bacteria 7733
49 Ga0070673_100109397 3300005364 Bacteria 2290
50 Ga0070673_100155342 3300005364 Bacteria 1941
51 Ga0070688_100026687 3300005365 Bacteria 3434
52 Ga0070659_100186392 3300005366 Unclassified 1704
53 Ga0070667_100005812 3300005367 Bacteria 10293
54 Ga0070667_100015804 3300005367 Bacteria 6244
55 Ga0070667_100277377 3300005367 Bacteria 1504
56 Ga0070709_10121049 3300005434 Bacteria 1774
57 Ga0070713_100027228 3300005436 Unclassified 4499
58 Ga0070713_100174248 3300005436 Unclassified 1929
59 Ga0070701_10007017 3300005438 Bacteria 4778
60 Ga0070705_100350573 3300005440 Bacteria 1076
61 Ga0070700_100016679 3300005441 Bacteria 4186
62 Ga0070700_100067492 3300005441 Bacteria 2272
63 Ga0070700_100325268 3300005441 Bacteria 1131
64 Ga0070708_100199477 3300005445 Bacteria 1873
65 Ga0070663_100376889 3300005455 Bacteria 1155
66 Ga0070663_100397176 3300005455 Bacteria 1126
67 Ga0070678_100032883 3300005456 Bacteria 3595
68 Ga0070678_100037940 3300005456 Unclassified 3388
69 Ga0070662_100061803 3300005457 Unclassified 2735
70 Ga0070662_100097466 3300005457 Bacteria 2219
71 Ga0068867_100017884 3300005459 Bacteria 5035
72 Ga0068867_100349452 3300005459 Unclassified 1233
73 Ga0070685_10005371 3300005466 Bacteria 6490
74 Ga0070685_10008955 3300005466 Bacteria 5162
75 Ga0070685_10123133 3300005466 Bacteria 1613
76 Ga0070707_100009565 3300005468 Bacteria 9007
77 Ga0070707_100364414 3300005468 Unclassified 1404
78 Ga0070698_100088624 3300005471 Bacteria 3079
79 Ga0070684_100529177 3300005535 Unclassified 1093
80 Ga0070697_100376096 3300005536 Unclassified 1230
81 Ga0070672_100004261 3300005543 Bacteria 9353
82 Ga0070672_100008283 3300005543 Bacteria 7105
83 Ga0070672_100221018 3300005543 Bacteria 1589
84 Ga0070672_100235639 3300005543 Bacteria 1538
85 Ga0070686_100033148 3300005544 Bacteria 3171
86 Ga0070686_100080546 3300005544 Bacteria 2155
87 Ga0070686_100107814 3300005544 Bacteria 1892
88 Ga0070696_100191278 3300005546 Bacteria 1523
89 Ga0070693_100148759 3300005547 Unclassified 1481
90 Ga0070665_100058226 3300005548 Unclassified 3873
91 Ga0070665_100092012 3300005548 Bacteria 3037
92 Ga0070704_100065539 3300005549 Bacteria 2615
93 Ga0070704_100073238 3300005549 Bacteria 2495
94 Ga0070664_100017683 3300005564 Bacteria 5855
95 Ga0070664_100069425 3300005564 Bacteria 3015
96 Ga0070664_100092880 3300005564 Unclassified 2614
97 Ga0070664_100534882 3300005564 Bacteria 1083
98 Ga0068857_100157114 3300005577 Unclassified 2062
99 Ga0068857_100324568 3300005577 Bacteria 1422
100 Ga0068857_100386295 3300005577 Bacteria 1301
101 Ga0070702_100027908 3300005615 Bacteria 3052
102 Ga0070702_100036736 3300005615 Bacteria 2716
103 Ga0068852_100119938 3300005616 Bacteria 2406
104 Ga0068859_100003531 3300005617 Bacteria 15926
105 Ga0068859_100056684 3300005617 Unclassified 3945
106 Ga0068859_100145560 3300005617 Bacteria 2444
107 Ga0068859_100243252 3300005617 Unclassified 1889
108 Ga0068864_100011943 3300005618 Bacteria 7170
109 Ga0068864_100014849 3300005618 Bacteria 6470
110 Ga0068866_10395773 3300005718 Unclassified 890
111 Ga0068861_100009437 3300005719 Bacteria 6736
112 Ga0068861_100011141 3300005719 Bacteria 6243
113 Ga0068861_100106660 3300005719 Bacteria 2238
114 Ga0068861_100178908 3300005719 Bacteria 1764
115 Ga0068870_10000313 3300005840 Bacteria 18015
116 Ga0068870_10296538 3300005840 Bacteria 1019
117 Ga0068863_100000478 3300005841 Bacteria 41029
118 Ga0068863_100054059 3300005841 Bacteria 3806
119 Ga0068863_100129614 3300005841 Bacteria 2408
120 Ga0068863_100144885 3300005841 Bacteria 2271
121 Ga0068863_100208961 3300005841 Bacteria 1879
122 Ga0068863_100445670 3300005841 Bacteria 1270
123 Ga0068858_100004643 3300005842 Bacteria 13456
124 Ga0068858_100010368 3300005842 Bacteria 8827
125 Ga0068858_100051292 3300005842 Unclassified 3817
126 Ga0068860_100002833 3300005843 Bacteria 18039
127 Ga0068860_100067837 3300005843 Bacteria 3388
128 Ga0068860_100305378 3300005843 Unclassified 1560
129 Ga0068862_100003841 3300005844 Bacteria 12795
130 Ga0068862_100197137 3300005844 Bacteria 1814
131 Ga0068862_100468778 3300005844 Bacteria 1190
132 Ga0081539_10000163 3300005985 Bacteria 156102
133 Ga0081539_10001355 3300005985 Bacteria 42627
134 Ga0081539_10002106 3300005985 Bacteria 29503
135 Ga0097621_100001051 3300006237 Bacteria 19349
136 Ga0097621_100014381 3300006237 Bacteria 5922
137 Ga0097621_100015980 3300006237 Bacteria 5660
138 Ga0097621_100018431 3300006237 Bacteria 5332
139 Ga0097621_100025993 3300006237 Bacteria 4587
140 Ga0097621_100280107 3300006237 Bacteria 1468
141 Ga0097621_100592791 3300006237 Unclassified 1012
142 Ga0068871_100001105 3300006358 Bacteria 18105
143 Ga0068871_100001880 3300006358 Bacteria 14199
144 Ga0068871_100046186 3300006358 Bacteria 3507
145 Ga0068871_100079188 3300006358 Bacteria 2718
146 Ga0068871_100086544 3300006358 Bacteria 2604
147 Ga0068871_100091443 3300006358 Unclassified 2536
148 Ga0068871_100230056 3300006358 Bacteria 1609
149 Ga0068871_100422420 3300006358 Bacteria 1191
150 Ga0075428_100007683 3300006844 Bacteria 11951
151 Ga0075428_100038076 3300006844 Bacteria 5292
152 Ga0075428_100197739 3300006844 Unclassified 2174
153 Ga0075428_100199251 3300006844 Bacteria 2165
154 Ga0075428_100348965 3300006844 Bacteria 1588
155 Ga0075430_100000271 3300006846 Bacteria 36690
156 Ga0075430_100067592 3300006846 Bacteria 3000
157 Ga0075430_100107225 3300006846 Bacteria 2330
158 Ga0075430_100278666 3300006846 Bacteria 1384
159 Ga0075431_100014800 3300006847 Bacteria 7897
160 Ga0075431_100067492 3300006847 Bacteria 3692
161 Ga0075431_100143611 3300006847 Bacteria 2459
162 Ga0075431_100212049 3300006847 Unclassified 1978
163 Ga0075431_100400249 3300006847 Bacteria 1374
164 Ga0075431_100569752 3300006847 Bacteria 1118
165 Ga0075433_10008899 3300006852 Bacteria 8013
166 Ga0075433_10022169 3300006852 Bacteria 5331
167 Ga0075433_10039169 3300006852 Bacteria 4097
168 Ga0075433_10294360 3300006852 Unclassified 1438
169 Ga0075434_100009387 3300006871 Bacteria 9118
170 Ga0075434_100010150 3300006871 Bacteria 8821
171 Ga0075434_100018260 3300006871 Bacteria 6772
172 Ga0075434_100043245 3300006871 Bacteria 4467
173 Ga0075434_100127000 3300006871 Bacteria 2567
174 Ga0075434_100160358 3300006871 Bacteria 2269
175 Ga0075434_100464375 3300006871 Bacteria 1287
176 Ga0075434_100495824 3300006871 Bacteria 1242
177 Ga0075429_100027056 3300006880 Bacteria 4980
178 Ga0075429_100098901 3300006880 Bacteria 2546
179 Ga0075429_100101372 3300006880 Unclassified 2513
180 Ga0075429_100173790 3300006880 Unclassified 1887
181 Ga0075429_100261018 3300006880 Unclassified 1517
182 Ga0075429_100409980 3300006880 Bacteria 1187
183 Ga0068865_100312997 3300006881 Bacteria 1260
184 Ga0068865_100488255 3300006881 Bacteria 1025
185 Ga0068865_100628351 3300006881 Bacteria 910
186 Ga0075436_100334287 3300006914 Unclassified 1090
187 Ga0097620_100003531 3300006931 Bacteria 15926
188 Ga0097620_100056683 3300006931 Unclassified 3945
189 Ga0097620_100145550 3300006931 Bacteria 2444
190 Ga0097620_100243253 3300006931 Unclassified 1889
191 Ga0075435_100003860 3300007076 Bacteria 10222
192 Ga0105240_10376834 3300009093 Unclassified 1603
193 Ga0111539_10000121 3300009094 Bacteria 87484
194 Ga0111539_10001142 3300009094 Bacteria 35096
195 Ga0111539_10005854 3300009094 Bacteria 15889
196 Ga0111539_10011687 3300009094 Bacteria 11016
197 Ga0111539_10030938 3300009094 Bacteria 6504
198 Ga0111539_10052251 3300009094 Unclassified 4865
199 Ga0111539_10350131 3300009094 Unclassified 1719
200 Ga0111539_10528130 3300009094 Unclassified 1375
201 Ga0105245_10002814 3300009098 Bacteria 15638
202 Ga0105247_10032884 3300009101 Bacteria 3152
203 Ga0105247_10144828 3300009101 Unclassified 1560
204 Ga0105247_10236428 3300009101 Unclassified 1243
205 Ga0114129_10001413 3300009147 Bacteria 32335
206 Ga0114129_10026428 3300009147 Bacteria 8219
207 Ga0114129_10107953 3300009147 Bacteria 3844
208 Ga0114129_10143826 3300009147 Bacteria 3267
209 Ga0114129_10145670 3300009147 Bacteria 3245
210 Ga0114129_10146962 3300009147 Bacteria 3228
211 Ga0114129_10160562 3300009147 Bacteria 3071
212 Ga0114129_10826788 3300009147 Unclassified 1179
213 Ga0105243_10121224 3300009148 Bacteria 2205
214 Ga0105242_10007847 3300009176 Bacteria 8213
215 Ga0105242_10613151 3300009176 Bacteria 1053
216 Ga0105242_10752180 3300009176 Unclassified 960
217 Ga0105242_10862634 3300009176 Bacteria 902
218 Ga0105248_10004819 3300009177 Bacteria 14933
219 Ga0105248_10045136 3300009177 Bacteria 4941
220 Ga0105248_10290936 3300009177 Bacteria 1839
221 Ga0105248_10296035 3300009177 Bacteria 1822
222 Ga0105238_10862269 3300009551 Unclassified 923
223 Ga0105249_10018336 3300009553 Bacteria 6223
224 Ga0105249_10189912 3300009553 Unclassified 2004
225 Ga0105249_10607643 3300009553 Bacteria 1149
226 Ga0105246_10039605 3300011119 Bacteria 3176
227 Ga0105246_10600708 3300011119 Bacteria 951
228 Ga0157374_10024743 3300013296 Bacteria 5383
229 Ga0157374_10143229 3300013296 Bacteria 2321
230 Ga0157378_10012221 3300013297 Bacteria 7519
231 Ga0157378_10297004 3300013297 Bacteria 1562
232 Ga0163162_10042215 3300013306 Bacteria 4564
233 Ga0163162_10053752 3300013306 Bacteria 4048
234 Ga0163162_10076631 3300013306 Bacteria 3406
235 Ga0163162_10162042 3300013306 Bacteria 2358
236 Ga0157375_10000105 3300013308 Bacteria 82289
237 Ga0163163_10034168 3300014325 Unclassified 4923
238 Ga0163163_10046112 3300014325 Bacteria 4280
239 Ga0163163_10793528 3300014325 Unclassified 1010
240 Ga0157380_10003118 3300014326 Bacteria 11305
241 Ga0157380_10004086 3300014326 Bacteria 10079
242 Ga0157380_10131658 3300014326 Unclassified 2135
243 Ga0157380_10341130 3300014326 Bacteria 1398
244 Ga0157380_10703434 3300014326 Bacteria 1016
245 Ga0157377_10070783 3300014745 Unclassified 2015
246 Ga0157377_10079360 3300014745 Bacteria 1914
247 Ga0157379_10000223 3300014968 Bacteria 44424
248 Ga0157379_10025570 3300014968 Bacteria 5246
249 Ga0157379_10038284 3300014968 Bacteria 4280
250 Ga0157379_10133743 3300014968 Unclassified 2234
251 Ga0157376_10016977 3300014969 Bacteria 5542
252 Ga0157376_10025287 3300014969 Bacteria 4675
253 Ga0157376_10165311 3300014969 Bacteria 2010
254 Ga0157376_10188924 3300014969 Bacteria 1888
255 Ga0157376_10214224 3300014969 Unclassified 1780
256 Ga0163161_10017881 3300017792 Bacteria 4967
257 Ga0163161_10044066 3300017792 Bacteria 3213
258 Ga0207697_10009997 3300025315 Bacteria 4074
259 Ga0207697_10063825 3300025315 Unclassified 1535
260 Ga0207682_10004256 3300025893 Bacteria 6042
261 Ga0207682_10010403 3300025893 Unclassified 3646
262 Ga0207710_10054678 3300025900 Bacteria 1798
263 Ga0207710_10075103 3300025900 Unclassified 1557
264 Ga0207710_10123778 3300025900 Unclassified 1237
265 Ga0207688_10088357 3300025901 Bacteria 1777
266 Ga0207688_10207358 3300025901 Bacteria 1177
267 Ga0207680_10022962 3300025903 Bacteria 3399
268 Ga0207680_10238311 3300025903 Unclassified 1253
269 Ga0207680_10412268 3300025903 Unclassified 956
270 Ga0207699_10038653 3300025906 Bacteria 2737
271 Ga0207645_10003652 3300025907 Bacteria 11609
272 Ga0207645_10004725 3300025907 Bacteria 10024
273 Ga0207645_10270186 3300025907 Unclassified 1127
274 Ga0207643_10000504 3300025908 Bacteria 24971
275 Ga0207643_10012474 3300025908 Unclassified 4593
276 Ga0207663_10021169 3300025916 Bacteria 3698
277 Ga0207660_10228362 3300025917 Bacteria 1463
278 Ga0207662_10004610 3300025918 Bacteria 7267
279 Ga0207649_10154885 3300025920 Bacteria 1582
280 Ga0207646_10005607 3300025922 Bacteria 13185
281 Ga0207681_10029758 3300025923 Bacteria 3552
282 Ga0207681_10062973 3300025923 Bacteria 2556
283 Ga0207681_10106188 3300025923 Bacteria 2034
284 Ga0207694_10055262 3300025924 Bacteria 3082
285 Ga0207650_10058565 3300025925 Bacteria 2868
286 Ga0207650_10119419 3300025925 Bacteria 2050
287 Ga0207650_10170118 3300025925 Bacteria 1731
288 Ga0207659_10000253 3300025926 Bacteria 32650
289 Ga0207659_10018202 3300025926 Unclassified 4602
290 Ga0207659_10033154 3300025926 Bacteria 3552
291 Ga0207659_10071680 3300025926 Bacteria 2530
292 Ga0207659_10375096 3300025926 Unclassified 1185
293 Ga0207687_10096937 3300025927 Bacteria 2162
294 Ga0207700_10070327 3300025928 Bacteria 2690
295 Ga0207706_10046232 3300025933 Unclassified 3854
296 Ga0207706_10213064 3300025933 Unclassified 1693
297 Ga0207706_10289985 3300025933 Bacteria 1427
298 Ga0207686_10037191 3300025934 Bacteria 2936
299 Ga0207686_10139152 3300025934 Unclassified 1675
300 Ga0207709_10058547 3300025935 Bacteria 2395
301 Ga0207670_10143046 3300025936 Bacteria 1765
302 Ga0207669_10013987 3300025937 Unclassified 4008
303 Ga0207669_10496564 3300025937 Unclassified 976
304 Ga0207704_10043658 3300025938 Bacteria 2649
305 Ga0207704_10146610 3300025938 Bacteria 1659
306 Ga0207704_10591419 3300025938 Unclassified 907
307 Ga0207665_10401346 3300025939 Unclassified 1044
308 Ga0207691_10001339 3300025940 Bacteria 24573
309 Ga0207691_10017587 3300025940 Bacteria 6776
310 Ga0207691_10130764 3300025940 Bacteria 2218
311 Ga0207691_10538484 3300025940 Bacteria 990
312 Ga0207711_10003803 3300025941 Bacteria 12978
313 Ga0207711_10012844 3300025941 Bacteria 6958
314 Ga0207711_10055686 3300025941 Unclassified 3395
315 Ga0207711_10159708 3300025941 Bacteria 2039
316 Ga0207689_10282491 3300025942 Bacteria 1374
317 Ga0207661_10415905 3300025944 Bacteria 1221
318 Ga0207679_10008079 3300025945 Bacteria 6691
319 Ga0207679_10049539 3300025945 Bacteria 3065
320 Ga0207679_10127539 3300025945 Bacteria 2036
321 Ga0207679_10227855 3300025945 Bacteria 1571
322 Ga0207651_10009211 3300025960 Bacteria 5386
323 Ga0207651_10037316 3300025960 Bacteria 3182
324 Ga0207651_10121270 3300025960 Unclassified 1983
325 Ga0207712_10017166 3300025961 Bacteria 4696
326 Ga0207712_10258876 3300025961 Bacteria 1410
327 Ga0207658_10067553 3300025986 Unclassified 2693
328 Ga0207677_10012533 3300026023 Bacteria 4878
329 Ga0207677_10030647 3300026023 Bacteria 3436
330 Ga0207703_10032803 3300026035 Bacteria 4113
331 Ga0207703_10089916 3300026035 Bacteria 2579
332 Ga0207678_10679593 3300026067 Bacteria 905
333 Ga0207708_10005313 3300026075 Bacteria 9486
334 Ga0207708_10014264 3300026075 Bacteria 5943
335 Ga0207708_10072671 3300026075 Unclassified 2636
336 Ga0207708_10086347 3300026075 Bacteria 2414
337 Ga0207641_10002415 3300026088 Bacteria 17250
338 Ga0207641_10069946 3300026088 Bacteria 3015
339 Ga0207641_10102413 3300026088 Bacteria 2525
340 Ga0207641_10303600 3300026088 Bacteria 1508
341 Ga0207648_10016050 3300026089 Bacteria 6861
342 Ga0207648_10031782 3300026089 Unclassified 4665
343 Ga0207648_10119136 3300026089 Unclassified 2320
344 Ga0207648_10119550 3300026089 Bacteria 2316
345 Ga0207648_10161877 3300026089 Bacteria 1976
346 Ga0207676_10047362 3300026095 Unclassified 3331
347 Ga0207676_10354960 3300026095 Bacteria 1357
348 Ga0207674_10042180 3300026116 Unclassified 4715
349 Ga0207674_10126769 3300026116 Bacteria 2518
350 Ga0207674_10254560 3300026116 Bacteria 1703
351 Ga0207674_10288631 3300026116 Bacteria 1589
352 Ga0207675_100005257 3300026118 Bacteria 12452
353 Ga0207675_100006040 3300026118 Bacteria 11522
354 Ga0207675_100102152 3300026118 Bacteria 2702
355 Ga0207675_100109596 3300026118 Bacteria 2605
356 Ga0207675_100370630 3300026118 Bacteria 1406
357 Ga0207683_10050990 3300026121 Bacteria 3626
358 Ga0207683_10056317 3300026121 Unclassified 3448
359 Ga0207683_10266241 3300026121 Bacteria 1565
360 Ga0207683_10272514 3300026121 Bacteria 1546
361 Ga0207698_10073990 3300026142 Bacteria 2715
362 Ga0209974_10015171 3300027876 Bacteria 2558
363 Ga0209974_10021239 3300027876 Bacteria 2149
364 Ga0207428_10001221 3300027907 Bacteria 27574
365 Ga0207428_10002827 3300027907 Bacteria 17231
366 Ga0207428_10003876 3300027907 Bacteria 14337
367 Ga0207428_10087200 3300027907 Bacteria 2428
368 Ga0207428_10100431 3300027907 Unclassified 2236
369 Ga0268266_10138661 3300028379 Unclassified 2181
370 Ga0268265_10003277 3300028380 Bacteria 11733
371 Ga0268265_10007800 3300028380 Bacteria 7226
372 Ga0268265_10210666 3300028380 Bacteria 1693
373 Ga0268265_10447747 3300028380 Bacteria 1205
374 Ga0268264_10005571 3300028381 Bacteria 10666
375 Ga0268264_10032026 3300028381 Bacteria 4314
376 Ga0268264_10169665 3300028381 Unclassified 1972
377 Ga0265314_10177038 3300031711 Unclassified 1282
378 Ga0307405_10074857 3300031731 Bacteria 2191
379 Ga0307405_10244971 3300031731 Unclassified 1330
380 Ga0307413_10277518 3300031824 Bacteria 1258
381 Ga0307410_10427278 3300031852 Bacteria 1076
382 Ga0307409_100750916 3300031995 Bacteria 979
383 Ga0307416_100169311 3300032002 Bacteria 2031
384 Ga0307416_100452924 3300032002 Unclassified 1336
385 Ga0307416_100480089 3300032002 Bacteria 1303
386 Ga0307414_10394642 3300032004 Bacteria 1200
387 Ga0373926_0046224 3300035083 Unclassified 1562
388 Ga0373932_0011145 3300035112 Bacteria 2191
389 Ga0373936_0030601 3300035113 Bacteria 2123
390 Ga0373939_0107964 3300035114 Unclassified 965
391 Ga0373956_0123277 3300035119 Bacteria 1211
392 Ga0373943_0064564 3300035170 Bacteria 1838
393 Ga0373955_0091694 3300035172 Bacteria 1732
394 Ga0373955_0295744 3300035172 Unclassified 976
395 Ga0373924_0003476 3300035410 Bacteria 5425
396 Ga0373931_0178097 3300035691 Bacteria 1257
397 Ga0373931_0295454 3300035691 Unclassified 999
398 Ga0373935_0044731 3300035692 Bacteria 2792
399 Ga0373927_0192555 3300035695 Unclassified 1338
400 Ga0373933_0021871 3300035724 Bacteria 3638
401 Ga0373933_0250695 3300035724 Bacteria 1140
402 Ga0373925_0183126 3300037068 Bacteria 1659
403 Ga0439453_0012362 3300041408 Unclassified 1437
404 Ga0439453_0017036 3300041408 Bacteria 1273
405 Ga0451576_0006647 3300045051 Bacteria 14121
406 Ga0495592_0062262 3300046454 Bacteria 2740
407 Ga0495603_0274685 3300046455 Bacteria 969
408 Ga0495580_0052601 3300046472 Bacteria 2876
409 Ga0495582_0203516 3300046473 Bacteria 1131
410 Ga0495639_0030826 3300046475 Bacteria 2385
411 Ga0495594_0133393 3300046499 Unclassified 1407
412 Ga0495608_0003518 3300046511 Bacteria 11225
413 Ga0495608_0237094 3300046511 Unclassified 1141
414 Ga0495630_0004051 3300046517 Bacteria 10261
415 Ga0495630_0380019 3300046517 Bacteria 1082
416 Ga0495643_0002930 3300046522 Bacteria 12934
417 Ga0495652_0303568 3300046529 Bacteria 1159
418 Ga0495598_0015443 3300046537 Bacteria 1929
419 Ga0495598_0030619 3300046537 Bacteria 1509
420 Ga0495621_0066969 3300046539 Bacteria 1315
421 Ga0495667_0119908 3300046559 Bacteria 1699
422 Ga0495634_0135773 3300046642 Bacteria 1565
423 Ga0495658_0046623 3300046683 Bacteria 2437
424 Ga0495613_0000330 3300046689 Bacteria 42800
425 Ga0495600_0115791 3300046809 Bacteria 1745
426 Ga0495604_0015570 3300047317 Bacteria 6071
427 Ga0495674_0028928 3300047319 Bacteria 5048
428 Ga0495674_0391610 3300047319 Bacteria 1123
429 Ga0495684_0000953 3300047471 Bacteria 23556
430 Ga0496100_0008160 3300048903 Bacteria 5830
431 Ga0496101_0000950 3300048904 Bacteria 17103
432 Ga0496102_0100541 3300048905 Bacteria 2686
433 Ga0496104_0137950 3300048907 Bacteria 2343
434 Ga0496106_0158627 3300048909 Unclassified 1788
435 Ga0496107_0031929 3300048910 Bacteria 3761
436 Ga0496108_0174633 3300048911 Bacteria 1860
437 Ga0496108_0243974 3300048911 Unclassified 1563
438 Ga0496109_0282717 3300048912 Unclassified 1564
439 Ga0496109_0343971 3300048912 Bacteria 1409
440 Ga0496112_0057864 3300048915 Bacteria 3817
441 Ga0496114_0319851 3300048917 Bacteria 1371
442 Ga0496114_0329765 3300048917 Bacteria 1349
443 Ga0496115_0134045 3300048918 Unclassified 2042
444 Ga0496115_0377664 3300048918 Bacteria 1153
445 Ga0501032_0314219 3300049569 Unclassified 1012
446 Ga0501033_0161788 3300049570 Bacteria 1611
447 Ga0501038_0026032 3300049574 Bacteria 5210
448 Ga0501038_0361332 3300049574 Unclassified 1129
449 Ga0501040_0001950 3300049576 Bacteria 13281
450 Ga0501040_0065253 3300049576 Bacteria 2507
451 Ga0501041_0008557 3300049577 Bacteria 6024
452 Ga0501042_0028583 3300049578 Bacteria 3930
453 Ga0501042_0047647 3300049578 Bacteria 3056
454 Ga0501042_0193667 3300049578 Bacteria 1466
455 Ga0501042_0298128 3300049578 Unclassified 1165
456 Ga0501043_0256441 3300049579 Bacteria 1346
457 Ga0501046_0011763 3300049580 Bacteria 7472
458 Ga0501046_0190884 3300049580 Bacteria 1528
459 Ga0501048_0077970 3300049582 Bacteria 2338
460 Ga0501068_0154972 3300049584 Unclassified 1442
461 Ga0501071_0009322 3300049587 Bacteria 6534
462 Ga0501071_0268510 3300049587 Unclassified 1289
463 Ga0501071_0582968 3300049587 Bacteria 859
464 Ga0501072_0017653 3300049588 Bacteria 5487
465 Ga0501074_0012397 3300049590 Bacteria 6197
466 Ga0501075_0000806 3300049591 Bacteria 19601
467 Ga0501075_0191840 3300049591 Bacteria 1558
468 Ga0501076_0020335 3300049592 Bacteria 5081
469 Ga0501076_0052625 3300049592 Bacteria 3225
470 Ga0501077_0014784 3300049593 Bacteria 4904
471 Ga0501079_0216560 3300049741 Unclassified 1496
472 Ga0501079_0390269 3300049741 Bacteria 1092
473 Ga0501081_0000676 3300049743 Bacteria 19583
474 Ga0501081_0369626 3300049743 Unclassified 1059
475 Ga0501081_0416959 3300049743 Bacteria 995
476 Ga0501283_035925 3300049779 Bacteria 845
477 Ga0501035_0342761 3300049822 Unclassified 1252
478 Ga0501045_0003631 3300049824 Bacteria 10608
479 Ga0501045_0321917 3300049824 Bacteria 1151
480 nmdc:mga05p37_148272_c1 3300050507 Bacteria 2871
481 nmdc:mga05p37_162540_c1 3300050507 Bacteria 2727
482 nmdc:mga05p37_218382_c1 3300050507 Bacteria 2302
483 nmdc:mga05p37_28113_c2 3300050507 Bacteria 3676
484 nmdc:mga05p37_294959_c1 3300050507 Bacteria 1929
485 nmdc:mga05p37_403764_c1 3300050507 Bacteria 1595
486 nmdc:mga05p37_421517_c1 3300050507 Bacteria 1553
487 nmdc:mga09592_14936_c1 3300050508 Bacteria 6344
488 nmdc:mga09592_198718_c1 3300050508 Unclassified 1736
489 nmdc:mga09592_234901_c1 3300050508 Unclassified 1588
490 nmdc:mga09592_47515_c1 3300050508 Bacteria 3617
491 nmdc:mga09592_643814_c1 3300050508 Unclassified 905
492 nmdc:mga09592_72050_c1 3300050508 Bacteria 2933
493 nmdc:mga09592_92764_c1 3300050508 Plasmid 2581
494 nmdc:mga0qj67_110502_c1 3300050509 Bacteria 2219
495 nmdc:mga0qj67_218446_c1 3300050509 Bacteria 1547
496 nmdc:mga0qj67_286083_c1 3300050509 Bacteria 1336
497 nmdc:mga0qj67_304_c1 3300050509 Bacteria 34204
498 nmdc:mga0qj67_31944_c1 3300050509 Bacteria 4104
499 nmdc:mga06r32_10601_c1 3300050510 Bacteria 8311
500 nmdc:mga06r32_390668_c1 3300050510 Bacteria 1374
501 nmdc:mga06r32_488058_c1 3300050510 Unclassified 1210
502 nmdc:mga06r32_575302_c1 3300050510 Bacteria 1099
503 nmdc:mga08y16_183_c1 3300050511 Bacteria 55505
504 nmdc:mga08y16_186895_c1 3300050511 Bacteria 2150
505 nmdc:mga08y16_30569_c1 3300050511 Bacteria 5668
506 nmdc:mga08y16_3388_c1 3300050511 Bacteria 16524
507 nmdc:mga08y16_67568_c1 3300050511 Bacteria 3728
508 nmdc:mga08y16_80750_c1 3300050511 Bacteria 3391
509 nmdc:mga0n895_233888_c1 3300050512 Bacteria 1865
510 nmdc:mga0n895_31372_c1 3300050512 Bacteria 5088
511 nmdc:mga0n895_36228_c1 3300050512 Bacteria 4763
512 nmdc:mga0n895_3785_c1 3300050512 Bacteria 12250
513 nmdc:mga0n895_5531_c1 3300050512 Bacteria 10579
514 nmdc:mga0n895_67972_c1 3300050512 Bacteria 3529
515 nmdc:mga0rr50_10481_c1 3300050513 Bacteria 5883
516 nmdc:mga0rr50_390741_c1 3300050513 Unclassified 1174
517 nmdc:mga0rr50_78162_c1 3300050513 Bacteria 2545
518 nmdc:mga0a205_17413_c1 3300050515 Bacteria 6736
519 nmdc:mga0a205_1793_c1 3300050515 Bacteria 18565
520 nmdc:mga0a205_225106_c1 3300050515 Bacteria 1760
521 nmdc:mga0a205_46998_c1 3300050515 Bacteria 4163
522 Ga0495601_0067791 3300053077 Unclassified 2273
523 Ga0495619_0001339 3300053085 Bacteria 16142
524 Ga0495619_0218183 3300053085 Unclassified 1321
525 Ga0501084_0029369 3300054114 Bacteria 4599
526 Ga0501084_0032528 3300054114 Bacteria 4363
527 Ga0501084_0466057 3300054114 Unclassified 1068
528 Ga0501082_0007764 3300060353 Bacteria 9258
529 Ga0530510_0020224 3300061734 Bacteria 4733
530 Ga0157375_11135879
531 JGI25406J46586_10001197
532 JGI25406J46586_10003315
533 Ga0065714_10071231
534 Ga0065714_10179521
535 Ga0065712_10071586
536 Ga0065712_10136838
537 Ga0065715_10023200
538 Ga0065715_10030918
539 Ga0065715_10112283
540 Ga0065707_10100049
541 Ga0065707_10152063
542 Ga0070676_10007975
543 Ga0070676_10079370
544 Ga0070683_100379814
545 Ga0070690_100005069
546 Ga0070690_100240418
547 Ga0070690_100316567
548 Ga0070670_100015147
549 Ga0070670_100025770
550 Ga0070670_100140037
551 Ga0070677_10001817
552 Ga0070677_10042907
553 Ga0068869_100132058
554 Ga0068869_100218402
555 Ga0070666_10007897
556 Ga0070666_10010958
557 Ga0070666_10070155
558 Ga0070680_100228128
559 Ga0070660_100386709
560 Ga0070689_100008281
561 Ga0070689_100188965
562 Ga0070687_100089063
563 Ga0070687_100112125
564 Ga0070661_100083105
565 Ga0070668_100014243
566 Ga0070669_100001320
567 Ga0070669_100031473
568 Ga0070669_100050823
569 Ga0070675_100001103
570 Ga0070675_100025428
571 Ga0070675_100028614
572 Ga0070675_100063715
573 Ga0070675_100107174
574 Ga0070675_100128752
575 Ga0070674_100000189
576 Ga0070673_100001241
577 Ga0070673_100006233
578 Ga0070673_100109397
579 Ga0070673_100155342
580 Ga0070688_100026687
581 Ga0070659_100186392
582 Ga0070667_100005812
583 Ga0070667_100015804
584 Ga0070667_100277377
585 Ga0070709_10121049
586 Ga0070713_100027228
587 Ga0070713_100174248
588 Ga0070701_10007017
589 Ga0070705_100350573
590 Ga0070700_100016679
591 Ga0070700_100067492
592 Ga0070700_100325268
593 Ga0070708_100199477
594 Ga0070663_100376889
595 Ga0070663_100397176
596 Ga0070678_100032883
597 Ga0070678_100037940
598 Ga0070662_100061803
599 Ga0070662_100097466
600 Ga0068867_100017884
601 Ga0068867_100349452
602 Ga0070685_10005371
603 Ga0070685_10008955
604 Ga0070685_10123133
605 Ga0070707_100009565
606 Ga0070707_100364414
607 Ga0070698_100088624
608 Ga0070684_100529177
609 Ga0070697_100376096
610 Ga0070672_100004261
611 Ga0070672_100008283
612 Ga0070672_100221018
613 Ga0070672_100235639
614 Ga0070686_100033148
615 Ga0070686_100080546
616 Ga0070686_100107814
617 Ga0070696_100191278
618 Ga0070693_100148759
619 Ga0070665_100058226
620 Ga0070665_100092012
621 Ga0070704_100065539
622 Ga0070704_100073238
623 Ga0070664_100017683
624 Ga0070664_100069425
625 Ga0070664_100092880
626 Ga0070664_100534882
627 Ga0068857_100157114
628 Ga0068857_100324568
629 Ga0068857_100386295
630 Ga0070702_100027908
631 Ga0070702_100036736
632 Ga0068852_100119938
633 Ga0068859_100003531
634 Ga0068859_100056684
635 Ga0068859_100145560
636 Ga0068859_100243252
637 Ga0068864_100011943
638 Ga0068864_100014849
639 Ga0068866_10395773
640 Ga0068861_100009437
641 Ga0068861_100011141
642 Ga0068861_100106660
643 Ga0068861_100178908
644 Ga0068870_10000313
645 Ga0068870_10296538
646 Ga0068863_100000478
647 Ga0068863_100054059
648 Ga0068863_100129614
649 Ga0068863_100144885
650 Ga0068863_100208961
651 Ga0068863_100445670
652 Ga0068858_100004643
653 Ga0068858_100010368
654 Ga0068858_100051292
655 Ga0068860_100002833
656 Ga0068860_100067837
657 Ga0068860_100305378
658 Ga0068862_100003841
659 Ga0068862_100197137
660 Ga0068862_100468778
661 Ga0081539_10000163
662 Ga0081539_10001355
663 Ga0081539_10002106
664 Ga0097621_100001051
665 Ga0097621_100014381
666 Ga0097621_100015980
667 Ga0097621_100018431
668 Ga0097621_100025993
669 Ga0097621_100280107
670 Ga0097621_100592791
671 Ga0068871_100001105
672 Ga0068871_100001880
673 Ga0068871_100046186
674 Ga0068871_100079188
675 Ga0068871_100086544
676 Ga0068871_100091443
677 Ga0068871_100230056
678 Ga0068871_100422420
679 Ga0075428_100007683
680 Ga0075428_100038076
681 Ga0075428_100197739
682 Ga0075428_100199251
683 Ga0075428_100348965
684 Ga0075430_100000271
685 Ga0075430_100067592
686 Ga0075430_100107225
687 Ga0075430_100278666
688 Ga0075431_100014800
689 Ga0075431_100067492
690 Ga0075431_100143611
691 Ga0075431_100212049
692 Ga0075431_100400249
693 Ga0075431_100569752
694 Ga0075433_10008899
695 Ga0075433_10022169
696 Ga0075433_10039169
697 Ga0075433_10294360
698 Ga0075434_100009387
699 Ga0075434_100010150
700 Ga0075434_100018260
701 Ga0075434_100043245
702 Ga0075434_100127000
703 Ga0075434_100160358
704 Ga0075434_100464375
705 Ga0075434_100495824
706 Ga0075429_100027056
707 Ga0075429_100098901
708 Ga0075429_100101372
709 Ga0075429_100173790
710 Ga0075429_100261018
711 Ga0075429_100409980
712 Ga0068865_100312997
713 Ga0068865_100488255
714 Ga0068865_100628351
715 Ga0075436_100334287
716 Ga0097620_100003531
717 Ga0097620_100056683
718 Ga0097620_100145550
719 Ga0097620_100243253
720 Ga0075435_100003860
721 Ga0105240_10376834
722 Ga0111539_10000121
723 Ga0111539_10001142
724 Ga0111539_10005854
725 Ga0111539_10011687
726 Ga0111539_10030938
727 Ga0111539_10052251
728 Ga0111539_10350131
729 Ga0111539_10528130
730 Ga0105245_10002814
731 Ga0105247_10032884
732 Ga0105247_10144828
733 Ga0105247_10236428
734 Ga0114129_10001413
735 Ga0114129_10026428
736 Ga0114129_10107953
737 Ga0114129_10143826
738 Ga0114129_10145670
739 Ga0114129_10146962
740 Ga0114129_10160562
741 Ga0114129_10826788
742 Ga0105243_10121224
743 Ga0105242_10007847
744 Ga0105242_10613151
745 Ga0105242_10752180
746 Ga0105242_10862634
747 Ga0105248_10004819
748 Ga0105248_10045136
749 Ga0105248_10290936
750 Ga0105248_10296035
751 Ga0105238_10862269
752 Ga0105249_10018336
753 Ga0105249_10189912
754 Ga0105249_10607643
755 Ga0105246_10039605
756 Ga0105246_10600708
757 Ga0157374_10024743
758 Ga0157374_10143229
759 Ga0157378_10012221
760 Ga0157378_10297004
761 Ga0163162_10042215
762 Ga0163162_10053752
763 Ga0163162_10076631
764 Ga0163162_10162042
765 Ga0157375_10000105
766 Ga0163163_10034168
767 Ga0163163_10046112
768 Ga0163163_10793528
769 Ga0157380_10003118
770 Ga0157380_10004086
771 Ga0157380_10131658
772 Ga0157380_10341130
773 Ga0157380_10703434
774 Ga0157377_10070783
775 Ga0157377_10079360
776 Ga0157379_10000223
777 Ga0157379_10025570
778 Ga0157379_10038284
779 Ga0157379_10133743
780 Ga0157376_10016977
781 Ga0157376_10025287
782 Ga0157376_10165311
783 Ga0157376_10188924
784 Ga0157376_10214224
785 Ga0163161_10017881
786 Ga0163161_10044066
787 Ga0207697_10009997
788 Ga0207697_10063825
789 Ga0207682_10004256
790 Ga0207682_10010403
791 Ga0207710_10054678
792 Ga0207710_10075103
793 Ga0207710_10123778
794 Ga0207688_10088357
795 Ga0207688_10207358
796 Ga0207680_10022962
797 Ga0207680_10238311
798 Ga0207680_10412268
799 Ga0207699_10038653
800 Ga0207645_10003652
801 Ga0207645_10004725
802 Ga0207645_10270186
803 Ga0207643_10000504
804 Ga0207643_10012474
805 Ga0207663_10021169
806 Ga0207660_10228362
807 Ga0207662_10004610
808 Ga0207649_10154885
809 Ga0207646_10005607
810 Ga0207681_10029758
811 Ga0207681_10062973
812 Ga0207681_10106188
813 Ga0207694_10055262
814 Ga0207650_10058565
815 Ga0207650_10119419
816 Ga0207650_10170118
817 Ga0207659_10000253
818 Ga0207659_10018202
819 Ga0207659_10033154
820 Ga0207659_10071680
821 Ga0207659_10375096
822 Ga0207687_10096937
823 Ga0207700_10070327
824 Ga0207706_10046232
825 Ga0207706_10213064
826 Ga0207706_10289985
827 Ga0207686_10037191
828 Ga0207686_10139152
829 Ga0207709_10058547
830 Ga0207670_10143046
831 Ga0207669_10013987
832 Ga0207669_10496564
833 Ga0207704_10043658
834 Ga0207704_10146610
835 Ga0207704_10591419
836 Ga0207665_10401346
837 Ga0207691_10001339
838 Ga0207691_10017587
839 Ga0207691_10130764
840 Ga0207691_10538484
841 Ga0207711_10003803
842 Ga0207711_10012844
843 Ga0207711_10055686
844 Ga0207711_10159708
845 Ga0207689_10282491
846 Ga0207661_10415905
847 Ga0207679_10008079
848 Ga0207679_10049539
849 Ga0207679_10127539
850 Ga0207679_10227855
851 Ga0207651_10009211
852 Ga0207651_10037316
853 Ga0207651_10121270
854 Ga0207712_10017166
855 Ga0207712_10258876
856 Ga0207658_10067553
857 Ga0207677_10012533
858 Ga0207677_10030647
859 Ga0207703_10032803
860 Ga0207703_10089916
861 Ga0207678_10679593
862 Ga0207708_10005313
863 Ga0207708_10014264
864 Ga0207708_10072671
865 Ga0207708_10086347
866 Ga0207641_10002415
867 Ga0207641_10069946
868 Ga0207641_10102413
869 Ga0207641_10303600
870 Ga0207648_10016050
871 Ga0207648_10031782
872 Ga0207648_10119136
873 Ga0207648_10119550
874 Ga0207648_10161877
875 Ga0207676_10047362
876 Ga0207676_10354960
877 Ga0207674_10042180
878 Ga0207674_10126769
879 Ga0207674_10254560
880 Ga0207674_10288631
881 Ga0207675_100005257
882 Ga0207675_100006040
883 Ga0207675_100102152
884 Ga0207675_100109596
885 Ga0207675_100370630
886 Ga0207683_10050990
887 Ga0207683_10056317
888 Ga0207683_10266241
889 Ga0207683_10272514
890 Ga0207698_10073990
891 Ga0209974_10015171
892 Ga0209974_10021239
893 Ga0207428_10001221
894 Ga0207428_10002827
895 Ga0207428_10003876
896 Ga0207428_10087200
897 Ga0207428_10100431
898 Ga0268266_10138661
899 Ga0268265_10003277
900 Ga0268265_10007800
901 Ga0268265_10210666
902 Ga0268265_10447747
903 Ga0268264_10005571
904 Ga0268264_10032026
905 Ga0268264_10169665
906 Ga0265314_10177038
907 Ga0307405_10074857
908 Ga0307405_10244971
909 Ga0307413_10277518
910 Ga0307410_10427278
911 Ga0307409_100750916
912 Ga0307416_100169311
913 Ga0307416_100452924
914 Ga0307416_100480089
915 Ga0307414_10394642
916 Ga0373926_0046224
917 Ga0373932_0011145
918 Ga0373936_0030601
919 Ga0373939_0107964
920 Ga0373956_0123277
921 Ga0373943_0064564
922 Ga0373955_0091694
923 Ga0373955_0295744
924 Ga0373924_0003476
925 Ga0373931_0178097
926 Ga0373931_0295454
927 Ga0373935_0044731
928 Ga0373927_0192555
929 Ga0373933_0021871
930 Ga0373933_0250695
931 Ga0373925_0183126
932 Ga0439453_0012362
933 Ga0439453_0017036
934 Ga0451576_0006647
935 Ga0495592_0062262
936 Ga0495603_0274685
937 Ga0495580_0052601
938 Ga0495582_0203516
939 Ga0495639_0030826
940 Ga0495594_0133393
941 Ga0495608_0003518
942 Ga0495608_0237094
943 Ga0495630_0004051
944 Ga0495630_0380019
945 Ga0495643_0002930
946 Ga0495652_0303568
947 Ga0495598_0015443
948 Ga0495598_0030619
949 Ga0495621_0066969
950 Ga0495667_0119908
951 Ga0495634_0135773
952 Ga0495658_0046623
953 Ga0495613_0000330
954 Ga0495600_0115791
955 Ga0495604_0015570
956 Ga0495674_0028928
957 Ga0495674_0391610
958 Ga0495684_0000953
959 Ga0496100_0008160
960 Ga0496101_0000950
961 Ga0496102_0100541
962 Ga0496104_0137950
963 Ga0496106_0158627
964 Ga0496107_0031929
965 Ga0496108_0174633
966 Ga0496108_0243974
967 Ga0496109_0282717
968 Ga0496109_0343971
969 Ga0496112_0057864
970 Ga0496114_0319851
971 Ga0496114_0329765
972 Ga0496115_0134045
973 Ga0496115_0377664
974 Ga0501032_0314219
975 Ga0501033_0161788
976 Ga0501038_0026032
977 Ga0501038_0361332
978 Ga0501040_0001950
979 Ga0501040_0065253
980 Ga0501041_0008557
981 Ga0501042_0028583
982 Ga0501042_0047647
983 Ga0501042_0193667
984 Ga0501042_0298128
985 Ga0501043_0256441
986 Ga0501046_0011763
987 Ga0501046_0190884
988 Ga0501048_0077970
989 Ga0501068_0154972
990 Ga0501071_0009322
991 Ga0501071_0268510
992 Ga0501071_0582968
993 Ga0501072_0017653
994 Ga0501074_0012397
995 Ga0501075_0000806
996 Ga0501075_0191840
997 Ga0501076_0020335
998 Ga0501076_0052625
999 Ga0501077_0014784
1000 Ga0501079_0216560
1001 Ga0501079_0390269
1002 Ga0501081_0000676
1003 Ga0501081_0369626
1004 Ga0501081_0416959
1005 Ga0501283_035925
1006 Ga0501035_0342761
1007 Ga0501045_0003631
1008 Ga0501045_0321917
1009 nmdc:mga05p37_148272_c1
1010 nmdc:mga05p37_162540_c1
1011 nmdc:mga05p37_218382_c1
1012 nmdc:mga05p37_28113_c2
1013 nmdc:mga05p37_294959_c1
1014 nmdc:mga05p37_403764_c1
1015 nmdc:mga05p37_421517_c1
1016 nmdc:mga09592_14936_c1
1017 nmdc:mga09592_198718_c1
1018 nmdc:mga09592_234901_c1
1019 nmdc:mga09592_47515_c1
1020 nmdc:mga09592_643814_c1
1021 nmdc:mga09592_72050_c1
1022 nmdc:mga09592_92764_c1
1023 nmdc:mga0qj67_110502_c1
1024 nmdc:mga0qj67_218446_c1
1025 nmdc:mga0qj67_286083_c1
1026 nmdc:mga0qj67_304_c1
1027 nmdc:mga0qj67_31944_c1
1028 nmdc:mga06r32_10601_c1
1029 nmdc:mga06r32_390668_c1
1030 nmdc:mga06r32_488058_c1
1031 nmdc:mga06r32_575302_c1
1032 nmdc:mga08y16_183_c1
1033 nmdc:mga08y16_186895_c1
1034 nmdc:mga08y16_30569_c1
1035 nmdc:mga08y16_3388_c1
1036 nmdc:mga08y16_67568_c1
1037 nmdc:mga08y16_80750_c1
1038 nmdc:mga0n895_233888_c1
1039 nmdc:mga0n895_31372_c1
1040 nmdc:mga0n895_36228_c1
1041 nmdc:mga0n895_3785_c1
1042 nmdc:mga0n895_5531_c1
1043 nmdc:mga0n895_67972_c1
1044 nmdc:mga0rr50_10481_c1
1045 nmdc:mga0rr50_390741_c1
1046 nmdc:mga0rr50_78162_c1
1047 nmdc:mga0a205_17413_c1
1048 nmdc:mga0a205_1793_c1
1049 nmdc:mga0a205_225106_c1
1050 nmdc:mga0a205_46998_c1
1051 Ga0495601_0067791
1052 Ga0495619_0001339
1053 Ga0495619_0218183
1054 Ga0501084_0029369
1055 Ga0501084_0032528
1056 Ga0501084_0466057
1057 Ga0501082_0007764
1058 Ga0530510_0020224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17645

Amdase

Arylmalonate decarboxylase

49

276

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vlb-assembly2.cif.gz_B structure of unliganded arylmalonate decarboxylase 0.9508 31 261
3eis-assembly1.cif.gz_A crystal structure of arylmalonate decarboxylase 0.9435 31 264
3dtv-assembly5.cif.gz_A crystal structure of arylmalonate decarboxylase 0.9412 31 264
3eis-assembly1.cif.gz_A crystal structure of arylmalonate decarboxylase 0.9394 31 264
2vlb-assembly2.cif.gz_B structure of unliganded arylmalonate decarboxylase 0.9381 31 261
ID Description Score Start End Superfamily
2vlbD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9274 31 264 3.40.50.12500
2vlbD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9196 31 264 3.40.50.12500
4ix1F00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8787 30 264 3.40.50.12500
4fq5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8631 31 263 3.40.50.12500
2xecC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.861 31 264 3.40.50.12500
ID Description Score Start End GO Terms
AF-A0A1Q8B3W5-F1-model_v4 Arylmalonate decarboxylase 0.9719 26 264
AF-A0A2V8IGN8-F1-model_v4 Arylmalonate decarboxylase 0.9699 40 264
AF-A0A2V8IGN8-F1-model_v4 Arylmalonate decarboxylase 0.9656 40 264
AF-A0A1Q8B3W5-F1-model_v4 Arylmalonate decarboxylase 0.964 26 264
AF-A0A4R5V628-F1-model_v4 Arylmalonate decarboxylase 0.9506 31 262

Map