F459796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 289 | 529 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300006914|Ga0075436_101335070|Ga0075436_1013350702 |
| Length | 108 |
| Sequence | MADVNYIDWHVHPFRSDRWLEIWRPALDRALAFGARSCYLTRDIDDPLHFRQVSVWDDHADFERYWYSDEIAAQREALQGYFNVPVLPEFYEIVGEGRALSLAPEEPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 189 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 192 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.91 |
| Nodule | 0 |
| Rhizoplane | 8.32 |
| Rhizosphere | 85.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1011488 | 3300000532 | Bacteria | 599 |
| 2 | JGI24743J22301_10096452 | 3300001991 | Bacteria | 634 |
| 3 | JGI24751J29686_10026942 | 3300002459 | Bacteria | 1193 |
| 4 | JGI25404J52841_10021990 | 3300003659 | Bacteria | 1380 |
| 5 | Ga0070658_10190259 | 3300005327 | Bacteria | 1730 |
| 6 | Ga0070683_100016350 | 3300005329 | Bacteria | 6542 |
| 7 | Ga0070683_100071230 | 3300005329 | Bacteria | 3243 |
| 8 | Ga0070683_100444286 | 3300005329 | Unclassified | 1237 |
| 9 | Ga0070683_101328676 | 3300005329 | Bacteria | 691 |
| 10 | Ga0070690_100133061 | 3300005330 | Bacteria | 1681 |
| 11 | Ga0070690_101252185 | 3300005330 | Unclassified | 593 |
| 12 | Ga0070670_100149841 | 3300005331 | Unclassified | 2019 |
| 13 | Ga0068869_102146520 | 3300005334 | Unclassified | 502 |
| 14 | Ga0070680_100413928 | 3300005336 | Bacteria | 1150 |
| 15 | Ga0070682_100000150 | 3300005337 | Bacteria | 55238 |
| 16 | Ga0070682_100073609 | 3300005337 | Bacteria | 2192 |
| 17 | Ga0068868_100000450 | 3300005338 | Bacteria | 27515 |
| 18 | Ga0068868_100002756 | 3300005338 | Bacteria | 12165 |
| 19 | Ga0068868_100729135 | 3300005338 | Bacteria | 889 |
| 20 | Ga0068868_101674955 | 3300005338 | Bacteria | 599 |
| 21 | Ga0070660_100207563 | 3300005339 | Bacteria | 1590 |
| 22 | Ga0070689_100747599 | 3300005340 | Bacteria | 857 |
| 23 | Ga0070687_100203649 | 3300005343 | Unclassified | 1201 |
| 24 | Ga0070687_100449919 | 3300005343 | Bacteria | 856 |
| 25 | Ga0070661_100000102 | 3300005344 | Bacteria | 69941 |
| 26 | Ga0070692_10044881 | 3300005345 | Bacteria | 2279 |
| 27 | Ga0070668_100031876 | 3300005347 | Bacteria | 4011 |
| 28 | Ga0070668_100203778 | 3300005347 | Bacteria | 1625 |
| 29 | Ga0070668_100497236 | 3300005347 | Bacteria | 1055 |
| 30 | Ga0070668_101320920 | 3300005347 | Unclassified | 656 |
| 31 | Ga0070669_101232365 | 3300005353 | Bacteria | 647 |
| 32 | Ga0070675_100000027 | 3300005354 | Bacteria | 106172 |
| 33 | Ga0070674_100092136 | 3300005356 | Bacteria | 2190 |
| 34 | Ga0070674_100857662 | 3300005356 | Bacteria | 788 |
| 35 | Ga0070674_101169558 | 3300005356 | Bacteria | 682 |
| 36 | Ga0070673_100291921 | 3300005364 | Bacteria | 1433 |
| 37 | Ga0070673_100812492 | 3300005364 | Bacteria | 864 |
| 38 | Ga0070688_100001250 | 3300005365 | Bacteria | 12681 |
| 39 | Ga0070688_100001531 | 3300005365 | Bacteria | 11553 |
| 40 | Ga0070688_100323861 | 3300005365 | Bacteria | 1121 |
| 41 | Ga0070688_100587882 | 3300005365 | Bacteria | 851 |
| 42 | Ga0070659_100119409 | 3300005366 | Bacteria | 2134 |
| 43 | Ga0070659_101071206 | 3300005366 | Bacteria | 710 |
| 44 | Ga0070667_100006185 | 3300005367 | Bacteria | 9957 |
| 45 | Ga0070667_100167082 | 3300005367 | Bacteria | 1941 |
| 46 | Ga0070714_100090319 | 3300005435 | Bacteria | 2682 |
| 47 | Ga0070713_100000085 | 3300005436 | Bacteria | 58902 |
| 48 | Ga0070701_10440854 | 3300005438 | Bacteria | 834 |
| 49 | Ga0070701_10468127 | 3300005438 | Bacteria | 812 |
| 50 | Ga0070701_10857506 | 3300005438 | Unclassified | 624 |
| 51 | Ga0070711_100003742 | 3300005439 | Bacteria | 8920 |
| 52 | Ga0070705_100502191 | 3300005440 | Unclassified | 921 |
| 53 | Ga0070700_100229234 | 3300005441 | Bacteria | 1321 |
| 54 | Ga0070700_100659437 | 3300005441 | Unclassified | 827 |
| 55 | Ga0070694_100672458 | 3300005444 | Bacteria | 840 |
| 56 | Ga0070694_100941252 | 3300005444 | Bacteria | 715 |
| 57 | Ga0070708_101900548 | 3300005445 | Bacteria | 552 |
| 58 | Ga0070663_100824965 | 3300005455 | Bacteria | 797 |
| 59 | Ga0070663_101859017 | 3300005455 | Unclassified | 540 |
| 60 | Ga0070678_100025174 | 3300005456 | Bacteria | 3999 |
| 61 | Ga0070678_100096103 | 3300005456 | Bacteria | 2285 |
| 62 | Ga0070678_100187127 | 3300005456 | Bacteria | 1700 |
| 63 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 64 | Ga0070662_101357189 | 3300005457 | Bacteria | 612 |
| 65 | Ga0070681_10579294 | 3300005458 | Unclassified | 1036 |
| 66 | Ga0068867_100528839 | 3300005459 | Bacteria | 1018 |
| 67 | Ga0068867_100892607 | 3300005459 | Bacteria | 799 |
| 68 | Ga0070685_10001410 | 3300005466 | Bacteria | 12591 |
| 69 | Ga0070685_10001719 | 3300005466 | Bacteria | 11497 |
| 70 | Ga0070685_10128981 | 3300005466 | Bacteria | 1579 |
| 71 | Ga0070685_11453797 | 3300005466 | Bacteria | 527 |
| 72 | Ga0070706_101720280 | 3300005467 | Bacteria | 571 |
| 73 | Ga0070707_100644243 | 3300005468 | Bacteria | 1022 |
| 74 | Ga0070684_100024292 | 3300005535 | Bacteria | 5082 |
| 75 | Ga0070684_100156085 | 3300005535 | Bacteria | 2069 |
| 76 | Ga0070684_100430015 | 3300005535 | Unclassified | 1219 |
| 77 | Ga0068853_100283811 | 3300005539 | Bacteria | 1526 |
| 78 | Ga0070686_100157757 | 3300005544 | Bacteria | 1595 |
| 79 | Ga0070695_100320435 | 3300005545 | Bacteria | 1152 |
| 80 | Ga0070696_100310799 | 3300005546 | Bacteria | 1210 |
| 81 | Ga0070693_100004573 | 3300005547 | Bacteria | 6563 |
| 82 | Ga0070665_100039235 | 3300005548 | Bacteria | 4762 |
| 83 | Ga0070665_100177505 | 3300005548 | Bacteria | 2131 |
| 84 | Ga0070665_100440390 | 3300005548 | Bacteria | 1312 |
| 85 | Ga0070704_100118890 | 3300005549 | Bacteria | 2025 |
| 86 | Ga0070704_102191011 | 3300005549 | Unclassified | 514 |
| 87 | Ga0070664_100224234 | 3300005564 | Bacteria | 1682 |
| 88 | Ga0068857_100055196 | 3300005577 | Bacteria | 3526 |
| 89 | Ga0068854_100000156 | 3300005578 | Bacteria | 46593 |
| 90 | Ga0068854_100850248 | 3300005578 | Bacteria | 799 |
| 91 | Ga0068856_100008468 | 3300005614 | Bacteria | 10010 |
| 92 | Ga0068856_100166410 | 3300005614 | Bacteria | 2216 |
| 93 | Ga0068852_100000006 | 3300005616 | Bacteria | 159569 |
| 94 | Ga0068852_100173873 | 3300005616 | Bacteria | 2021 |
| 95 | Ga0068852_100432959 | 3300005616 | Bacteria | 1299 |
| 96 | Ga0068864_100000053 | 3300005618 | Bacteria | 133049 |
| 97 | Ga0068866_10104193 | 3300005718 | Bacteria | 1571 |
| 98 | Ga0068866_10252856 | 3300005718 | Bacteria | 1079 |
| 99 | Ga0068851_10001568 | 3300005834 | Bacteria | 10036 |
| 100 | Ga0068851_10277035 | 3300005834 | Unclassified | 958 |
| 101 | Ga0068870_10274147 | 3300005840 | Bacteria | 1055 |
| 102 | Ga0068870_10669180 | 3300005840 | Bacteria | 713 |
| 103 | Ga0068863_100013897 | 3300005841 | Bacteria | 7763 |
| 104 | Ga0068863_101116738 | 3300005841 | Unclassified | 793 |
| 105 | Ga0068858_100133034 | 3300005842 | Bacteria | 2333 |
| 106 | Ga0068858_100848521 | 3300005842 | Bacteria | 892 |
| 107 | Ga0068860_100099968 | 3300005843 | Bacteria | 2767 |
| 108 | Ga0068860_100213711 | 3300005843 | Bacteria | 1871 |
| 109 | Ga0068862_100000050 | 3300005844 | Bacteria | 145502 |
| 110 | Ga0068862_101871538 | 3300005844 | Unclassified | 610 |
| 111 | Ga0081455_10015768 | 3300005937 | Bacteria | 7320 |
| 112 | Ga0081455_10126014 | 3300005937 | Bacteria | 2010 |
| 113 | Ga0081538_10259574 | 3300005981 | Bacteria | 657 |
| 114 | Ga0081540_1000163 | 3300005983 | Bacteria | 68955 |
| 115 | Ga0075365_10000254 | 3300006038 | Bacteria | 18312 |
| 116 | Ga0075365_10009768 | 3300006038 | Bacteria | 5543 |
| 117 | Ga0075365_10011771 | 3300006038 | Bacteria | 5160 |
| 118 | Ga0075365_10209183 | 3300006038 | Bacteria | 1367 |
| 119 | Ga0075365_10565614 | 3300006038 | Bacteria | 804 |
| 120 | Ga0075368_10143636 | 3300006042 | Bacteria | 995 |
| 121 | Ga0075368_10308826 | 3300006042 | Bacteria | 683 |
| 122 | Ga0075363_100206608 | 3300006048 | Bacteria | 1123 |
| 123 | Ga0075363_101000489 | 3300006048 | Unclassified | 515 |
| 124 | Ga0075364_10048139 | 3300006051 | Bacteria | 2778 |
| 125 | Ga0075364_10073425 | 3300006051 | Bacteria | 2255 |
| 126 | Ga0070715_10090788 | 3300006163 | Bacteria | 1405 |
| 127 | Ga0070712_100128331 | 3300006175 | Bacteria | 1919 |
| 128 | Ga0075367_10171417 | 3300006178 | Bacteria | 1352 |
| 129 | Ga0075367_10736944 | 3300006178 | Bacteria | 627 |
| 130 | Ga0097621_101384106 | 3300006237 | Bacteria | 666 |
| 131 | Ga0068871_100486996 | 3300006358 | Unclassified | 1110 |
| 132 | Ga0075428_100031418 | 3300006844 | Bacteria | 5870 |
| 133 | Ga0075430_100280718 | 3300006846 | Bacteria | 1378 |
| 134 | Ga0075430_100923773 | 3300006846 | Unclassified | 719 |
| 135 | Ga0075431_100001567 | 3300006847 | Bacteria | 21238 |
| 136 | Ga0075431_101320141 | 3300006847 | Bacteria | 682 |
| 137 | Ga0075433_10014351 | 3300006852 | Bacteria | 6471 |
| 138 | Ga0075433_10111759 | 3300006852 | Archaea | 2424 |
| 139 | Ga0075434_100001678 | 3300006871 | Bacteria | 18909 |
| 140 | Ga0075434_100030706 | 3300006871 | Bacteria | 5293 |
| 141 | Ga0068865_100000023 | 3300006881 | Bacteria | 100785 |
| 142 | Ga0068865_100059820 | 3300006881 | Bacteria | 2666 |
| 143 | Ga0075436_101335070 | 3300006914 | Bacteria | 543 |
| 144 | Ga0075435_100460636 | 3300007076 | Bacteria | 1097 |
| 145 | Ga0075435_100779849 | 3300007076 | Bacteria | 832 |
| 146 | Ga0105240_10517701 | 3300009093 | Bacteria | 1324 |
| 147 | Ga0105240_11104890 | 3300009093 | Unclassified | 843 |
| 148 | Ga0111539_10005066 | 3300009094 | Bacteria | 17115 |
| 149 | Ga0111539_10300546 | 3300009094 | Bacteria | 1868 |
| 150 | Ga0111539_12124471 | 3300009094 | Unclassified | 651 |
| 151 | Ga0105245_10000254 | 3300009098 | Bacteria | 50918 |
| 152 | Ga0105245_10011357 | 3300009098 | Bacteria | 7756 |
| 153 | Ga0105245_10261871 | 3300009098 | Bacteria | 1683 |
| 154 | Ga0105245_10770683 | 3300009098 | Bacteria | 999 |
| 155 | Ga0105245_10787908 | 3300009098 | Bacteria | 988 |
| 156 | Ga0114129_10006865 | 3300009147 | Bacteria | 16187 |
| 157 | Ga0114129_10740223 | 3300009147 | Bacteria | 1259 |
| 158 | Ga0114129_11577306 | 3300009147 | Bacteria | 804 |
| 159 | Ga0105243_10162820 | 3300009148 | Bacteria | 1925 |
| 160 | Ga0105243_10287503 | 3300009148 | Bacteria | 1484 |
| 161 | Ga0105243_11951245 | 3300009148 | Unclassified | 621 |
| 162 | Ga0105241_10052214 | 3300009174 | Bacteria | 3120 |
| 163 | Ga0105242_10000032 | 3300009176 | Bacteria | 98198 |
| 164 | Ga0105242_11802106 | 3300009176 | Bacteria | 650 |
| 165 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 166 | Ga0105248_10359559 | 3300009177 | Bacteria | 1639 |
| 167 | Ga0105238_11268020 | 3300009551 | Bacteria | 762 |
| 168 | Ga0105249_10118734 | 3300009553 | Bacteria | 2511 |
| 169 | Ga0105249_10140910 | 3300009553 | Bacteria | 2312 |
| 170 | Ga0105249_11329598 | 3300009553 | Bacteria | 790 |
| 171 | Ga0105249_11635343 | 3300009553 | Bacteria | 717 |
| 172 | Ga0105239_10268371 | 3300010375 | Bacteria | 1919 |
| 173 | Ga0105239_10610284 | 3300010375 | Bacteria | 1245 |
| 174 | Ga0105239_10729858 | 3300010375 | Bacteria | 1133 |
| 175 | Ga0105239_13428268 | 3300010375 | Bacteria | 516 |
| 176 | Ga0157342_1016405 | 3300012507 | Bacteria | 819 |
| 177 | Ga0157371_10004749 | 3300013102 | Bacteria | 11723 |
| 178 | Ga0157370_10023676 | 3300013104 | Bacteria | 6094 |
| 179 | Ga0157370_10141010 | 3300013104 | Unclassified | 2246 |
| 180 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 181 | Ga0157369_11623048 | 3300013105 | Unclassified | 657 |
| 182 | Ga0157374_10308513 | 3300013296 | Bacteria | 1566 |
| 183 | Ga0157374_10727882 | 3300013296 | Bacteria | 1006 |
| 184 | Ga0157378_10005986 | 3300013297 | Bacteria | 10663 |
| 185 | Ga0157378_10030467 | 3300013297 | Bacteria | 4768 |
| 186 | Ga0157378_10238950 | 3300013297 | Bacteria | 1735 |
| 187 | Ga0157378_10749058 | 3300013297 | Bacteria | 1000 |
| 188 | Ga0157378_12450227 | 3300013297 | Unclassified | 574 |
| 189 | Ga0163162_10150512 | 3300013306 | Bacteria | 2444 |
| 190 | Ga0163162_10672328 | 3300013306 | Bacteria | 1158 |
| 191 | Ga0157372_10000112 | 3300013307 | Bacteria | 85902 |
| 192 | Ga0157372_10515980 | 3300013307 | Bacteria | 1393 |
| 193 | Ga0157375_10101600 | 3300013308 | Bacteria | 2959 |
| 194 | Ga0157375_10706131 | 3300013308 | Bacteria | 1162 |
| 195 | Ga0163163_11307028 | 3300014325 | Bacteria | 787 |
| 196 | Ga0163163_11956392 | 3300014325 | Bacteria | 646 |
| 197 | Ga0157380_10000091 | 3300014326 | Bacteria | 49188 |
| 198 | Ga0157380_10477609 | 3300014326 | Bacteria | 1205 |
| 199 | Ga0157377_11493300 | 3300014745 | Bacteria | 537 |
| 200 | Ga0157379_10031097 | 3300014968 | Bacteria | 4757 |
| 201 | Ga0157379_10068023 | 3300014968 | Bacteria | 3184 |
| 202 | Ga0157379_10581618 | 3300014968 | Bacteria | 1044 |
| 203 | Ga0157376_12911503 | 3300014969 | Unclassified | 518 |
| 204 | Ga0206356_10199296 | 3300020070 | Bacteria | 1213 |
| 205 | Ga0224712_10038893 | 3300022467 | Bacteria | 1780 |
| 206 | Ga0207656_10000385 | 3300025321 | Bacteria | 14857 |
| 207 | Ga0207656_10187978 | 3300025321 | Unclassified | 994 |
| 208 | Ga0207642_10078160 | 3300025899 | Bacteria | 1598 |
| 209 | Ga0207688_10144741 | 3300025901 | Bacteria | 1400 |
| 210 | Ga0207688_10275190 | 3300025901 | Bacteria | 1025 |
| 211 | Ga0207685_10212719 | 3300025905 | Bacteria | 915 |
| 212 | Ga0207645_10525397 | 3300025907 | Bacteria | 802 |
| 213 | Ga0207643_10186047 | 3300025908 | Bacteria | 1259 |
| 214 | Ga0207705_10167133 | 3300025909 | Bacteria | 1655 |
| 215 | Ga0207654_10271036 | 3300025911 | Bacteria | 1145 |
| 216 | Ga0207695_10353802 | 3300025913 | Bacteria | 1355 |
| 217 | Ga0207695_10515603 | 3300025913 | Bacteria | 1077 |
| 218 | Ga0207693_10028297 | 3300025915 | Bacteria | 4428 |
| 219 | Ga0207693_10048890 | 3300025915 | Bacteria | 3321 |
| 220 | Ga0207663_10002370 | 3300025916 | Bacteria | 9051 |
| 221 | Ga0207662_10128755 | 3300025918 | Bacteria | 1594 |
| 222 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 223 | Ga0207649_10350271 | 3300025920 | Bacteria | 1093 |
| 224 | Ga0207681_11318969 | 3300025923 | Unclassified | 606 |
| 225 | Ga0207650_10130173 | 3300025925 | Unclassified | 1968 |
| 226 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 227 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 228 | Ga0207687_10052479 | 3300025927 | Bacteria | 2846 |
| 229 | Ga0207687_10082407 | 3300025927 | Bacteria | 2327 |
| 230 | Ga0207687_10694306 | 3300025927 | Bacteria | 863 |
| 231 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 232 | Ga0207664_10100280 | 3300025929 | Bacteria | 2391 |
| 233 | Ga0207690_10076663 | 3300025932 | Bacteria | 2322 |
| 234 | Ga0207690_10141963 | 3300025932 | Bacteria | 1771 |
| 235 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 236 | Ga0207706_11432935 | 3300025933 | Bacteria | 566 |
| 237 | Ga0207686_10000048 | 3300025934 | Bacteria | 115595 |
| 238 | Ga0207709_10093921 | 3300025935 | Bacteria | 1967 |
| 239 | Ga0207709_10404037 | 3300025935 | Bacteria | 1045 |
| 240 | Ga0207670_10996910 | 3300025936 | Bacteria | 705 |
| 241 | Ga0207669_10209009 | 3300025937 | Bacteria | 1423 |
| 242 | Ga0207704_10000159 | 3300025938 | Bacteria | 36005 |
| 243 | Ga0207704_10130732 | 3300025938 | Bacteria | 1738 |
| 244 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 245 | Ga0207661_10000253 | 3300025944 | Bacteria | 34627 |
| 246 | Ga0207661_10007822 | 3300025944 | Bacteria | 7613 |
| 247 | Ga0207661_10148671 | 3300025944 | Bacteria | 2023 |
| 248 | Ga0207679_10293740 | 3300025945 | Bacteria | 1398 |
| 249 | Ga0207651_10550904 | 3300025960 | Bacteria | 1003 |
| 250 | Ga0207712_10096320 | 3300025961 | Bacteria | 2190 |
| 251 | Ga0207712_10859340 | 3300025961 | Unclassified | 800 |
| 252 | Ga0207668_10019945 | 3300025972 | Bacteria | 4250 |
| 253 | Ga0207668_10027927 | 3300025972 | Bacteria | 3683 |
| 254 | Ga0207668_10045033 | 3300025972 | Bacteria | 3006 |
| 255 | Ga0207668_10409174 | 3300025972 | Bacteria | 1149 |
| 256 | Ga0207668_10460501 | 3300025972 | Bacteria | 1087 |
| 257 | Ga0207640_10000038 | 3300025981 | Bacteria | 108630 |
| 258 | Ga0207640_10404440 | 3300025981 | Bacteria | 1113 |
| 259 | Ga0207658_10013822 | 3300025986 | Bacteria | 5523 |
| 260 | Ga0207677_10000200 | 3300026023 | Bacteria | 48320 |
| 261 | Ga0207677_10001552 | 3300026023 | Bacteria | 12156 |
| 262 | Ga0207677_10039577 | 3300026023 | Bacteria | 3101 |
| 263 | Ga0207677_10972498 | 3300026023 | Bacteria | 768 |
| 264 | Ga0207677_11461843 | 3300026023 | Bacteria | 631 |
| 265 | Ga0207703_11322304 | 3300026035 | Unclassified | 693 |
| 266 | Ga0207639_10230174 | 3300026041 | Bacteria | 1606 |
| 267 | Ga0207678_10334328 | 3300026067 | Bacteria | 1304 |
| 268 | Ga0207708_10047844 | 3300026075 | Bacteria | 3255 |
| 269 | Ga0207708_10193019 | 3300026075 | Bacteria | 1622 |
| 270 | Ga0207708_12002187 | 3300026075 | Unclassified | 507 |
| 271 | Ga0207702_10000158 | 3300026078 | Bacteria | 79984 |
| 272 | Ga0207641_10005198 | 3300026088 | Bacteria | 11129 |
| 273 | Ga0207641_10703844 | 3300026088 | Unclassified | 995 |
| 274 | Ga0207648_10006385 | 3300026089 | Bacteria | 11717 |
| 275 | Ga0207648_10801368 | 3300026089 | Bacteria | 877 |
| 276 | Ga0207648_11083934 | 3300026089 | Bacteria | 751 |
| 277 | Ga0207676_10000195 | 3300026095 | Bacteria | 52951 |
| 278 | Ga0207674_10107055 | 3300026116 | Bacteria | 2773 |
| 279 | Ga0207683_10011741 | 3300026121 | Bacteria | 7475 |
| 280 | Ga0207683_10334641 | 3300026121 | Bacteria | 1388 |
| 281 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 282 | Ga0207698_10068043 | 3300026142 | Bacteria | 2811 |
| 283 | Ga0207698_10526067 | 3300026142 | Bacteria | 1155 |
| 284 | Ga0207698_10643432 | 3300026142 | Bacteria | 1050 |
| 285 | Ga0209813_10106604 | 3300027866 | Bacteria | 960 |
| 286 | Ga0207428_10053592 | 3300027907 | Bacteria | 3216 |
| 287 | Ga0268266_10009710 | 3300028379 | Bacteria | 8457 |
| 288 | Ga0268266_10113867 | 3300028379 | Bacteria | 2399 |
| 289 | Ga0268266_10626190 | 3300028379 | Bacteria | 1034 |
| 290 | Ga0268265_10001136 | 3300028380 | Bacteria | 23498 |
| 291 | Ga0268265_10726034 | 3300028380 | Unclassified | 962 |
| 292 | Ga0268264_10238155 | 3300028381 | Bacteria | 1684 |
| 293 | Ga0268264_11502190 | 3300028381 | Unclassified | 684 |
| 294 | Ga0268264_12015981 | 3300028381 | Bacteria | 586 |
| 295 | Ga0265337_1000807 | 3300028556 | Bacteria | 16498 |
| 296 | Ga0265326_10000252 | 3300028558 | Bacteria | 25133 |
| 297 | Ga0265319_1044415 | 3300028563 | Bacteria | 1489 |
| 298 | Ga0265334_10116393 | 3300028573 | Bacteria | 958 |
| 299 | Ga0265334_10283867 | 3300028573 | Bacteria | 568 |
| 300 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 301 | Ga0265336_10004887 | 3300028666 | Bacteria | 5023 |
| 302 | Ga0265338_10284399 | 3300028800 | Bacteria | 1207 |
| 303 | Ga0265324_10000498 | 3300029957 | Bacteria | 27248 |
| 304 | Ga0265332_10017744 | 3300031238 | Bacteria | 3141 |
| 305 | Ga0265328_10001094 | 3300031239 | Bacteria | 12441 |
| 306 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 307 | Ga0265329_10010170 | 3300031242 | Bacteria | 3470 |
| 308 | Ga0265339_10033137 | 3300031249 | Bacteria | 2911 |
| 309 | Ga0265331_10008961 | 3300031250 | Bacteria | 5655 |
| 310 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 311 | Ga0307408_100304669 | 3300031548 | Bacteria | 1336 |
| 312 | Ga0265314_10000062 | 3300031711 | Bacteria | 159496 |
| 313 | Ga0307415_100001241 | 3300032126 | Bacteria | 11977 |
| 314 | Ga0373943_0224989 | 3300035170 | Bacteria | 1046 |
| 315 | Ga0373961_0280663 | 3300035241 | Unclassified | 611 |
| 316 | Ga0316574_0035851 | 3300035398 | Bacteria | 3034 |
| 317 | Ga0373947_0862950 | 3300035725 | Bacteria | 618 |
| 318 | Ga0395899_0019253 | 3300037312 | Bacteria | 5188 |
| 319 | Ga0395899_0969220 | 3300037312 | Bacteria | 515 |
| 320 | Ga0395900_0240995 | 3300037418 | Bacteria | 1814 |
| 321 | Ga0395900_0325411 | 3300037418 | Unclassified | 1516 |
| 322 | Ga0395898_0001408 | 3300037466 | Bacteria | 34249 |
| 323 | Ga0395898_0178368 | 3300037466 | Bacteria | 2030 |
| 324 | Ga0395898_0759438 | 3300037466 | Unclassified | 911 |
| 325 | Ga0395898_1093279 | 3300037466 | Bacteria | 731 |
| 326 | Ga0395905_0013982 | 3300037471 | Bacteria | 7678 |
| 327 | Ga0395905_0149279 | 3300037471 | Bacteria | 2199 |
| 328 | Ga0395901_0004783 | 3300038443 | Bacteria | 13666 |
| 329 | Ga0395901_0200958 | 3300038443 | Bacteria | 2089 |
| 330 | Ga0395901_1530705 | 3300038443 | Unclassified | 622 |
| 331 | Ga0242420_039261 | 3300038996 | Bacteria | 901 |
| 332 | Ga0451804_0586164 | 3300041463 | Unclassified | 525 |
| 333 | Ga0451807_2276071 | 3300041486 | Bacteria | 1586 |
| 334 | Ga0451837_1359903 | 3300041494 | Bacteria | 651 |
| 335 | Ga0451855_0011574 | 3300041511 | Bacteria | 698 |
| 336 | Ga0451853_2385083 | 3300041512 | Bacteria | 1131 |
| 337 | Ga0466963_0006674 | 3300044694 | Bacteria | 6855 |
| 338 | Ga0466964_0249778 | 3300044706 | Bacteria | 874 |
| 339 | Ga0466957_0029121 | 3300044842 | Bacteria | 3292 |
| 340 | Ga0466957_0287140 | 3300044842 | Bacteria | 1102 |
| 341 | Ga0466958_0113749 | 3300045836 | Bacteria | 1690 |
| 342 | Ga0466967_0000009 | 3300045976 | Bacteria | 122610 |
| 343 | Ga0466967_0046799 | 3300045976 | Bacteria | 3768 |
| 344 | Ga0495592_0392807 | 3300046454 | Bacteria | 880 |
| 345 | Ga0495603_0000016 | 3300046455 | Bacteria | 67399 |
| 346 | Ga0495603_0117873 | 3300046455 | Bacteria | 1548 |
| 347 | Ga0495590_0250346 | 3300046457 | Bacteria | 659 |
| 348 | Ga0495629_0001726 | 3300046459 | Bacteria | 17147 |
| 349 | Ga0495629_0071888 | 3300046459 | Bacteria | 2414 |
| 350 | Ga0495629_0505314 | 3300046459 | Bacteria | 815 |
| 351 | Ga0495629_1028965 | 3300046459 | Bacteria | 535 |
| 352 | Ga0495641_0007825 | 3300046461 | Bacteria | 6617 |
| 353 | Ga0495641_0143819 | 3300046461 | Bacteria | 1065 |
| 354 | Ga0495582_0162122 | 3300046473 | Bacteria | 1272 |
| 355 | Ga0495662_0004365 | 3300046476 | Bacteria | 7100 |
| 356 | Ga0495607_0214274 | 3300046501 | Bacteria | 946 |
| 357 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 358 | Ga0495610_0104506 | 3300046512 | Bacteria | 1263 |
| 359 | Ga0495628_0210425 | 3300046516 | Bacteria | 1463 |
| 360 | Ga0495630_0000020 | 3300046517 | Bacteria | 176389 |
| 361 | Ga0495630_0137874 | 3300046517 | Bacteria | 1854 |
| 362 | Ga0495644_0003786 | 3300046523 | Bacteria | 5953 |
| 363 | Ga0495644_0020961 | 3300046523 | Bacteria | 2494 |
| 364 | Ga0495666_0346009 | 3300046526 | Bacteria | 670 |
| 365 | Ga0495640_0704543 | 3300046533 | Unclassified | 606 |
| 366 | Ga0495587_0758295 | 3300046536 | Bacteria | 531 |
| 367 | Ga0495598_0056702 | 3300046537 | Bacteria | 1196 |
| 368 | Ga0495667_0410266 | 3300046559 | Bacteria | 853 |
| 369 | Ga0495625_0568084 | 3300046660 | Bacteria | 685 |
| 370 | Ga0495635_0100682 | 3300046663 | Bacteria | 1975 |
| 371 | Ga0495635_0188788 | 3300046663 | Bacteria | 1399 |
| 372 | Ga0495661_0278575 | 3300046665 | Bacteria | 844 |
| 373 | Ga0495588_0000134 | 3300046674 | Bacteria | 117581 |
| 374 | Ga0495647_0000156 | 3300046681 | Bacteria | 17539 |
| 375 | Ga0495647_0032967 | 3300046681 | Bacteria | 1934 |
| 376 | Ga0495658_0150163 | 3300046683 | Bacteria | 1430 |
| 377 | Ga0495613_0000801 | 3300046689 | Bacteria | 24391 |
| 378 | Ga0495624_0000647 | 3300046690 | Bacteria | 27259 |
| 379 | Ga0495624_0118680 | 3300046690 | Bacteria | 1625 |
| 380 | Ga0495624_0404917 | 3300046690 | Bacteria | 819 |
| 381 | Ga0495581_0041693 | 3300047315 | Bacteria | 2657 |
| 382 | Ga0495672_0054930 | 3300047320 | Bacteria | 2325 |
| 383 | Ga0495672_0438509 | 3300047320 | Bacteria | 591 |
| 384 | Ga0495676_0034423 | 3300047321 | Bacteria | 4251 |
| 385 | Ga0495676_0210851 | 3300047321 | Bacteria | 1344 |
| 386 | Ga0495676_0255640 | 3300047321 | Bacteria | 1193 |
| 387 | Ga0495676_0373998 | 3300047321 | Bacteria | 949 |
| 388 | Ga0495680_0004286 | 3300047322 | Bacteria | 13686 |
| 389 | Ga0495680_0087866 | 3300047322 | Bacteria | 2337 |
| 390 | Ga0495680_0162728 | 3300047322 | Bacteria | 1619 |
| 391 | Ga0495593_0446320 | 3300047673 | Unclassified | 647 |
| 392 | Ga0495614_0348313 | 3300048089 | Unclassified | 690 |
| 393 | Ga0496100_0003241 | 3300048903 | Bacteria | 8456 |
| 394 | Ga0496101_0045653 | 3300048904 | Bacteria | 3139 |
| 395 | Ga0496102_0000115 | 3300048905 | Bacteria | 114224 |
| 396 | Ga0496102_0033079 | 3300048905 | Bacteria | 4645 |
| 397 | Ga0496102_0436598 | 3300048905 | Bacteria | 1229 |
| 398 | Ga0496102_0553888 | 3300048905 | Bacteria | 1073 |
| 399 | Ga0496102_1042455 | 3300048905 | Bacteria | 738 |
| 400 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 401 | Ga0496103_0005173 | 3300048906 | Bacteria | 7850 |
| 402 | Ga0496103_0196322 | 3300048906 | Bacteria | 1298 |
| 403 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 404 | Ga0496104_0380101 | 3300048907 | Bacteria | 1325 |
| 405 | Ga0496104_1377168 | 3300048907 | Bacteria | 608 |
| 406 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 407 | Ga0496105_0199680 | 3300048908 | Unclassified | 1632 |
| 408 | Ga0496106_0006555 | 3300048909 | Bacteria | 8622 |
| 409 | Ga0496106_0192776 | 3300048909 | Bacteria | 1621 |
| 410 | Ga0496107_0018938 | 3300048910 | Bacteria | 4853 |
| 411 | Ga0496107_0039557 | 3300048910 | Bacteria | 3383 |
| 412 | Ga0496107_0268895 | 3300048910 | Bacteria | 1269 |
| 413 | Ga0496108_0000175 | 3300048911 | Bacteria | 59373 |
| 414 | Ga0496108_0174293 | 3300048911 | Bacteria | 1861 |
| 415 | Ga0496108_0404344 | 3300048911 | Bacteria | 1192 |
| 416 | Ga0496109_0000121 | 3300048912 | Bacteria | 81487 |
| 417 | Ga0496109_0000249 | 3300048912 | Bacteria | 51718 |
| 418 | Ga0496109_0111597 | 3300048912 | Bacteria | 2542 |
| 419 | Ga0496109_0826775 | 3300048912 | Unclassified | 864 |
| 420 | Ga0496110_0001510 | 3300048913 | Bacteria | 16887 |
| 421 | Ga0496110_0021318 | 3300048913 | Bacteria | 5483 |
| 422 | Ga0496110_0270238 | 3300048913 | Bacteria | 1548 |
| 423 | Ga0496110_0833920 | 3300048913 | Bacteria | 827 |
| 424 | Ga0496111_0000009 | 3300048914 | Bacteria | 93943 |
| 425 | Ga0496111_0017476 | 3300048914 | Bacteria | 4959 |
| 426 | Ga0496111_0229400 | 3300048914 | Bacteria | 1379 |
| 427 | Ga0496112_0003135 | 3300048915 | Bacteria | 13566 |
| 428 | Ga0496113_0023007 | 3300048916 | Bacteria | 4415 |
| 429 | Ga0496113_0124627 | 3300048916 | Bacteria | 2017 |
| 430 | Ga0496114_0013450 | 3300048917 | Bacteria | 6561 |
| 431 | Ga0496114_0620830 | 3300048917 | Bacteria | 952 |
| 432 | Ga0496114_1310020 | 3300048917 | Bacteria | 611 |
| 433 | Ga0496115_0012444 | 3300048918 | Bacteria | 6405 |
| 434 | Ga0496115_0077192 | 3300048918 | Bacteria | 2708 |
| 435 | Ga0496119_0005911 | 3300048922 | Bacteria | 11538 |
| 436 | Ga0496120_0141614 | 3300048923 | Unclassified | 1220 |
| 437 | Ga0501031_0197227 | 3300049568 | Bacteria | 1314 |
| 438 | Ga0501031_0918858 | 3300049568 | Bacteria | 560 |
| 439 | Ga0501033_0226434 | 3300049570 | Bacteria | 1330 |
| 440 | Ga0501036_0140288 | 3300049572 | Bacteria | 2040 |
| 441 | Ga0501038_0355219 | 3300049574 | Bacteria | 1141 |
| 442 | Ga0501039_0231756 | 3300049575 | Bacteria | 1452 |
| 443 | Ga0501040_1128466 | 3300049576 | Bacteria | 569 |
| 444 | Ga0501041_0153342 | 3300049577 | Bacteria | 1439 |
| 445 | Ga0501041_0649779 | 3300049577 | Bacteria | 674 |
| 446 | Ga0501042_0180552 | 3300049578 | Bacteria | 1523 |
| 447 | Ga0501042_0607065 | 3300049578 | Bacteria | 795 |
| 448 | Ga0501042_0968291 | 3300049578 | Bacteria | 620 |
| 449 | Ga0501046_0794413 | 3300049580 | Bacteria | 663 |
| 450 | Ga0501048_0113075 | 3300049582 | Bacteria | 1918 |
| 451 | Ga0501048_0406323 | 3300049582 | Bacteria | 974 |
| 452 | Ga0501048_0552602 | 3300049582 | Bacteria | 826 |
| 453 | Ga0501048_0700740 | 3300049582 | Bacteria | 727 |
| 454 | Ga0501068_0245467 | 3300049584 | Bacteria | 1140 |
| 455 | Ga0501068_0736809 | 3300049584 | Bacteria | 645 |
| 456 | Ga0501070_0397013 | 3300049586 | Bacteria | 1116 |
| 457 | Ga0501070_1306118 | 3300049586 | Unclassified | 554 |
| 458 | Ga0501071_0106318 | 3300049587 | Unclassified | 2072 |
| 459 | Ga0501071_0140618 | 3300049587 | Bacteria | 1797 |
| 460 | Ga0501071_0382511 | 3300049587 | Bacteria | 1073 |
| 461 | Ga0501072_0115365 | 3300049588 | Bacteria | 2139 |
| 462 | Ga0501072_0115413 | 3300049588 | Bacteria | 2138 |
| 463 | Ga0501072_0289943 | 3300049588 | Bacteria | 1301 |
| 464 | Ga0501072_1107092 | 3300049588 | Bacteria | 616 |
| 465 | Ga0501072_1531061 | 3300049588 | Unclassified | 514 |
| 466 | Ga0501074_0178944 | 3300049590 | Bacteria | 1513 |
| 467 | Ga0501074_0476818 | 3300049590 | Bacteria | 884 |
| 468 | Ga0501074_0862285 | 3300049590 | Bacteria | 638 |
| 469 | Ga0501074_1092053 | 3300049590 | Bacteria | 560 |
| 470 | Ga0501075_0009392 | 3300049591 | Bacteria | 6842 |
| 471 | Ga0501075_0065292 | 3300049591 | Bacteria | 2746 |
| 472 | Ga0501075_0275108 | 3300049591 | Bacteria | 1283 |
| 473 | Ga0501075_0353514 | 3300049591 | Bacteria | 1120 |
| 474 | Ga0501075_0480444 | 3300049591 | Bacteria | 948 |
| 475 | Ga0501076_0111839 | 3300049592 | Bacteria | 2208 |
| 476 | Ga0501076_0621651 | 3300049592 | Bacteria | 891 |
| 477 | Ga0501076_0660828 | 3300049592 | Bacteria | 863 |
| 478 | Ga0501077_0741094 | 3300049593 | Bacteria | 632 |
| 479 | Ga0501079_0061586 | 3300049741 | Bacteria | 2895 |
| 480 | Ga0501079_0400147 | 3300049741 | Bacteria | 1077 |
| 481 | Ga0501081_0341470 | 3300049743 | Bacteria | 1103 |
| 482 | Ga0501081_0367379 | 3300049743 | Bacteria | 1062 |
| 483 | Ga0501081_0398740 | 3300049743 | Bacteria | 1018 |
| 484 | Ga0501081_1153049 | 3300049743 | Bacteria | 587 |
| 485 | Ga0501045_0061312 | 3300049824 | Bacteria | 2759 |
| 486 | Ga0501045_0252710 | 3300049824 | Unclassified | 1312 |
| 487 | Ga0501045_0314229 | 3300049824 | Bacteria | 1166 |
| 488 | nmdc:mga03n38_140808_c1 | 3300050490 | Bacteria | 1204 |
| 489 | nmdc:mga03n38_240000_c1 | 3300050490 | Bacteria | 953 |
| 490 | nmdc:mga03n38_919781_c1 | 3300050490 | Unclassified | 515 |
| 491 | nmdc:mga00v17_15328_c1 | 3300050491 | Bacteria | 4302 |
| 492 | nmdc:mga00v17_36527_c1 | 3300050491 | Bacteria | 2928 |
| 493 | nmdc:mga0yw44_206536_c1 | 3300050492 | Bacteria | 1298 |
| 494 | nmdc:mga0yw44_2428_c2 | 3300050492 | Bacteria | 5820 |
| 495 | nmdc:mga0yw44_3349_c1 | 3300050492 | Bacteria | 7102 |
| 496 | nmdc:mga0yw44_5644_c1 | 3300050492 | Bacteria | 5950 |
| 497 | nmdc:mga04h51_253280_c1 | 3300050495 | Bacteria | 706 |
| 498 | nmdc:mga05p37_590184_c1 | 3300050507 | Bacteria | 1256 |
| 499 | nmdc:mga05p37_853842_c1 | 3300050507 | Bacteria | 988 |
| 500 | nmdc:mga0qj67_273240_c1 | 3300050509 | Bacteria | 1370 |
| 501 | nmdc:mga06r32_9219_c1 | 3300050510 | Bacteria | 8897 |
| 502 | nmdc:mga08y16_1757707_c1 | 3300050511 | Unclassified | 574 |
| 503 | nmdc:mga08y16_58359_c1 | 3300050511 | Bacteria | 4032 |
| 504 | nmdc:mga08y16_9469_c1 | 3300050511 | Bacteria | 10222 |
| 505 | nmdc:mga0n895_3781_c1 | 3300050512 | Bacteria | 12256 |
| 506 | nmdc:mga0n895_906732_c1 | 3300050512 | Bacteria | 867 |
| 507 | nmdc:mga0rr50_13332_c1 | 3300050513 | Bacteria | 5348 |
| 508 | nmdc:mga0a205_72741_c1 | 3300050515 | Bacteria | 3321 |
| 509 | nmdc:mga0a205_98154_c1 | 3300050515 | Bacteria | 2828 |
| 510 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 511 | Ga0495601_0256051 | 3300053077 | Bacteria | 1143 |
| 512 | Ga0495601_0277206 | 3300053077 | Bacteria | 1093 |
| 513 | Ga0495612_0088014 | 3300053078 | Bacteria | 1311 |
| 514 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 515 | Ga0495619_0000157 | 3300053085 | Bacteria | 49848 |
| 516 | Ga0495619_0000782 | 3300053085 | Bacteria | 20846 |
| 517 | Ga0495619_0003131 | 3300053085 | Bacteria | 10732 |
| 518 | Ga0500566_0185740 | 3300053094 | Bacteria | 1062 |
| 519 | Ga0500628_000033 | 3300053129 | Bacteria | 52431 |
| 520 | Ga0501084_0045121 | 3300054114 | Bacteria | 3691 |
| 521 | Ga0501084_0225936 | 3300054114 | Bacteria | 1580 |
| 522 | Ga0501084_0399577 | 3300054114 | Bacteria | 1161 |
| 523 | Ga0501084_1202984 | 3300054114 | Bacteria | 636 |
| 524 | Ga0501082_0931684 | 3300060353 | Bacteria | 760 |
| 525 | Ga0530510_0041671 | 3300061734 | Bacteria | 3315 |
| 526 | Ga0530510_0060860 | 3300061734 | Bacteria | 2733 |
| 527 | Ga0530510_0204064 | 3300061734 | Bacteria | 1469 |
| 528 | Ga0530510_0470631 | 3300061734 | Bacteria | 951 |
| 529 | Ga0530510_0492166 | 3300061734 | Bacteria | 929 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0969220 | Ga0395899_0969220_32_325 | 93 |
| 2 | 3300005331 | Ga0070670_100149841 | Ga0070670_1001498412 | 96 |
| 3 | 3300005337 | Ga0070682_100000150 | Ga0070682_10000015050 | 96 |
| 4 | 3300005338 | Ga0068868_100002756 | Ga0068868_10000275612 | 96 |
| 5 | 3300005338 | Ga0068868_101674955 | Ga0068868_1016749552 | 96 |
| 6 | 3300005364 | Ga0070673_100812492 | Ga0070673_1008124922 | 96 |
| 7 | 3300005365 | Ga0070688_100001250 | Ga0070688_10000125012 | 96 |
| 8 | 3300005365 | Ga0070688_100001531 | Ga0070688_1000015312 | 96 |
| 9 | 3300005436 | Ga0070713_100000085 | Ga0070713_10000008512 | 96 |
| 10 | 3300005466 | Ga0070685_10001410 | Ga0070685_1000141012 | 96 |
| 11 | 3300005466 | Ga0070685_10001719 | Ga0070685_1000171911 | 96 |
| 12 | 3300005539 | Ga0068853_100283811 | Ga0068853_1002838112 | 96 |
| 13 | 3300005549 | Ga0070704_100118890 | Ga0070704_1001188902 | 96 |
| 14 | 3300005614 | Ga0068856_100008468 | Ga0068856_1000084682 | 96 |
| 15 | 3300005616 | Ga0068852_100000006 | Ga0068852_100000006149 | 96 |
| 16 | 3300006178 | Ga0075367_10171417 | Ga0075367_101714172 | 96 |
| 17 | 3300006881 | Ga0068865_100000023 | Ga0068865_10000002395 | 96 |
| 18 | 3300009098 | Ga0105245_10000254 | Ga0105245_100002545 | 96 |
| 19 | 3300009148 | Ga0105243_10162820 | Ga0105243_101628203 | 96 |
| 20 | 3300009174 | Ga0105241_10052214 | Ga0105241_100522142 | 96 |
| 21 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008309 | 96 |
| 22 | 3300010375 | Ga0105239_10610284 | Ga0105239_106102842 | 96 |
| 23 | 3300012507 | Ga0157342_1016405 | Ga0157342_10164052 | 96 |
| 24 | 3300013102 | Ga0157371_10004749 | Ga0157371_1000474912 | 96 |
| 25 | 3300013104 | Ga0157370_10023676 | Ga0157370_100236763 | 96 |
| 26 | 3300013104 | Ga0157370_10141010 | Ga0157370_101410102 | 96 |
| 27 | 3300013105 | Ga0157369_10000020 | Ga0157369_10000020190 | 96 |
| 28 | 3300013105 | Ga0157369_11623048 | Ga0157369_116230482 | 96 |
| 29 | 3300013296 | Ga0157374_10727882 | Ga0157374_107278822 | 96 |
| 30 | 3300020070 | Ga0206356_10199296 | Ga0206356_101992962 | 96 |
| 31 | 3300022467 | Ga0224712_10038893 | Ga0224712_100388932 | 96 |
| 32 | 3300025907 | Ga0207645_10525397 | Ga0207645_105253972 | 96 |
| 33 | 3300025911 | Ga0207654_10271036 | Ga0207654_102710362 | 96 |
| 34 | 3300025925 | Ga0207650_10130173 | Ga0207650_101301732 | 96 |
| 35 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007431 | 96 |
| 36 | 3300025928 | Ga0207700_10000027 | Ga0207700_1000002754 | 96 |
| 37 | 3300025935 | Ga0207709_10093921 | Ga0207709_100939212 | 96 |
| 38 | 3300025938 | Ga0207704_10000159 | Ga0207704_1000015915 | 96 |
| 39 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006703 | 96 |
| 40 | 3300025972 | Ga0207668_10045033 | Ga0207668_100450332 | 96 |
| 41 | 3300026023 | Ga0207677_10001552 | Ga0207677_100015522 | 96 |
| 42 | 3300026023 | Ga0207677_11461843 | Ga0207677_114618432 | 96 |
| 43 | 3300026041 | Ga0207639_10230174 | Ga0207639_102301742 | 96 |
| 44 | 3300026078 | Ga0207702_10000158 | Ga0207702_1000015878 | 96 |
| 45 | 3300026142 | Ga0207698_10000013 | Ga0207698_1000001340 | 96 |
| 46 | 3300037466 | Ga0395898_0759438 | Ga0395898_0759438_467_790 | 96 |
| 47 | 3300044694 | Ga0466963_0006674 | Ga0466963_0006674_3940_4230 | 96 |
| 48 | 3300044842 | Ga0466957_0029121 | Ga0466957_0029121_788_1078 | 96 |
| 49 | 3300045836 | Ga0466958_0113749 | Ga0466958_0113749_1382_1672 | 96 |
| 50 | 3300045976 | Ga0466967_0000009 | Ga0466967_0000009_113004_113294 | 96 |
| 51 | 3300045976 | Ga0466967_0046799 | Ga0466967_0046799_885_1175 | 96 |
| 52 | 3300046457 | Ga0495590_0250346 | Ga0495590_0250346_146_469 | 96 |
| 53 | 3300046476 | Ga0495662_0004365 | Ga0495662_0004365_2809_3099 | 96 |
| 54 | 3300046501 | Ga0495607_0214274 | Ga0495607_0214274_431_754 | 96 |
| 55 | 3300046516 | Ga0495628_0210425 | Ga0495628_0210425_212_502 | 96 |
| 56 | 3300046523 | Ga0495644_0020961 | Ga0495644_0020961_617_940 | 96 |
| 57 | 3300046665 | Ga0495661_0278575 | Ga0495661_0278575_141_464 | 96 |
| 58 | 3300046683 | Ga0495658_0150163 | Ga0495658_0150163_316_606 | 96 |
| 59 | 3300047320 | Ga0495672_0438509 | Ga0495672_0438509_212_535 | 96 |
| 60 | 3300047673 | Ga0495593_0446320 | Ga0495593_0446320_193_483 | 96 |
| 61 | 3300048911 | Ga0496108_0000175 | Ga0496108_0000175_9445_9735 | 96 |
| 62 | 3300048911 | Ga0496108_0404344 | Ga0496108_0404344_257_547 | 96 |
| 63 | 3300048912 | Ga0496109_0000121 | Ga0496109_0000121_9437_9727 | 96 |
| 64 | 3300048912 | Ga0496109_0000249 | Ga0496109_0000249_42853_43143 | 96 |
| 65 | 3300048912 | Ga0496109_0826775 | Ga0496109_0826775_180_470 | 96 |
| 66 | 3300048913 | Ga0496110_0833920 | Ga0496110_0833920_170_460 | 96 |
| 67 | 3300048916 | Ga0496113_0124627 | Ga0496113_0124627_814_1104 | 96 |
| 68 | 3300053085 | Ga0495619_0000782 | Ga0495619_0000782_6177_6467 | 96 |
| 69 | 3300000532 | CNAas_1011488 | CNAas_10114881 | 97 |
| 70 | 3300001991 | JGI24743J22301_10096452 | JGI24743J22301_100964522 | 97 |
| 71 | 3300002459 | JGI24751J29686_10026942 | JGI24751J29686_100269423 | 97 |
| 72 | 3300003659 | JGI25404J52841_10021990 | JGI25404J52841_100219902 | 97 |
| 73 | 3300005327 | Ga0070658_10190259 | Ga0070658_101902592 | 97 |
| 74 | 3300005329 | Ga0070683_100016350 | Ga0070683_1000163502 | 97 |
| 75 | 3300005329 | Ga0070683_100071230 | Ga0070683_1000712302 | 97 |
| 76 | 3300005329 | Ga0070683_100444286 | Ga0070683_1004442862 | 97 |
| 77 | 3300005329 | Ga0070683_101328676 | Ga0070683_1013286762 | 97 |
| 78 | 3300005330 | Ga0070690_100133061 | Ga0070690_1001330613 | 97 |
| 79 | 3300005330 | Ga0070690_101252185 | Ga0070690_1012521851 | 97 |
| 80 | 3300005334 | Ga0068869_102146520 | Ga0068869_1021465201 | 97 |
| 81 | 3300005336 | Ga0070680_100413928 | Ga0070680_1004139283 | 97 |
| 82 | 3300005337 | Ga0070682_100073609 | Ga0070682_1000736092 | 97 |
| 83 | 3300005338 | Ga0068868_100000450 | Ga0068868_1000004509 | 97 |
| 84 | 3300005338 | Ga0068868_100729135 | Ga0068868_1007291352 | 97 |
| 85 | 3300005339 | Ga0070660_100207563 | Ga0070660_1002075632 | 97 |
| 86 | 3300005340 | Ga0070689_100747599 | Ga0070689_1007475992 | 97 |
| 87 | 3300005343 | Ga0070687_100203649 | Ga0070687_1002036493 | 97 |
| 88 | 3300005343 | Ga0070687_100449919 | Ga0070687_1004499192 | 97 |
| 89 | 3300005344 | Ga0070661_100000102 | Ga0070661_10000010214 | 97 |
| 90 | 3300005345 | Ga0070692_10044881 | Ga0070692_100448814 | 97 |
| 91 | 3300005347 | Ga0070668_100031876 | Ga0070668_1000318762 | 97 |
| 92 | 3300005347 | Ga0070668_100203778 | Ga0070668_1002037782 | 97 |
| 93 | 3300005347 | Ga0070668_100497236 | Ga0070668_1004972362 | 97 |
| 94 | 3300005347 | Ga0070668_101320920 | Ga0070668_1013209202 | 97 |
| 95 | 3300005353 | Ga0070669_101232365 | Ga0070669_1012323651 | 97 |
| 96 | 3300005354 | Ga0070675_100000027 | Ga0070675_10000002735 | 97 |
| 97 | 3300005356 | Ga0070674_100092136 | Ga0070674_1000921364 | 97 |
| 98 | 3300005356 | Ga0070674_100857662 | Ga0070674_1008576622 | 97 |
| 99 | 3300005356 | Ga0070674_101169558 | Ga0070674_1011695581 | 97 |
| 100 | 3300005364 | Ga0070673_100291921 | Ga0070673_1002919212 | 97 |
| 101 | 3300005365 | Ga0070688_100323861 | Ga0070688_1003238612 | 97 |
| 102 | 3300005365 | Ga0070688_100587882 | Ga0070688_1005878822 | 97 |
| 103 | 3300005366 | Ga0070659_100119409 | Ga0070659_1001194092 | 97 |
| 104 | 3300005366 | Ga0070659_101071206 | Ga0070659_1010712061 | 97 |
| 105 | 3300005367 | Ga0070667_100006185 | Ga0070667_10000618510 | 97 |
| 106 | 3300005367 | Ga0070667_100167082 | Ga0070667_1001670822 | 97 |
| 107 | 3300005435 | Ga0070714_100090319 | Ga0070714_1000903192 | 97 |
| 108 | 3300005438 | Ga0070701_10440854 | Ga0070701_104408542 | 97 |
| 109 | 3300005438 | Ga0070701_10468127 | Ga0070701_104681272 | 97 |
| 110 | 3300005438 | Ga0070701_10857506 | Ga0070701_108575061 | 97 |
| 111 | 3300005439 | Ga0070711_100003742 | Ga0070711_10000374212 | 97 |
| 112 | 3300005440 | Ga0070705_100502191 | Ga0070705_1005021912 | 97 |
| 113 | 3300005441 | Ga0070700_100229234 | Ga0070700_1002292343 | 97 |
| 114 | 3300005441 | Ga0070700_100659437 | Ga0070700_1006594372 | 97 |
| 115 | 3300005444 | Ga0070694_100672458 | Ga0070694_1006724582 | 97 |
| 116 | 3300005444 | Ga0070694_100941252 | Ga0070694_1009412522 | 97 |
| 117 | 3300005445 | Ga0070708_101900548 | Ga0070708_1019005482 | 97 |
| 118 | 3300005455 | Ga0070663_100824965 | Ga0070663_1008249652 | 97 |
| 119 | 3300005455 | Ga0070663_101859017 | Ga0070663_1018590172 | 97 |
| 120 | 3300005456 | Ga0070678_100025174 | Ga0070678_1000251746 | 97 |
| 121 | 3300005456 | Ga0070678_100096103 | Ga0070678_1000961031 | 97 |
| 122 | 3300005456 | Ga0070678_100187127 | Ga0070678_1001871272 | 97 |
| 123 | 3300005457 | Ga0070662_100000004 | Ga0070662_100000004152 | 97 |
| 124 | 3300005457 | Ga0070662_101357189 | Ga0070662_1013571892 | 97 |
| 125 | 3300005458 | Ga0070681_10579294 | Ga0070681_105792941 | 97 |
| 126 | 3300005459 | Ga0068867_100528839 | Ga0068867_1005288392 | 97 |
| 127 | 3300005459 | Ga0068867_100892607 | Ga0068867_1008926072 | 97 |
| 128 | 3300005466 | Ga0070685_10128981 | Ga0070685_101289813 | 97 |
| 129 | 3300005466 | Ga0070685_11453797 | Ga0070685_114537972 | 97 |
| 130 | 3300005467 | Ga0070706_101720280 | Ga0070706_1017202802 | 97 |
| 131 | 3300005468 | Ga0070707_100644243 | Ga0070707_1006442432 | 97 |
| 132 | 3300005535 | Ga0070684_100024292 | Ga0070684_1000242922 | 97 |
| 133 | 3300005535 | Ga0070684_100156085 | Ga0070684_1001560852 | 97 |
| 134 | 3300005535 | Ga0070684_100430015 | Ga0070684_1004300153 | 97 |
| 135 | 3300005544 | Ga0070686_100157757 | Ga0070686_1001577573 | 97 |
| 136 | 3300005545 | Ga0070695_100320435 | Ga0070695_1003204352 | 97 |
| 137 | 3300005546 | Ga0070696_100310799 | Ga0070696_1003107992 | 97 |
| 138 | 3300005547 | Ga0070693_100004573 | Ga0070693_1000045735 | 97 |
| 139 | 3300005548 | Ga0070665_100039235 | Ga0070665_1000392352 | 97 |
| 140 | 3300005548 | Ga0070665_100177505 | Ga0070665_1001775051 | 97 |
| 141 | 3300005548 | Ga0070665_100440390 | Ga0070665_1004403902 | 97 |
| 142 | 3300005549 | Ga0070704_102191011 | Ga0070704_1021910112 | 97 |
| 143 | 3300005564 | Ga0070664_100224234 | Ga0070664_1002242343 | 97 |
| 144 | 3300005577 | Ga0068857_100055196 | Ga0068857_1000551962 | 97 |
| 145 | 3300005578 | Ga0068854_100000156 | Ga0068854_10000015654 | 97 |
| 146 | 3300005578 | Ga0068854_100850248 | Ga0068854_1008502481 | 97 |
| 147 | 3300005614 | Ga0068856_100166410 | Ga0068856_1001664102 | 97 |
| 148 | 3300005616 | Ga0068852_100173873 | Ga0068852_1001738732 | 97 |
| 149 | 3300005616 | Ga0068852_100432959 | Ga0068852_1004329592 | 97 |
| 150 | 3300005618 | Ga0068864_100000053 | Ga0068864_10000005395 | 97 |
| 151 | 3300005718 | Ga0068866_10104193 | Ga0068866_101041932 | 97 |
| 152 | 3300005718 | Ga0068866_10252856 | Ga0068866_102528561 | 97 |
| 153 | 3300005834 | Ga0068851_10001568 | Ga0068851_100015683 | 97 |
| 154 | 3300005834 | Ga0068851_10277035 | Ga0068851_102770352 | 97 |
| 155 | 3300005840 | Ga0068870_10274147 | Ga0068870_102741472 | 97 |
| 156 | 3300005840 | Ga0068870_10669180 | Ga0068870_106691802 | 97 |
| 157 | 3300005841 | Ga0068863_100013897 | Ga0068863_1000138976 | 97 |
| 158 | 3300005841 | Ga0068863_101116738 | Ga0068863_1011167381 | 97 |
| 159 | 3300005842 | Ga0068858_100133034 | Ga0068858_1001330342 | 97 |
| 160 | 3300005842 | Ga0068858_100848521 | Ga0068858_1008485212 | 97 |
| 161 | 3300005843 | Ga0068860_100099968 | Ga0068860_1000999683 | 97 |
| 162 | 3300005843 | Ga0068860_100213711 | Ga0068860_1002137112 | 97 |
| 163 | 3300005844 | Ga0068862_100000050 | Ga0068862_10000005099 | 97 |
| 164 | 3300005844 | Ga0068862_101871538 | Ga0068862_1018715382 | 97 |
| 165 | 3300005937 | Ga0081455_10015768 | Ga0081455_100157684 | 97 |
| 166 | 3300005937 | Ga0081455_10126014 | Ga0081455_101260143 | 97 |
| 167 | 3300005981 | Ga0081538_10259574 | Ga0081538_102595742 | 97 |
| 168 | 3300005983 | Ga0081540_1000163 | Ga0081540_100016365 | 97 |
| 169 | 3300006038 | Ga0075365_10000254 | Ga0075365_100002546 | 97 |
| 170 | 3300006038 | Ga0075365_10009768 | Ga0075365_100097683 | 97 |
| 171 | 3300006038 | Ga0075365_10011771 | Ga0075365_100117716 | 97 |
| 172 | 3300006038 | Ga0075365_10209183 | Ga0075365_102091833 | 97 |
| 173 | 3300006038 | Ga0075365_10565614 | Ga0075365_105656142 | 97 |
| 174 | 3300006042 | Ga0075368_10143636 | Ga0075368_101436362 | 97 |
| 175 | 3300006042 | Ga0075368_10308826 | Ga0075368_103088262 | 97 |
| 176 | 3300006048 | Ga0075363_100206608 | Ga0075363_1002066082 | 97 |
| 177 | 3300006048 | Ga0075363_101000489 | Ga0075363_1010004892 | 97 |
| 178 | 3300006051 | Ga0075364_10048139 | Ga0075364_100481392 | 97 |
| 179 | 3300006051 | Ga0075364_10073425 | Ga0075364_100734253 | 97 |
| 180 | 3300006163 | Ga0070715_10090788 | Ga0070715_100907883 | 97 |
| 181 | 3300006175 | Ga0070712_100128331 | Ga0070712_1001283312 | 97 |
| 182 | 3300006178 | Ga0075367_10736944 | Ga0075367_107369442 | 97 |
| 183 | 3300006237 | Ga0097621_101384106 | Ga0097621_1013841061 | 97 |
| 184 | 3300006358 | Ga0068871_100486996 | Ga0068871_1004869963 | 97 |
| 185 | 3300006844 | Ga0075428_100031418 | Ga0075428_1000314184 | 97 |
| 186 | 3300006846 | Ga0075430_100280718 | Ga0075430_1002807183 | 97 |
| 187 | 3300006846 | Ga0075430_100923773 | Ga0075430_1009237732 | 97 |
| 188 | 3300006847 | Ga0075431_100001567 | Ga0075431_10000156723 | 97 |
| 189 | 3300006847 | Ga0075431_101320141 | Ga0075431_1013201412 | 97 |
| 190 | 3300006852 | Ga0075433_10014351 | Ga0075433_100143512 | 97 |
| 191 | 3300006852 | Ga0075433_10111759 | Ga0075433_101117594 | 97 |
| 192 | 3300006871 | Ga0075434_100001678 | Ga0075434_1000016786 | 97 |
| 193 | 3300006871 | Ga0075434_100030706 | Ga0075434_1000307062 | 97 |
| 194 | 3300006881 | Ga0068865_100059820 | Ga0068865_1000598204 | 97 |
| 195 | 3300006914 | Ga0075436_101335070 | Ga0075436_1013350702 | 97 |
| 196 | 3300007076 | Ga0075435_100460636 | Ga0075435_1004606362 | 97 |
| 197 | 3300007076 | Ga0075435_100779849 | Ga0075435_1007798492 | 97 |
| 198 | 3300009093 | Ga0105240_10517701 | Ga0105240_105177012 | 97 |
| 199 | 3300009093 | Ga0105240_11104890 | Ga0105240_111048902 | 97 |
| 200 | 3300009094 | Ga0111539_10005066 | Ga0111539_100050666 | 97 |
| 201 | 3300009094 | Ga0111539_10300546 | Ga0111539_103005462 | 97 |
| 202 | 3300009094 | Ga0111539_12124471 | Ga0111539_121244712 | 97 |
| 203 | 3300009098 | Ga0105245_10011357 | Ga0105245_100113576 | 97 |
| 204 | 3300009098 | Ga0105245_10261871 | Ga0105245_102618712 | 97 |
| 205 | 3300009098 | Ga0105245_10770683 | Ga0105245_107706832 | 97 |
| 206 | 3300009098 | Ga0105245_10787908 | Ga0105245_107879082 | 97 |
| 207 | 3300009147 | Ga0114129_10006865 | Ga0114129_1000686510 | 97 |
| 208 | 3300009147 | Ga0114129_10740223 | Ga0114129_107402232 | 97 |
| 209 | 3300009147 | Ga0114129_11577306 | Ga0114129_115773062 | 97 |
| 210 | 3300009148 | Ga0105243_10287503 | Ga0105243_102875033 | 97 |
| 211 | 3300009148 | Ga0105243_11951245 | Ga0105243_119512452 | 97 |
| 212 | 3300009176 | Ga0105242_10000032 | Ga0105242_1000003234 | 97 |
| 213 | 3300009176 | Ga0105242_11802106 | Ga0105242_118021062 | 97 |
| 214 | 3300009177 | Ga0105248_10359559 | Ga0105248_103595593 | 97 |
| 215 | 3300009551 | Ga0105238_11268020 | Ga0105238_112680202 | 97 |
| 216 | 3300009553 | Ga0105249_10118734 | Ga0105249_101187345 | 97 |
| 217 | 3300009553 | Ga0105249_10140910 | Ga0105249_101409104 | 97 |
| 218 | 3300009553 | Ga0105249_11329598 | Ga0105249_113295982 | 97 |
| 219 | 3300009553 | Ga0105249_11635343 | Ga0105249_116353432 | 97 |
| 220 | 3300010375 | Ga0105239_10268371 | Ga0105239_102683711 | 97 |
| 221 | 3300010375 | Ga0105239_10729858 | Ga0105239_107298582 | 97 |
| 222 | 3300010375 | Ga0105239_13428268 | Ga0105239_134282681 | 97 |
| 223 | 3300013296 | Ga0157374_10308513 | Ga0157374_103085132 | 97 |
| 224 | 3300013297 | Ga0157378_10005986 | Ga0157378_1000598613 | 97 |
| 225 | 3300013297 | Ga0157378_10030467 | Ga0157378_100304675 | 97 |
| 226 | 3300013297 | Ga0157378_10238950 | Ga0157378_102389502 | 97 |
| 227 | 3300013297 | Ga0157378_10749058 | Ga0157378_107490582 | 97 |
| 228 | 3300013297 | Ga0157378_12450227 | Ga0157378_124502271 | 97 |
| 229 | 3300013306 | Ga0163162_10150512 | Ga0163162_101505124 | 97 |
| 230 | 3300013306 | Ga0163162_10672328 | Ga0163162_106723282 | 97 |
| 231 | 3300013307 | Ga0157372_10000112 | Ga0157372_1000011249 | 97 |
| 232 | 3300013307 | Ga0157372_10515980 | Ga0157372_105159803 | 97 |
| 233 | 3300013308 | Ga0157375_10101600 | Ga0157375_101016002 | 97 |
| 234 | 3300013308 | Ga0157375_10706131 | Ga0157375_107061312 | 97 |
| 235 | 3300014325 | Ga0163163_11307028 | Ga0163163_113070282 | 97 |
| 236 | 3300014325 | Ga0163163_11956392 | Ga0163163_119563922 | 97 |
| 237 | 3300014326 | Ga0157380_10000091 | Ga0157380_100000913 | 97 |
| 238 | 3300014326 | Ga0157380_10477609 | Ga0157380_104776092 | 97 |
| 239 | 3300014745 | Ga0157377_11493300 | Ga0157377_114933002 | 97 |
| 240 | 3300014968 | Ga0157379_10031097 | Ga0157379_100310974 | 97 |
| 241 | 3300014968 | Ga0157379_10068023 | Ga0157379_100680236 | 97 |
| 242 | 3300014968 | Ga0157379_10581618 | Ga0157379_105816182 | 97 |
| 243 | 3300014969 | Ga0157376_12911503 | Ga0157376_129115032 | 97 |
| 244 | 3300025321 | Ga0207656_10000385 | Ga0207656_100003857 | 97 |
| 245 | 3300025321 | Ga0207656_10187978 | Ga0207656_101879783 | 97 |
| 246 | 3300025899 | Ga0207642_10078160 | Ga0207642_100781602 | 97 |
| 247 | 3300025901 | Ga0207688_10144741 | Ga0207688_101447412 | 97 |
| 248 | 3300025901 | Ga0207688_10275190 | Ga0207688_102751902 | 97 |
| 249 | 3300025905 | Ga0207685_10212719 | Ga0207685_102127191 | 97 |
| 250 | 3300025908 | Ga0207643_10186047 | Ga0207643_101860473 | 97 |
| 251 | 3300025909 | Ga0207705_10167133 | Ga0207705_101671333 | 97 |
| 252 | 3300025913 | Ga0207695_10353802 | Ga0207695_103538022 | 97 |
| 253 | 3300025913 | Ga0207695_10515603 | Ga0207695_105156032 | 97 |
| 254 | 3300025915 | Ga0207693_10028297 | Ga0207693_100282973 | 97 |
| 255 | 3300025915 | Ga0207693_10048890 | Ga0207693_100488903 | 97 |
| 256 | 3300025916 | Ga0207663_10002370 | Ga0207663_100023702 | 97 |
| 257 | 3300025918 | Ga0207662_10128755 | Ga0207662_101287552 | 97 |
| 258 | 3300025920 | Ga0207649_10000009 | Ga0207649_10000009238 | 97 |
| 259 | 3300025920 | Ga0207649_10350271 | Ga0207649_103502713 | 97 |
| 260 | 3300025923 | Ga0207681_11318969 | Ga0207681_113189691 | 97 |
| 261 | 3300025926 | Ga0207659_10000010 | Ga0207659_1000001064 | 97 |
| 262 | 3300025927 | Ga0207687_10052479 | Ga0207687_100524792 | 97 |
| 263 | 3300025927 | Ga0207687_10082407 | Ga0207687_100824074 | 97 |
| 264 | 3300025927 | Ga0207687_10694306 | Ga0207687_106943062 | 97 |
| 265 | 3300025929 | Ga0207664_10100280 | Ga0207664_101002805 | 97 |
| 266 | 3300025932 | Ga0207690_10076663 | Ga0207690_100766632 | 97 |
| 267 | 3300025932 | Ga0207690_10141963 | Ga0207690_101419632 | 97 |
| 268 | 3300025933 | Ga0207706_10000012 | Ga0207706_1000001266 | 97 |
| 269 | 3300025933 | Ga0207706_11432935 | Ga0207706_114329351 | 97 |
| 270 | 3300025934 | Ga0207686_10000048 | Ga0207686_1000004834 | 97 |
| 271 | 3300025935 | Ga0207709_10404037 | Ga0207709_104040372 | 97 |
| 272 | 3300025936 | Ga0207670_10996910 | Ga0207670_109969102 | 97 |
| 273 | 3300025937 | Ga0207669_10209009 | Ga0207669_102090093 | 97 |
| 274 | 3300025938 | Ga0207704_10130732 | Ga0207704_101307322 | 97 |
| 275 | 3300025944 | Ga0207661_10000253 | Ga0207661_1000025339 | 97 |
| 276 | 3300025944 | Ga0207661_10007822 | Ga0207661_100078226 | 97 |
| 277 | 3300025944 | Ga0207661_10148671 | Ga0207661_101486713 | 97 |
| 278 | 3300025945 | Ga0207679_10293740 | Ga0207679_102937402 | 97 |
| 279 | 3300025960 | Ga0207651_10550904 | Ga0207651_105509042 | 97 |
| 280 | 3300025961 | Ga0207712_10096320 | Ga0207712_100963204 | 97 |
| 281 | 3300025961 | Ga0207712_10859340 | Ga0207712_108593402 | 97 |
| 282 | 3300025972 | Ga0207668_10019945 | Ga0207668_100199454 | 97 |
| 283 | 3300025972 | Ga0207668_10027927 | Ga0207668_100279272 | 97 |
| 284 | 3300025972 | Ga0207668_10409174 | Ga0207668_104091742 | 97 |
| 285 | 3300025972 | Ga0207668_10460501 | Ga0207668_104605012 | 97 |
| 286 | 3300025981 | Ga0207640_10000038 | Ga0207640_1000003853 | 97 |
| 287 | 3300025981 | Ga0207640_10404440 | Ga0207640_104044402 | 97 |
| 288 | 3300025986 | Ga0207658_10013822 | Ga0207658_100138226 | 97 |
| 289 | 3300026023 | Ga0207677_10000200 | Ga0207677_1000020027 | 97 |
| 290 | 3300026023 | Ga0207677_10039577 | Ga0207677_100395773 | 97 |
| 291 | 3300026023 | Ga0207677_10972498 | Ga0207677_109724982 | 97 |
| 292 | 3300026035 | Ga0207703_11322304 | Ga0207703_113223042 | 97 |
| 293 | 3300026067 | Ga0207678_10334328 | Ga0207678_103343283 | 97 |
| 294 | 3300026075 | Ga0207708_10047844 | Ga0207708_100478443 | 97 |
| 295 | 3300026075 | Ga0207708_10193019 | Ga0207708_101930192 | 97 |
| 296 | 3300026075 | Ga0207708_12002187 | Ga0207708_120021872 | 97 |
| 297 | 3300026088 | Ga0207641_10005198 | Ga0207641_100051988 | 97 |
| 298 | 3300026088 | Ga0207641_10703844 | Ga0207641_107038442 | 97 |
| 299 | 3300026089 | Ga0207648_10006385 | Ga0207648_100063859 | 97 |
| 300 | 3300026089 | Ga0207648_10801368 | Ga0207648_108013682 | 97 |
| 301 | 3300026089 | Ga0207648_11083934 | Ga0207648_110839342 | 97 |
| 302 | 3300026095 | Ga0207676_10000195 | Ga0207676_1000019525 | 97 |
| 303 | 3300026116 | Ga0207674_10107055 | Ga0207674_101070555 | 97 |
| 304 | 3300026121 | Ga0207683_10011741 | Ga0207683_100117415 | 97 |
| 305 | 3300026121 | Ga0207683_10334641 | Ga0207683_103346412 | 97 |
| 306 | 3300026142 | Ga0207698_10068043 | Ga0207698_100680432 | 97 |
| 307 | 3300026142 | Ga0207698_10526067 | Ga0207698_105260672 | 97 |
| 308 | 3300026142 | Ga0207698_10643432 | Ga0207698_106434322 | 97 |
| 309 | 3300027866 | Ga0209813_10106604 | Ga0209813_101066042 | 97 |
| 310 | 3300027907 | Ga0207428_10053592 | Ga0207428_100535923 | 97 |
| 311 | 3300028379 | Ga0268266_10009710 | Ga0268266_100097103 | 97 |
| 312 | 3300028379 | Ga0268266_10113867 | Ga0268266_101138674 | 97 |
| 313 | 3300028379 | Ga0268266_10626190 | Ga0268266_106261901 | 97 |
| 314 | 3300028380 | Ga0268265_10001136 | Ga0268265_100011368 | 97 |
| 315 | 3300028380 | Ga0268265_10726034 | Ga0268265_107260342 | 97 |
| 316 | 3300028381 | Ga0268264_10238155 | Ga0268264_102381552 | 97 |
| 317 | 3300028381 | Ga0268264_11502190 | Ga0268264_115021902 | 97 |
| 318 | 3300028381 | Ga0268264_12015981 | Ga0268264_120159812 | 97 |
| 319 | 3300028556 | Ga0265337_1000807 | Ga0265337_10008071 | 97 |
| 320 | 3300028558 | Ga0265326_10000252 | Ga0265326_1000025212 | 97 |
| 321 | 3300028563 | Ga0265319_1044415 | Ga0265319_10444152 | 97 |
| 322 | 3300028573 | Ga0265334_10116393 | Ga0265334_101163932 | 97 |
| 323 | 3300028573 | Ga0265334_10283867 | Ga0265334_102838671 | 97 |
| 324 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001372 | 97 |
| 325 | 3300028666 | Ga0265336_10004887 | Ga0265336_100048874 | 97 |
| 326 | 3300028800 | Ga0265338_10284399 | Ga0265338_102843991 | 97 |
| 327 | 3300029957 | Ga0265324_10000498 | Ga0265324_100004982 | 97 |
| 328 | 3300031238 | Ga0265332_10017744 | Ga0265332_100177442 | 97 |
| 329 | 3300031239 | Ga0265328_10001094 | Ga0265328_100010942 | 97 |
| 330 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002371 | 97 |
| 331 | 3300031242 | Ga0265329_10010170 | Ga0265329_100101703 | 97 |
| 332 | 3300031249 | Ga0265339_10033137 | Ga0265339_100331372 | 97 |
| 333 | 3300031250 | Ga0265331_10008961 | Ga0265331_100089612 | 97 |
| 334 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011371 | 97 |
| 335 | 3300031548 | Ga0307408_100304669 | Ga0307408_1003046692 | 97 |
| 336 | 3300031711 | Ga0265314_10000062 | Ga0265314_10000062105 | 97 |
| 337 | 3300032126 | Ga0307415_100001241 | Ga0307415_1000012418 | 97 |
| 338 | 3300035170 | Ga0373943_0224989 | Ga0373943_0224989_405_701 | 97 |
| 339 | 3300035241 | Ga0373961_0280663 | Ga0373961_0280663_10_324 | 97 |
| 340 | 3300035398 | Ga0316574_0035851 | Ga0316574_0035851_556_849 | 97 |
| 341 | 3300035725 | Ga0373947_0862950 | Ga0373947_0862950_29_343 | 97 |
| 342 | 3300037312 | Ga0395899_0019253 | Ga0395899_0019253_4609_4926 | 97 |
| 343 | 3300037418 | Ga0395900_0240995 | Ga0395900_0240995_981_1295 | 97 |
| 344 | 3300037418 | Ga0395900_0325411 | Ga0395900_0325411_592_909 | 97 |
| 345 | 3300037466 | Ga0395898_0001408 | Ga0395898_0001408_1183_1500 | 97 |
| 346 | 3300037466 | Ga0395898_0178368 | Ga0395898_0178368_168_482 | 97 |
| 347 | 3300037466 | Ga0395898_1093279 | Ga0395898_1093279_187_501 | 97 |
| 348 | 3300037471 | Ga0395905_0013982 | Ga0395905_0013982_1622_1939 | 97 |
| 349 | 3300037471 | Ga0395905_0149279 | Ga0395905_0149279_689_1003 | 97 |
| 350 | 3300038443 | Ga0395901_0004783 | Ga0395901_0004783_512_829 | 97 |
| 351 | 3300038443 | Ga0395901_0200958 | Ga0395901_0200958_481_795 | 97 |
| 352 | 3300038443 | Ga0395901_1530705 | Ga0395901_1530705_159_473 | 97 |
| 353 | 3300038996 | Ga0242420_039261 | Ga0242420_039261_284_595 | 97 |
| 354 | 3300041463 | Ga0451804_0586164 | Ga0451804_0586164_19_333 | 97 |
| 355 | 3300041486 | Ga0451807_2276071 | Ga0451807_2276071_629_922 | 97 |
| 356 | 3300041494 | Ga0451837_1359903 | Ga0451837_1359903_247_540 | 97 |
| 357 | 3300041511 | Ga0451855_0011574 | Ga0451855_0011574_239_532 | 97 |
| 358 | 3300041512 | Ga0451853_2385083 | Ga0451853_2385083_166_480 | 97 |
| 359 | 3300044706 | Ga0466964_0249778 | Ga0466964_0249778_293_604 | 97 |
| 360 | 3300044842 | Ga0466957_0287140 | Ga0466957_0287140_548_841 | 97 |
| 361 | 3300046454 | Ga0495592_0392807 | Ga0495592_0392807_543_836 | 97 |
| 362 | 3300046455 | Ga0495603_0000016 | Ga0495603_0000016_2657_2950 | 97 |
| 363 | 3300046455 | Ga0495603_0117873 | Ga0495603_0117873_795_1109 | 97 |
| 364 | 3300046459 | Ga0495629_0001726 | Ga0495629_0001726_13389_13682 | 97 |
| 365 | 3300046459 | Ga0495629_0071888 | Ga0495629_0071888_1724_2017 | 97 |
| 366 | 3300046459 | Ga0495629_0505314 | Ga0495629_0505314_54_368 | 97 |
| 367 | 3300046459 | Ga0495629_1028965 | Ga0495629_1028965_113_406 | 97 |
| 368 | 3300046461 | Ga0495641_0007825 | Ga0495641_0007825_4124_4417 | 97 |
| 369 | 3300046461 | Ga0495641_0143819 | Ga0495641_0143819_540_854 | 97 |
| 370 | 3300046473 | Ga0495582_0162122 | Ga0495582_0162122_92_406 | 97 |
| 371 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_14072_14365 | 97 |
| 372 | 3300046512 | Ga0495610_0104506 | Ga0495610_0104506_746_1039 | 97 |
| 373 | 3300046517 | Ga0495630_0000020 | Ga0495630_0000020_85173_85466 | 97 |
| 374 | 3300046517 | Ga0495630_0137874 | Ga0495630_0137874_425_721 | 97 |
| 375 | 3300046523 | Ga0495644_0003786 | Ga0495644_0003786_4947_5240 | 97 |
| 376 | 3300046526 | Ga0495666_0346009 | Ga0495666_0346009_16_330 | 97 |
| 377 | 3300046533 | Ga0495640_0704543 | Ga0495640_0704543_104_400 | 97 |
| 378 | 3300046536 | Ga0495587_0758295 | Ga0495587_0758295_109_402 | 97 |
| 379 | 3300046537 | Ga0495598_0056702 | Ga0495598_0056702_206_499 | 97 |
| 380 | 3300046559 | Ga0495667_0410266 | Ga0495667_0410266_74_367 | 97 |
| 381 | 3300046660 | Ga0495625_0568084 | Ga0495625_0568084_124_417 | 97 |
| 382 | 3300046663 | Ga0495635_0100682 | Ga0495635_0100682_1034_1330 | 97 |
| 383 | 3300046663 | Ga0495635_0188788 | Ga0495635_0188788_384_677 | 97 |
| 384 | 3300046674 | Ga0495588_0000134 | Ga0495588_0000134_16397_16690 | 97 |
| 385 | 3300046681 | Ga0495647_0000156 | Ga0495647_0000156_8072_8365 | 97 |
| 386 | 3300046681 | Ga0495647_0032967 | Ga0495647_0032967_1220_1534 | 97 |
| 387 | 3300046689 | Ga0495613_0000801 | Ga0495613_0000801_14807_15100 | 97 |
| 388 | 3300046690 | Ga0495624_0000647 | Ga0495624_0000647_14595_14888 | 97 |
| 389 | 3300046690 | Ga0495624_0118680 | Ga0495624_0118680_265_561 | 97 |
| 390 | 3300046690 | Ga0495624_0404917 | Ga0495624_0404917_253_546 | 97 |
| 391 | 3300047315 | Ga0495581_0041693 | Ga0495581_0041693_2178_2492 | 97 |
| 392 | 3300047320 | Ga0495672_0054930 | Ga0495672_0054930_736_1041 | 97 |
| 393 | 3300047321 | Ga0495676_0034423 | Ga0495676_0034423_173_487 | 97 |
| 394 | 3300047321 | Ga0495676_0210851 | Ga0495676_0210851_949_1242 | 97 |
| 395 | 3300047321 | Ga0495676_0255640 | Ga0495676_0255640_816_1109 | 97 |
| 396 | 3300047321 | Ga0495676_0373998 | Ga0495676_0373998_381_674 | 97 |
| 397 | 3300047322 | Ga0495680_0004286 | Ga0495680_0004286_9190_9489 | 97 |
| 398 | 3300047322 | Ga0495680_0087866 | Ga0495680_0087866_509_802 | 97 |
| 399 | 3300047322 | Ga0495680_0162728 | Ga0495680_0162728_710_1003 | 97 |
| 400 | 3300048089 | Ga0495614_0348313 | Ga0495614_0348313_353_667 | 97 |
| 401 | 3300048903 | Ga0496100_0003241 | Ga0496100_0003241_6576_6890 | 97 |
| 402 | 3300048904 | Ga0496101_0045653 | Ga0496101_0045653_880_1194 | 97 |
| 403 | 3300048905 | Ga0496102_0000115 | Ga0496102_0000115_106140_106433 | 97 |
| 404 | 3300048905 | Ga0496102_0033079 | Ga0496102_0033079_2394_2708 | 97 |
| 405 | 3300048905 | Ga0496102_0436598 | Ga0496102_0436598_861_1172 | 97 |
| 406 | 3300048905 | Ga0496102_0553888 | Ga0496102_0553888_452_757 | 97 |
| 407 | 3300048905 | Ga0496102_1042455 | Ga0496102_1042455_227_541 | 97 |
| 408 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_113165_113458 | 97 |
| 409 | 3300048906 | Ga0496103_0005173 | Ga0496103_0005173_6779_7093 | 97 |
| 410 | 3300048906 | Ga0496103_0196322 | Ga0496103_0196322_202_516 | 97 |
| 411 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_349748_350041 | 97 |
| 412 | 3300048907 | Ga0496104_0380101 | Ga0496104_0380101_457_750 | 97 |
| 413 | 3300048907 | Ga0496104_1377168 | Ga0496104_1377168_134_448 | 97 |
| 414 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_291790_292083 | 97 |
| 415 | 3300048908 | Ga0496105_0199680 | Ga0496105_0199680_133_447 | 97 |
| 416 | 3300048909 | Ga0496106_0006555 | Ga0496106_0006555_4718_5032 | 97 |
| 417 | 3300048909 | Ga0496106_0192776 | Ga0496106_0192776_869_1180 | 97 |
| 418 | 3300048910 | Ga0496107_0018938 | Ga0496107_0018938_1667_1981 | 97 |
| 419 | 3300048910 | Ga0496107_0039557 | Ga0496107_0039557_2258_2569 | 97 |
| 420 | 3300048910 | Ga0496107_0268895 | Ga0496107_0268895_569_874 | 97 |
| 421 | 3300048911 | Ga0496108_0174293 | Ga0496108_0174293_869_1183 | 97 |
| 422 | 3300048912 | Ga0496109_0111597 | Ga0496109_0111597_1472_1786 | 97 |
| 423 | 3300048913 | Ga0496110_0001510 | Ga0496110_0001510_2601_2894 | 97 |
| 424 | 3300048913 | Ga0496110_0021318 | Ga0496110_0021318_770_1084 | 97 |
| 425 | 3300048913 | Ga0496110_0270238 | Ga0496110_0270238_158_451 | 97 |
| 426 | 3300048914 | Ga0496111_0000009 | Ga0496111_0000009_79693_79986 | 97 |
| 427 | 3300048914 | Ga0496111_0017476 | Ga0496111_0017476_1644_1958 | 97 |
| 428 | 3300048914 | Ga0496111_0229400 | Ga0496111_0229400_1026_1319 | 97 |
| 429 | 3300048915 | Ga0496112_0003135 | Ga0496112_0003135_3747_4061 | 97 |
| 430 | 3300048916 | Ga0496113_0023007 | Ga0496113_0023007_870_1184 | 97 |
| 431 | 3300048917 | Ga0496114_0013450 | Ga0496114_0013450_4053_4367 | 97 |
| 432 | 3300048917 | Ga0496114_0620830 | Ga0496114_0620830_610_903 | 97 |
| 433 | 3300048917 | Ga0496114_1310020 | Ga0496114_1310020_197_490 | 97 |
| 434 | 3300048918 | Ga0496115_0012444 | Ga0496115_0012444_5523_5816 | 97 |
| 435 | 3300048918 | Ga0496115_0077192 | Ga0496115_0077192_1707_2021 | 97 |
| 436 | 3300048922 | Ga0496119_0005911 | Ga0496119_0005911_7256_7549 | 97 |
| 437 | 3300048923 | Ga0496120_0141614 | Ga0496120_0141614_104_397 | 97 |
| 438 | 3300049568 | Ga0501031_0197227 | Ga0501031_0197227_78_395 | 97 |
| 439 | 3300049568 | Ga0501031_0918858 | Ga0501031_0918858_174_491 | 97 |
| 440 | 3300049570 | Ga0501033_0226434 | Ga0501033_0226434_61_369 | 97 |
| 441 | 3300049572 | Ga0501036_0140288 | Ga0501036_0140288_818_1135 | 97 |
| 442 | 3300049574 | Ga0501038_0355219 | Ga0501038_0355219_318_626 | 97 |
| 443 | 3300049575 | Ga0501039_0231756 | Ga0501039_0231756_838_1146 | 97 |
| 444 | 3300049576 | Ga0501040_1128466 | Ga0501040_1128466_13_330 | 97 |
| 445 | 3300049577 | Ga0501041_0153342 | Ga0501041_0153342_803_1120 | 97 |
| 446 | 3300049577 | Ga0501041_0649779 | Ga0501041_0649779_250_567 | 97 |
| 447 | 3300049578 | Ga0501042_0180552 | Ga0501042_0180552_1190_1507 | 97 |
| 448 | 3300049578 | Ga0501042_0607065 | Ga0501042_0607065_79_396 | 97 |
| 449 | 3300049578 | Ga0501042_0968291 | Ga0501042_0968291_39_332 | 97 |
| 450 | 3300049580 | Ga0501046_0794413 | Ga0501046_0794413_329_646 | 97 |
| 451 | 3300049582 | Ga0501048_0113075 | Ga0501048_0113075_192_500 | 97 |
| 452 | 3300049582 | Ga0501048_0406323 | Ga0501048_0406323_332_649 | 97 |
| 453 | 3300049582 | Ga0501048_0552602 | Ga0501048_0552602_378_695 | 97 |
| 454 | 3300049582 | Ga0501048_0700740 | Ga0501048_0700740_107_400 | 97 |
| 455 | 3300049584 | Ga0501068_0245467 | Ga0501068_0245467_651_959 | 97 |
| 456 | 3300049584 | Ga0501068_0736809 | Ga0501068_0736809_152_469 | 97 |
| 457 | 3300049586 | Ga0501070_0397013 | Ga0501070_0397013_406_723 | 97 |
| 458 | 3300049586 | Ga0501070_1306118 | Ga0501070_1306118_210_518 | 97 |
| 459 | 3300049587 | Ga0501071_0106318 | Ga0501071_0106318_1558_1875 | 97 |
| 460 | 3300049587 | Ga0501071_0140618 | Ga0501071_0140618_1041_1349 | 97 |
| 461 | 3300049587 | Ga0501071_0382511 | Ga0501071_0382511_177_470 | 97 |
| 462 | 3300049588 | Ga0501072_0115365 | Ga0501072_0115365_1362_1679 | 97 |
| 463 | 3300049588 | Ga0501072_0115413 | Ga0501072_0115413_383_700 | 97 |
| 464 | 3300049588 | Ga0501072_0289943 | Ga0501072_0289943_123_440 | 97 |
| 465 | 3300049588 | Ga0501072_1107092 | Ga0501072_1107092_61_378 | 97 |
| 466 | 3300049588 | Ga0501072_1531061 | Ga0501072_1531061_39_332 | 97 |
| 467 | 3300049590 | Ga0501074_0178944 | Ga0501074_0178944_937_1254 | 97 |
| 468 | 3300049590 | Ga0501074_0476818 | Ga0501074_0476818_374_691 | 97 |
| 469 | 3300049590 | Ga0501074_0862285 | Ga0501074_0862285_75_368 | 97 |
| 470 | 3300049590 | Ga0501074_1092053 | Ga0501074_1092053_110_427 | 97 |
| 471 | 3300049591 | Ga0501075_0009392 | Ga0501075_0009392_836_1129 | 97 |
| 472 | 3300049591 | Ga0501075_0065292 | Ga0501075_0065292_1514_1831 | 97 |
| 473 | 3300049591 | Ga0501075_0275108 | Ga0501075_0275108_217_534 | 97 |
| 474 | 3300049591 | Ga0501075_0353514 | Ga0501075_0353514_583_900 | 97 |
| 475 | 3300049591 | Ga0501075_0480444 | Ga0501075_0480444_354_671 | 97 |
| 476 | 3300049592 | Ga0501076_0111839 | Ga0501076_0111839_1150_1467 | 97 |
| 477 | 3300049592 | Ga0501076_0621651 | Ga0501076_0621651_533_841 | 97 |
| 478 | 3300049592 | Ga0501076_0660828 | Ga0501076_0660828_432_749 | 97 |
| 479 | 3300049593 | Ga0501077_0741094 | Ga0501077_0741094_197_514 | 97 |
| 480 | 3300049741 | Ga0501079_0061586 | Ga0501079_0061586_1139_1456 | 97 |
| 481 | 3300049741 | Ga0501079_0400147 | Ga0501079_0400147_698_1015 | 97 |
| 482 | 3300049743 | Ga0501081_0341470 | Ga0501081_0341470_632_949 | 97 |
| 483 | 3300049743 | Ga0501081_0367379 | Ga0501081_0367379_223_540 | 97 |
| 484 | 3300049743 | Ga0501081_0398740 | Ga0501081_0398740_377_694 | 97 |
| 485 | 3300049743 | Ga0501081_1153049 | Ga0501081_1153049_182_475 | 97 |
| 486 | 3300049824 | Ga0501045_0061312 | Ga0501045_0061312_1925_2233 | 97 |
| 487 | 3300049824 | Ga0501045_0252710 | Ga0501045_0252710_829_1122 | 97 |
| 488 | 3300049824 | Ga0501045_0314229 | Ga0501045_0314229_47_364 | 97 |
| 489 | 3300050490 | nmdc:mga03n38_140808_c1 | nmdc:mga03n38_140808_c1_149_463 | 97 |
| 490 | 3300050490 | nmdc:mga03n38_240000_c1 | nmdc:mga03n38_240000_c1_133_444 | 97 |
| 491 | 3300050490 | nmdc:mga03n38_919781_c1 | nmdc:mga03n38_919781_c1_16_330 | 97 |
| 492 | 3300050491 | nmdc:mga00v17_15328_c1 | nmdc:mga00v17_15328_c1_3109_3426 | 97 |
| 493 | 3300050491 | nmdc:mga00v17_36527_c1 | nmdc:mga00v17_36527_c1_1610_1924 | 97 |
| 494 | 3300050492 | nmdc:mga0yw44_206536_c1 | nmdc:mga0yw44_206536_c1_782_1096 | 97 |
| 495 | 3300050492 | nmdc:mga0yw44_2428_c2 | nmdc:mga0yw44_2428_c2_4728_5042 | 97 |
| 496 | 3300050492 | nmdc:mga0yw44_3349_c1 | nmdc:mga0yw44_3349_c1_1637_1954 | 97 |
| 497 | 3300050492 | nmdc:mga0yw44_5644_c1 | nmdc:mga0yw44_5644_c1_2511_2825 | 97 |
| 498 | 3300050495 | nmdc:mga04h51_253280_c1 | nmdc:mga04h51_253280_c1_160_474 | 97 |
| 499 | 3300050507 | nmdc:mga05p37_590184_c1 | nmdc:mga05p37_590184_c1_525_836 | 97 |
| 500 | 3300050507 | nmdc:mga05p37_853842_c1 | nmdc:mga05p37_853842_c1_350_661 | 97 |
| 501 | 3300050509 | nmdc:mga0qj67_273240_c1 | nmdc:mga0qj67_273240_c1_987_1304 | 97 |
| 502 | 3300050510 | nmdc:mga06r32_9219_c1 | nmdc:mga06r32_9219_c1_4478_4792 | 97 |
| 503 | 3300050511 | nmdc:mga08y16_1757707_c1 | nmdc:mga08y16_1757707_c1_193_507 | 97 |
| 504 | 3300050511 | nmdc:mga08y16_58359_c1 | nmdc:mga08y16_58359_c1_2483_2797 | 97 |
| 505 | 3300050511 | nmdc:mga08y16_9469_c1 | nmdc:mga08y16_9469_c1_2595_2909 | 97 |
| 506 | 3300050512 | nmdc:mga0n895_3781_c1 | nmdc:mga0n895_3781_c1_2159_2473 | 97 |
| 507 | 3300050512 | nmdc:mga0n895_906732_c1 | nmdc:mga0n895_906732_c1_307_618 | 97 |
| 508 | 3300050513 | nmdc:mga0rr50_13332_c1 | nmdc:mga0rr50_13332_c1_488_799 | 97 |
| 509 | 3300050515 | nmdc:mga0a205_72741_c1 | nmdc:mga0a205_72741_c1_750_1061 | 97 |
| 510 | 3300050515 | nmdc:mga0a205_98154_c1 | nmdc:mga0a205_98154_c1_1567_1881 | 97 |
| 511 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_29963_30256 | 97 |
| 512 | 3300053077 | Ga0495601_0256051 | Ga0495601_0256051_467_760 | 97 |
| 513 | 3300053077 | Ga0495601_0277206 | Ga0495601_0277206_402_698 | 97 |
| 514 | 3300053078 | Ga0495612_0088014 | Ga0495612_0088014_245_538 | 97 |
| 515 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_286237_286530 | 97 |
| 516 | 3300053085 | Ga0495619_0000157 | Ga0495619_0000157_38283_38576 | 97 |
| 517 | 3300053085 | Ga0495619_0003131 | Ga0495619_0003131_152_448 | 97 |
| 518 | 3300053094 | Ga0500566_0185740 | Ga0500566_0185740_395_688 | 97 |
| 519 | 3300053129 | Ga0500628_000033 | Ga0500628_000033_38268_38561 | 97 |
| 520 | 3300054114 | Ga0501084_0045121 | Ga0501084_0045121_2090_2407 | 97 |
| 521 | 3300054114 | Ga0501084_0225936 | Ga0501084_0225936_1013_1330 | 97 |
| 522 | 3300054114 | Ga0501084_0399577 | Ga0501084_0399577_130_447 | 97 |
| 523 | 3300054114 | Ga0501084_1202984 | Ga0501084_1202984_142_459 | 97 |
| 524 | 3300060353 | Ga0501082_0931684 | Ga0501082_0931684_237_554 | 97 |
| 525 | 3300061734 | Ga0530510_0041671 | Ga0530510_0041671_1383_1700 | 97 |
| 526 | 3300061734 | Ga0530510_0060860 | Ga0530510_0060860_1831_2139 | 97 |
| 527 | 3300061734 | Ga0530510_0204064 | Ga0530510_0204064_154_471 | 97 |
| 528 | 3300061734 | Ga0530510_0470631 | Ga0530510_0470631_358_675 | 97 |
| 529 | 3300061734 | Ga0530510_0492166 | Ga0530510_0492166_282_599 | 97 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2omo-assembly2.cif.gz_C | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.9291 | 2 | 94 |
| 2omo-assembly4.cif.gz_E | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.9187 | 3 | 95 |
| 4dpo-assembly1.cif.gz_B | crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 | 0.9037 | 1 | 91 |
| 3mcs-assembly1.cif.gz_A | crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution | 0.9036 | 2 | 90 |
| 3qmq-assembly2.cif.gz_B | crystal structure of e. coli lsrg | 0.8983 | 1 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qmqB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8983 | 1 | 96 | 3.30.70.100 |
| 2omoE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8956 | 4 | 95 | 3.30.70.100 |
| 2bbeA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8883 | 2 | 91 | 3.30.70.100 |
| 4dpoB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8858 | 2 | 91 | 3.30.70.100 |
| af_Q8BG18_205_343_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8821 | 2 | 93 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838V4U8-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9956 | 1 | 97 |
|
| AF-A0A7V9S2F7-F1-model_v4 | ABM domain-containing protein | 0.9762 | 3 | 97 |
|
| AF-A0A7W0RCL5-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9701 | 3 | 97 |
|
| AF-A0A6J7CXM4-F1-model_v4 | Unannotated protein | 0.9504 | 1 | 97 |
|
| AF-A0A7W1NI50-F1-model_v4 | deleted | 0.9481 | 1 | 68 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar