F459796

General Info

Members Datasets Scaffolds Average Seq Length
529 289 529 101

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_101335070|Ga0075436_1013350702
Length 108
Sequence MADVNYIDWHVHPFRSDRWLEIWRPALDRALAFGARSCYLTRDIDDPLHFRQVSVWDDHADFERYWYSDEIAAQREALQGYFNVPVLPEFYEIVGEGRALSLAPEEPS

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
192 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 0
Rhizoplane 8.32
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1011488 3300000532 Bacteria 599
2 JGI24743J22301_10096452 3300001991 Bacteria 634
3 JGI24751J29686_10026942 3300002459 Bacteria 1193
4 JGI25404J52841_10021990 3300003659 Bacteria 1380
5 Ga0070658_10190259 3300005327 Bacteria 1730
6 Ga0070683_100016350 3300005329 Bacteria 6542
7 Ga0070683_100071230 3300005329 Bacteria 3243
8 Ga0070683_100444286 3300005329 Unclassified 1237
9 Ga0070683_101328676 3300005329 Bacteria 691
10 Ga0070690_100133061 3300005330 Bacteria 1681
11 Ga0070690_101252185 3300005330 Unclassified 593
12 Ga0070670_100149841 3300005331 Unclassified 2019
13 Ga0068869_102146520 3300005334 Unclassified 502
14 Ga0070680_100413928 3300005336 Bacteria 1150
15 Ga0070682_100000150 3300005337 Bacteria 55238
16 Ga0070682_100073609 3300005337 Bacteria 2192
17 Ga0068868_100000450 3300005338 Bacteria 27515
18 Ga0068868_100002756 3300005338 Bacteria 12165
19 Ga0068868_100729135 3300005338 Bacteria 889
20 Ga0068868_101674955 3300005338 Bacteria 599
21 Ga0070660_100207563 3300005339 Bacteria 1590
22 Ga0070689_100747599 3300005340 Bacteria 857
23 Ga0070687_100203649 3300005343 Unclassified 1201
24 Ga0070687_100449919 3300005343 Bacteria 856
25 Ga0070661_100000102 3300005344 Bacteria 69941
26 Ga0070692_10044881 3300005345 Bacteria 2279
27 Ga0070668_100031876 3300005347 Bacteria 4011
28 Ga0070668_100203778 3300005347 Bacteria 1625
29 Ga0070668_100497236 3300005347 Bacteria 1055
30 Ga0070668_101320920 3300005347 Unclassified 656
31 Ga0070669_101232365 3300005353 Bacteria 647
32 Ga0070675_100000027 3300005354 Bacteria 106172
33 Ga0070674_100092136 3300005356 Bacteria 2190
34 Ga0070674_100857662 3300005356 Bacteria 788
35 Ga0070674_101169558 3300005356 Bacteria 682
36 Ga0070673_100291921 3300005364 Bacteria 1433
37 Ga0070673_100812492 3300005364 Bacteria 864
38 Ga0070688_100001250 3300005365 Bacteria 12681
39 Ga0070688_100001531 3300005365 Bacteria 11553
40 Ga0070688_100323861 3300005365 Bacteria 1121
41 Ga0070688_100587882 3300005365 Bacteria 851
42 Ga0070659_100119409 3300005366 Bacteria 2134
43 Ga0070659_101071206 3300005366 Bacteria 710
44 Ga0070667_100006185 3300005367 Bacteria 9957
45 Ga0070667_100167082 3300005367 Bacteria 1941
46 Ga0070714_100090319 3300005435 Bacteria 2682
47 Ga0070713_100000085 3300005436 Bacteria 58902
48 Ga0070701_10440854 3300005438 Bacteria 834
49 Ga0070701_10468127 3300005438 Bacteria 812
50 Ga0070701_10857506 3300005438 Unclassified 624
51 Ga0070711_100003742 3300005439 Bacteria 8920
52 Ga0070705_100502191 3300005440 Unclassified 921
53 Ga0070700_100229234 3300005441 Bacteria 1321
54 Ga0070700_100659437 3300005441 Unclassified 827
55 Ga0070694_100672458 3300005444 Bacteria 840
56 Ga0070694_100941252 3300005444 Bacteria 715
57 Ga0070708_101900548 3300005445 Bacteria 552
58 Ga0070663_100824965 3300005455 Bacteria 797
59 Ga0070663_101859017 3300005455 Unclassified 540
60 Ga0070678_100025174 3300005456 Bacteria 3999
61 Ga0070678_100096103 3300005456 Bacteria 2285
62 Ga0070678_100187127 3300005456 Bacteria 1700
63 Ga0070662_100000004 3300005457 Bacteria 195534
64 Ga0070662_101357189 3300005457 Bacteria 612
65 Ga0070681_10579294 3300005458 Unclassified 1036
66 Ga0068867_100528839 3300005459 Bacteria 1018
67 Ga0068867_100892607 3300005459 Bacteria 799
68 Ga0070685_10001410 3300005466 Bacteria 12591
69 Ga0070685_10001719 3300005466 Bacteria 11497
70 Ga0070685_10128981 3300005466 Bacteria 1579
71 Ga0070685_11453797 3300005466 Bacteria 527
72 Ga0070706_101720280 3300005467 Bacteria 571
73 Ga0070707_100644243 3300005468 Bacteria 1022
74 Ga0070684_100024292 3300005535 Bacteria 5082
75 Ga0070684_100156085 3300005535 Bacteria 2069
76 Ga0070684_100430015 3300005535 Unclassified 1219
77 Ga0068853_100283811 3300005539 Bacteria 1526
78 Ga0070686_100157757 3300005544 Bacteria 1595
79 Ga0070695_100320435 3300005545 Bacteria 1152
80 Ga0070696_100310799 3300005546 Bacteria 1210
81 Ga0070693_100004573 3300005547 Bacteria 6563
82 Ga0070665_100039235 3300005548 Bacteria 4762
83 Ga0070665_100177505 3300005548 Bacteria 2131
84 Ga0070665_100440390 3300005548 Bacteria 1312
85 Ga0070704_100118890 3300005549 Bacteria 2025
86 Ga0070704_102191011 3300005549 Unclassified 514
87 Ga0070664_100224234 3300005564 Bacteria 1682
88 Ga0068857_100055196 3300005577 Bacteria 3526
89 Ga0068854_100000156 3300005578 Bacteria 46593
90 Ga0068854_100850248 3300005578 Bacteria 799
91 Ga0068856_100008468 3300005614 Bacteria 10010
92 Ga0068856_100166410 3300005614 Bacteria 2216
93 Ga0068852_100000006 3300005616 Bacteria 159569
94 Ga0068852_100173873 3300005616 Bacteria 2021
95 Ga0068852_100432959 3300005616 Bacteria 1299
96 Ga0068864_100000053 3300005618 Bacteria 133049
97 Ga0068866_10104193 3300005718 Bacteria 1571
98 Ga0068866_10252856 3300005718 Bacteria 1079
99 Ga0068851_10001568 3300005834 Bacteria 10036
100 Ga0068851_10277035 3300005834 Unclassified 958
101 Ga0068870_10274147 3300005840 Bacteria 1055
102 Ga0068870_10669180 3300005840 Bacteria 713
103 Ga0068863_100013897 3300005841 Bacteria 7763
104 Ga0068863_101116738 3300005841 Unclassified 793
105 Ga0068858_100133034 3300005842 Bacteria 2333
106 Ga0068858_100848521 3300005842 Bacteria 892
107 Ga0068860_100099968 3300005843 Bacteria 2767
108 Ga0068860_100213711 3300005843 Bacteria 1871
109 Ga0068862_100000050 3300005844 Bacteria 145502
110 Ga0068862_101871538 3300005844 Unclassified 610
111 Ga0081455_10015768 3300005937 Bacteria 7320
112 Ga0081455_10126014 3300005937 Bacteria 2010
113 Ga0081538_10259574 3300005981 Bacteria 657
114 Ga0081540_1000163 3300005983 Bacteria 68955
115 Ga0075365_10000254 3300006038 Bacteria 18312
116 Ga0075365_10009768 3300006038 Bacteria 5543
117 Ga0075365_10011771 3300006038 Bacteria 5160
118 Ga0075365_10209183 3300006038 Bacteria 1367
119 Ga0075365_10565614 3300006038 Bacteria 804
120 Ga0075368_10143636 3300006042 Bacteria 995
121 Ga0075368_10308826 3300006042 Bacteria 683
122 Ga0075363_100206608 3300006048 Bacteria 1123
123 Ga0075363_101000489 3300006048 Unclassified 515
124 Ga0075364_10048139 3300006051 Bacteria 2778
125 Ga0075364_10073425 3300006051 Bacteria 2255
126 Ga0070715_10090788 3300006163 Bacteria 1405
127 Ga0070712_100128331 3300006175 Bacteria 1919
128 Ga0075367_10171417 3300006178 Bacteria 1352
129 Ga0075367_10736944 3300006178 Bacteria 627
130 Ga0097621_101384106 3300006237 Bacteria 666
131 Ga0068871_100486996 3300006358 Unclassified 1110
132 Ga0075428_100031418 3300006844 Bacteria 5870
133 Ga0075430_100280718 3300006846 Bacteria 1378
134 Ga0075430_100923773 3300006846 Unclassified 719
135 Ga0075431_100001567 3300006847 Bacteria 21238
136 Ga0075431_101320141 3300006847 Bacteria 682
137 Ga0075433_10014351 3300006852 Bacteria 6471
138 Ga0075433_10111759 3300006852 Archaea 2424
139 Ga0075434_100001678 3300006871 Bacteria 18909
140 Ga0075434_100030706 3300006871 Bacteria 5293
141 Ga0068865_100000023 3300006881 Bacteria 100785
142 Ga0068865_100059820 3300006881 Bacteria 2666
143 Ga0075436_101335070 3300006914 Bacteria 543
144 Ga0075435_100460636 3300007076 Bacteria 1097
145 Ga0075435_100779849 3300007076 Bacteria 832
146 Ga0105240_10517701 3300009093 Bacteria 1324
147 Ga0105240_11104890 3300009093 Unclassified 843
148 Ga0111539_10005066 3300009094 Bacteria 17115
149 Ga0111539_10300546 3300009094 Bacteria 1868
150 Ga0111539_12124471 3300009094 Unclassified 651
151 Ga0105245_10000254 3300009098 Bacteria 50918
152 Ga0105245_10011357 3300009098 Bacteria 7756
153 Ga0105245_10261871 3300009098 Bacteria 1683
154 Ga0105245_10770683 3300009098 Bacteria 999
155 Ga0105245_10787908 3300009098 Bacteria 988
156 Ga0114129_10006865 3300009147 Bacteria 16187
157 Ga0114129_10740223 3300009147 Bacteria 1259
158 Ga0114129_11577306 3300009147 Bacteria 804
159 Ga0105243_10162820 3300009148 Bacteria 1925
160 Ga0105243_10287503 3300009148 Bacteria 1484
161 Ga0105243_11951245 3300009148 Unclassified 621
162 Ga0105241_10052214 3300009174 Bacteria 3120
163 Ga0105242_10000032 3300009176 Bacteria 98198
164 Ga0105242_11802106 3300009176 Bacteria 650
165 Ga0105248_10000008 3300009177 Bacteria 403910
166 Ga0105248_10359559 3300009177 Bacteria 1639
167 Ga0105238_11268020 3300009551 Bacteria 762
168 Ga0105249_10118734 3300009553 Bacteria 2511
169 Ga0105249_10140910 3300009553 Bacteria 2312
170 Ga0105249_11329598 3300009553 Bacteria 790
171 Ga0105249_11635343 3300009553 Bacteria 717
172 Ga0105239_10268371 3300010375 Bacteria 1919
173 Ga0105239_10610284 3300010375 Bacteria 1245
174 Ga0105239_10729858 3300010375 Bacteria 1133
175 Ga0105239_13428268 3300010375 Bacteria 516
176 Ga0157342_1016405 3300012507 Bacteria 819
177 Ga0157371_10004749 3300013102 Bacteria 11723
178 Ga0157370_10023676 3300013104 Bacteria 6094
179 Ga0157370_10141010 3300013104 Unclassified 2246
180 Ga0157369_10000020 3300013105 Bacteria 241679
181 Ga0157369_11623048 3300013105 Unclassified 657
182 Ga0157374_10308513 3300013296 Bacteria 1566
183 Ga0157374_10727882 3300013296 Bacteria 1006
184 Ga0157378_10005986 3300013297 Bacteria 10663
185 Ga0157378_10030467 3300013297 Bacteria 4768
186 Ga0157378_10238950 3300013297 Bacteria 1735
187 Ga0157378_10749058 3300013297 Bacteria 1000
188 Ga0157378_12450227 3300013297 Unclassified 574
189 Ga0163162_10150512 3300013306 Bacteria 2444
190 Ga0163162_10672328 3300013306 Bacteria 1158
191 Ga0157372_10000112 3300013307 Bacteria 85902
192 Ga0157372_10515980 3300013307 Bacteria 1393
193 Ga0157375_10101600 3300013308 Bacteria 2959
194 Ga0157375_10706131 3300013308 Bacteria 1162
195 Ga0163163_11307028 3300014325 Bacteria 787
196 Ga0163163_11956392 3300014325 Bacteria 646
197 Ga0157380_10000091 3300014326 Bacteria 49188
198 Ga0157380_10477609 3300014326 Bacteria 1205
199 Ga0157377_11493300 3300014745 Bacteria 537
200 Ga0157379_10031097 3300014968 Bacteria 4757
201 Ga0157379_10068023 3300014968 Bacteria 3184
202 Ga0157379_10581618 3300014968 Bacteria 1044
203 Ga0157376_12911503 3300014969 Unclassified 518
204 Ga0206356_10199296 3300020070 Bacteria 1213
205 Ga0224712_10038893 3300022467 Bacteria 1780
206 Ga0207656_10000385 3300025321 Bacteria 14857
207 Ga0207656_10187978 3300025321 Unclassified 994
208 Ga0207642_10078160 3300025899 Bacteria 1598
209 Ga0207688_10144741 3300025901 Bacteria 1400
210 Ga0207688_10275190 3300025901 Bacteria 1025
211 Ga0207685_10212719 3300025905 Bacteria 915
212 Ga0207645_10525397 3300025907 Bacteria 802
213 Ga0207643_10186047 3300025908 Bacteria 1259
214 Ga0207705_10167133 3300025909 Bacteria 1655
215 Ga0207654_10271036 3300025911 Bacteria 1145
216 Ga0207695_10353802 3300025913 Bacteria 1355
217 Ga0207695_10515603 3300025913 Bacteria 1077
218 Ga0207693_10028297 3300025915 Bacteria 4428
219 Ga0207693_10048890 3300025915 Bacteria 3321
220 Ga0207663_10002370 3300025916 Bacteria 9051
221 Ga0207662_10128755 3300025918 Bacteria 1594
222 Ga0207649_10000009 3300025920 Bacteria 295544
223 Ga0207649_10350271 3300025920 Bacteria 1093
224 Ga0207681_11318969 3300025923 Unclassified 606
225 Ga0207650_10130173 3300025925 Unclassified 1968
226 Ga0207659_10000010 3300025926 Bacteria 286639
227 Ga0207687_10000007 3300025927 Bacteria 604185
228 Ga0207687_10052479 3300025927 Bacteria 2846
229 Ga0207687_10082407 3300025927 Bacteria 2327
230 Ga0207687_10694306 3300025927 Bacteria 863
231 Ga0207700_10000027 3300025928 Bacteria 137708
232 Ga0207664_10100280 3300025929 Bacteria 2391
233 Ga0207690_10076663 3300025932 Bacteria 2322
234 Ga0207690_10141963 3300025932 Bacteria 1771
235 Ga0207706_10000012 3300025933 Bacteria 195475
236 Ga0207706_11432935 3300025933 Bacteria 566
237 Ga0207686_10000048 3300025934 Bacteria 115595
238 Ga0207709_10093921 3300025935 Bacteria 1967
239 Ga0207709_10404037 3300025935 Bacteria 1045
240 Ga0207670_10996910 3300025936 Bacteria 705
241 Ga0207669_10209009 3300025937 Bacteria 1423
242 Ga0207704_10000159 3300025938 Bacteria 36005
243 Ga0207704_10130732 3300025938 Bacteria 1738
244 Ga0207711_10000006 3300025941 Bacteria 792692
245 Ga0207661_10000253 3300025944 Bacteria 34627
246 Ga0207661_10007822 3300025944 Bacteria 7613
247 Ga0207661_10148671 3300025944 Bacteria 2023
248 Ga0207679_10293740 3300025945 Bacteria 1398
249 Ga0207651_10550904 3300025960 Bacteria 1003
250 Ga0207712_10096320 3300025961 Bacteria 2190
251 Ga0207712_10859340 3300025961 Unclassified 800
252 Ga0207668_10019945 3300025972 Bacteria 4250
253 Ga0207668_10027927 3300025972 Bacteria 3683
254 Ga0207668_10045033 3300025972 Bacteria 3006
255 Ga0207668_10409174 3300025972 Bacteria 1149
256 Ga0207668_10460501 3300025972 Bacteria 1087
257 Ga0207640_10000038 3300025981 Bacteria 108630
258 Ga0207640_10404440 3300025981 Bacteria 1113
259 Ga0207658_10013822 3300025986 Bacteria 5523
260 Ga0207677_10000200 3300026023 Bacteria 48320
261 Ga0207677_10001552 3300026023 Bacteria 12156
262 Ga0207677_10039577 3300026023 Bacteria 3101
263 Ga0207677_10972498 3300026023 Bacteria 768
264 Ga0207677_11461843 3300026023 Bacteria 631
265 Ga0207703_11322304 3300026035 Unclassified 693
266 Ga0207639_10230174 3300026041 Bacteria 1606
267 Ga0207678_10334328 3300026067 Bacteria 1304
268 Ga0207708_10047844 3300026075 Bacteria 3255
269 Ga0207708_10193019 3300026075 Bacteria 1622
270 Ga0207708_12002187 3300026075 Unclassified 507
271 Ga0207702_10000158 3300026078 Bacteria 79984
272 Ga0207641_10005198 3300026088 Bacteria 11129
273 Ga0207641_10703844 3300026088 Unclassified 995
274 Ga0207648_10006385 3300026089 Bacteria 11717
275 Ga0207648_10801368 3300026089 Bacteria 877
276 Ga0207648_11083934 3300026089 Bacteria 751
277 Ga0207676_10000195 3300026095 Bacteria 52951
278 Ga0207674_10107055 3300026116 Bacteria 2773
279 Ga0207683_10011741 3300026121 Bacteria 7475
280 Ga0207683_10334641 3300026121 Bacteria 1388
281 Ga0207698_10000013 3300026142 Bacteria 255414
282 Ga0207698_10068043 3300026142 Bacteria 2811
283 Ga0207698_10526067 3300026142 Bacteria 1155
284 Ga0207698_10643432 3300026142 Bacteria 1050
285 Ga0209813_10106604 3300027866 Bacteria 960
286 Ga0207428_10053592 3300027907 Bacteria 3216
287 Ga0268266_10009710 3300028379 Bacteria 8457
288 Ga0268266_10113867 3300028379 Bacteria 2399
289 Ga0268266_10626190 3300028379 Bacteria 1034
290 Ga0268265_10001136 3300028380 Bacteria 23498
291 Ga0268265_10726034 3300028380 Unclassified 962
292 Ga0268264_10238155 3300028381 Bacteria 1684
293 Ga0268264_11502190 3300028381 Unclassified 684
294 Ga0268264_12015981 3300028381 Bacteria 586
295 Ga0265337_1000807 3300028556 Bacteria 16498
296 Ga0265326_10000252 3300028558 Bacteria 25133
297 Ga0265319_1044415 3300028563 Bacteria 1489
298 Ga0265334_10116393 3300028573 Bacteria 958
299 Ga0265334_10283867 3300028573 Bacteria 568
300 Ga0265322_10000001 3300028654 Bacteria 543854
301 Ga0265336_10004887 3300028666 Bacteria 5023
302 Ga0265338_10284399 3300028800 Bacteria 1207
303 Ga0265324_10000498 3300029957 Bacteria 27248
304 Ga0265332_10017744 3300031238 Bacteria 3141
305 Ga0265328_10001094 3300031239 Bacteria 12441
306 Ga0265320_10000002 3300031240 Bacteria 542875
307 Ga0265329_10010170 3300031242 Bacteria 3470
308 Ga0265339_10033137 3300031249 Bacteria 2911
309 Ga0265331_10008961 3300031250 Bacteria 5655
310 Ga0265327_10000011 3300031251 Bacteria 543807
311 Ga0307408_100304669 3300031548 Bacteria 1336
312 Ga0265314_10000062 3300031711 Bacteria 159496
313 Ga0307415_100001241 3300032126 Bacteria 11977
314 Ga0373943_0224989 3300035170 Bacteria 1046
315 Ga0373961_0280663 3300035241 Unclassified 611
316 Ga0316574_0035851 3300035398 Bacteria 3034
317 Ga0373947_0862950 3300035725 Bacteria 618
318 Ga0395899_0019253 3300037312 Bacteria 5188
319 Ga0395899_0969220 3300037312 Bacteria 515
320 Ga0395900_0240995 3300037418 Bacteria 1814
321 Ga0395900_0325411 3300037418 Unclassified 1516
322 Ga0395898_0001408 3300037466 Bacteria 34249
323 Ga0395898_0178368 3300037466 Bacteria 2030
324 Ga0395898_0759438 3300037466 Unclassified 911
325 Ga0395898_1093279 3300037466 Bacteria 731
326 Ga0395905_0013982 3300037471 Bacteria 7678
327 Ga0395905_0149279 3300037471 Bacteria 2199
328 Ga0395901_0004783 3300038443 Bacteria 13666
329 Ga0395901_0200958 3300038443 Bacteria 2089
330 Ga0395901_1530705 3300038443 Unclassified 622
331 Ga0242420_039261 3300038996 Bacteria 901
332 Ga0451804_0586164 3300041463 Unclassified 525
333 Ga0451807_2276071 3300041486 Bacteria 1586
334 Ga0451837_1359903 3300041494 Bacteria 651
335 Ga0451855_0011574 3300041511 Bacteria 698
336 Ga0451853_2385083 3300041512 Bacteria 1131
337 Ga0466963_0006674 3300044694 Bacteria 6855
338 Ga0466964_0249778 3300044706 Bacteria 874
339 Ga0466957_0029121 3300044842 Bacteria 3292
340 Ga0466957_0287140 3300044842 Bacteria 1102
341 Ga0466958_0113749 3300045836 Bacteria 1690
342 Ga0466967_0000009 3300045976 Bacteria 122610
343 Ga0466967_0046799 3300045976 Bacteria 3768
344 Ga0495592_0392807 3300046454 Bacteria 880
345 Ga0495603_0000016 3300046455 Bacteria 67399
346 Ga0495603_0117873 3300046455 Bacteria 1548
347 Ga0495590_0250346 3300046457 Bacteria 659
348 Ga0495629_0001726 3300046459 Bacteria 17147
349 Ga0495629_0071888 3300046459 Bacteria 2414
350 Ga0495629_0505314 3300046459 Bacteria 815
351 Ga0495629_1028965 3300046459 Bacteria 535
352 Ga0495641_0007825 3300046461 Bacteria 6617
353 Ga0495641_0143819 3300046461 Bacteria 1065
354 Ga0495582_0162122 3300046473 Bacteria 1272
355 Ga0495662_0004365 3300046476 Bacteria 7100
356 Ga0495607_0214274 3300046501 Bacteria 946
357 Ga0495606_0000072 3300046507 Bacteria 173678
358 Ga0495610_0104506 3300046512 Bacteria 1263
359 Ga0495628_0210425 3300046516 Bacteria 1463
360 Ga0495630_0000020 3300046517 Bacteria 176389
361 Ga0495630_0137874 3300046517 Bacteria 1854
362 Ga0495644_0003786 3300046523 Bacteria 5953
363 Ga0495644_0020961 3300046523 Bacteria 2494
364 Ga0495666_0346009 3300046526 Bacteria 670
365 Ga0495640_0704543 3300046533 Unclassified 606
366 Ga0495587_0758295 3300046536 Bacteria 531
367 Ga0495598_0056702 3300046537 Bacteria 1196
368 Ga0495667_0410266 3300046559 Bacteria 853
369 Ga0495625_0568084 3300046660 Bacteria 685
370 Ga0495635_0100682 3300046663 Bacteria 1975
371 Ga0495635_0188788 3300046663 Bacteria 1399
372 Ga0495661_0278575 3300046665 Bacteria 844
373 Ga0495588_0000134 3300046674 Bacteria 117581
374 Ga0495647_0000156 3300046681 Bacteria 17539
375 Ga0495647_0032967 3300046681 Bacteria 1934
376 Ga0495658_0150163 3300046683 Bacteria 1430
377 Ga0495613_0000801 3300046689 Bacteria 24391
378 Ga0495624_0000647 3300046690 Bacteria 27259
379 Ga0495624_0118680 3300046690 Bacteria 1625
380 Ga0495624_0404917 3300046690 Bacteria 819
381 Ga0495581_0041693 3300047315 Bacteria 2657
382 Ga0495672_0054930 3300047320 Bacteria 2325
383 Ga0495672_0438509 3300047320 Bacteria 591
384 Ga0495676_0034423 3300047321 Bacteria 4251
385 Ga0495676_0210851 3300047321 Bacteria 1344
386 Ga0495676_0255640 3300047321 Bacteria 1193
387 Ga0495676_0373998 3300047321 Bacteria 949
388 Ga0495680_0004286 3300047322 Bacteria 13686
389 Ga0495680_0087866 3300047322 Bacteria 2337
390 Ga0495680_0162728 3300047322 Bacteria 1619
391 Ga0495593_0446320 3300047673 Unclassified 647
392 Ga0495614_0348313 3300048089 Unclassified 690
393 Ga0496100_0003241 3300048903 Bacteria 8456
394 Ga0496101_0045653 3300048904 Bacteria 3139
395 Ga0496102_0000115 3300048905 Bacteria 114224
396 Ga0496102_0033079 3300048905 Bacteria 4645
397 Ga0496102_0436598 3300048905 Bacteria 1229
398 Ga0496102_0553888 3300048905 Bacteria 1073
399 Ga0496102_1042455 3300048905 Bacteria 738
400 Ga0496103_0000008 3300048906 Bacteria 340474
401 Ga0496103_0005173 3300048906 Bacteria 7850
402 Ga0496103_0196322 3300048906 Bacteria 1298
403 Ga0496104_0000004 3300048907 Bacteria 641830
404 Ga0496104_0380101 3300048907 Bacteria 1325
405 Ga0496104_1377168 3300048907 Bacteria 608
406 Ga0496105_0000001 3300048908 Bacteria 1328178
407 Ga0496105_0199680 3300048908 Unclassified 1632
408 Ga0496106_0006555 3300048909 Bacteria 8622
409 Ga0496106_0192776 3300048909 Bacteria 1621
410 Ga0496107_0018938 3300048910 Bacteria 4853
411 Ga0496107_0039557 3300048910 Bacteria 3383
412 Ga0496107_0268895 3300048910 Bacteria 1269
413 Ga0496108_0000175 3300048911 Bacteria 59373
414 Ga0496108_0174293 3300048911 Bacteria 1861
415 Ga0496108_0404344 3300048911 Bacteria 1192
416 Ga0496109_0000121 3300048912 Bacteria 81487
417 Ga0496109_0000249 3300048912 Bacteria 51718
418 Ga0496109_0111597 3300048912 Bacteria 2542
419 Ga0496109_0826775 3300048912 Unclassified 864
420 Ga0496110_0001510 3300048913 Bacteria 16887
421 Ga0496110_0021318 3300048913 Bacteria 5483
422 Ga0496110_0270238 3300048913 Bacteria 1548
423 Ga0496110_0833920 3300048913 Bacteria 827
424 Ga0496111_0000009 3300048914 Bacteria 93943
425 Ga0496111_0017476 3300048914 Bacteria 4959
426 Ga0496111_0229400 3300048914 Bacteria 1379
427 Ga0496112_0003135 3300048915 Bacteria 13566
428 Ga0496113_0023007 3300048916 Bacteria 4415
429 Ga0496113_0124627 3300048916 Bacteria 2017
430 Ga0496114_0013450 3300048917 Bacteria 6561
431 Ga0496114_0620830 3300048917 Bacteria 952
432 Ga0496114_1310020 3300048917 Bacteria 611
433 Ga0496115_0012444 3300048918 Bacteria 6405
434 Ga0496115_0077192 3300048918 Bacteria 2708
435 Ga0496119_0005911 3300048922 Bacteria 11538
436 Ga0496120_0141614 3300048923 Unclassified 1220
437 Ga0501031_0197227 3300049568 Bacteria 1314
438 Ga0501031_0918858 3300049568 Bacteria 560
439 Ga0501033_0226434 3300049570 Bacteria 1330
440 Ga0501036_0140288 3300049572 Bacteria 2040
441 Ga0501038_0355219 3300049574 Bacteria 1141
442 Ga0501039_0231756 3300049575 Bacteria 1452
443 Ga0501040_1128466 3300049576 Bacteria 569
444 Ga0501041_0153342 3300049577 Bacteria 1439
445 Ga0501041_0649779 3300049577 Bacteria 674
446 Ga0501042_0180552 3300049578 Bacteria 1523
447 Ga0501042_0607065 3300049578 Bacteria 795
448 Ga0501042_0968291 3300049578 Bacteria 620
449 Ga0501046_0794413 3300049580 Bacteria 663
450 Ga0501048_0113075 3300049582 Bacteria 1918
451 Ga0501048_0406323 3300049582 Bacteria 974
452 Ga0501048_0552602 3300049582 Bacteria 826
453 Ga0501048_0700740 3300049582 Bacteria 727
454 Ga0501068_0245467 3300049584 Bacteria 1140
455 Ga0501068_0736809 3300049584 Bacteria 645
456 Ga0501070_0397013 3300049586 Bacteria 1116
457 Ga0501070_1306118 3300049586 Unclassified 554
458 Ga0501071_0106318 3300049587 Unclassified 2072
459 Ga0501071_0140618 3300049587 Bacteria 1797
460 Ga0501071_0382511 3300049587 Bacteria 1073
461 Ga0501072_0115365 3300049588 Bacteria 2139
462 Ga0501072_0115413 3300049588 Bacteria 2138
463 Ga0501072_0289943 3300049588 Bacteria 1301
464 Ga0501072_1107092 3300049588 Bacteria 616
465 Ga0501072_1531061 3300049588 Unclassified 514
466 Ga0501074_0178944 3300049590 Bacteria 1513
467 Ga0501074_0476818 3300049590 Bacteria 884
468 Ga0501074_0862285 3300049590 Bacteria 638
469 Ga0501074_1092053 3300049590 Bacteria 560
470 Ga0501075_0009392 3300049591 Bacteria 6842
471 Ga0501075_0065292 3300049591 Bacteria 2746
472 Ga0501075_0275108 3300049591 Bacteria 1283
473 Ga0501075_0353514 3300049591 Bacteria 1120
474 Ga0501075_0480444 3300049591 Bacteria 948
475 Ga0501076_0111839 3300049592 Bacteria 2208
476 Ga0501076_0621651 3300049592 Bacteria 891
477 Ga0501076_0660828 3300049592 Bacteria 863
478 Ga0501077_0741094 3300049593 Bacteria 632
479 Ga0501079_0061586 3300049741 Bacteria 2895
480 Ga0501079_0400147 3300049741 Bacteria 1077
481 Ga0501081_0341470 3300049743 Bacteria 1103
482 Ga0501081_0367379 3300049743 Bacteria 1062
483 Ga0501081_0398740 3300049743 Bacteria 1018
484 Ga0501081_1153049 3300049743 Bacteria 587
485 Ga0501045_0061312 3300049824 Bacteria 2759
486 Ga0501045_0252710 3300049824 Unclassified 1312
487 Ga0501045_0314229 3300049824 Bacteria 1166
488 nmdc:mga03n38_140808_c1 3300050490 Bacteria 1204
489 nmdc:mga03n38_240000_c1 3300050490 Bacteria 953
490 nmdc:mga03n38_919781_c1 3300050490 Unclassified 515
491 nmdc:mga00v17_15328_c1 3300050491 Bacteria 4302
492 nmdc:mga00v17_36527_c1 3300050491 Bacteria 2928
493 nmdc:mga0yw44_206536_c1 3300050492 Bacteria 1298
494 nmdc:mga0yw44_2428_c2 3300050492 Bacteria 5820
495 nmdc:mga0yw44_3349_c1 3300050492 Bacteria 7102
496 nmdc:mga0yw44_5644_c1 3300050492 Bacteria 5950
497 nmdc:mga04h51_253280_c1 3300050495 Bacteria 706
498 nmdc:mga05p37_590184_c1 3300050507 Bacteria 1256
499 nmdc:mga05p37_853842_c1 3300050507 Bacteria 988
500 nmdc:mga0qj67_273240_c1 3300050509 Bacteria 1370
501 nmdc:mga06r32_9219_c1 3300050510 Bacteria 8897
502 nmdc:mga08y16_1757707_c1 3300050511 Unclassified 574
503 nmdc:mga08y16_58359_c1 3300050511 Bacteria 4032
504 nmdc:mga08y16_9469_c1 3300050511 Bacteria 10222
505 nmdc:mga0n895_3781_c1 3300050512 Bacteria 12256
506 nmdc:mga0n895_906732_c1 3300050512 Bacteria 867
507 nmdc:mga0rr50_13332_c1 3300050513 Bacteria 5348
508 nmdc:mga0a205_72741_c1 3300050515 Bacteria 3321
509 nmdc:mga0a205_98154_c1 3300050515 Bacteria 2828
510 Ga0495601_0000013 3300053077 Bacteria 226476
511 Ga0495601_0256051 3300053077 Bacteria 1143
512 Ga0495601_0277206 3300053077 Bacteria 1093
513 Ga0495612_0088014 3300053078 Bacteria 1311
514 Ga0495655_0000001 3300053083 Bacteria 419518
515 Ga0495619_0000157 3300053085 Bacteria 49848
516 Ga0495619_0000782 3300053085 Bacteria 20846
517 Ga0495619_0003131 3300053085 Bacteria 10732
518 Ga0500566_0185740 3300053094 Bacteria 1062
519 Ga0500628_000033 3300053129 Bacteria 52431
520 Ga0501084_0045121 3300054114 Bacteria 3691
521 Ga0501084_0225936 3300054114 Bacteria 1580
522 Ga0501084_0399577 3300054114 Bacteria 1161
523 Ga0501084_1202984 3300054114 Bacteria 636
524 Ga0501082_0931684 3300060353 Bacteria 760
525 Ga0530510_0041671 3300061734 Bacteria 3315
526 Ga0530510_0060860 3300061734 Bacteria 2733
527 Ga0530510_0204064 3300061734 Bacteria 1469
528 Ga0530510_0470631 3300061734 Bacteria 951
529 Ga0530510_0492166 3300061734 Bacteria 929

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0969220 Ga0395899_0969220_32_325 93
2 3300005331 Ga0070670_100149841 Ga0070670_1001498412 96
3 3300005337 Ga0070682_100000150 Ga0070682_10000015050 96
4 3300005338 Ga0068868_100002756 Ga0068868_10000275612 96
5 3300005338 Ga0068868_101674955 Ga0068868_1016749552 96
6 3300005364 Ga0070673_100812492 Ga0070673_1008124922 96
7 3300005365 Ga0070688_100001250 Ga0070688_10000125012 96
8 3300005365 Ga0070688_100001531 Ga0070688_1000015312 96
9 3300005436 Ga0070713_100000085 Ga0070713_10000008512 96
10 3300005466 Ga0070685_10001410 Ga0070685_1000141012 96
11 3300005466 Ga0070685_10001719 Ga0070685_1000171911 96
12 3300005539 Ga0068853_100283811 Ga0068853_1002838112 96
13 3300005549 Ga0070704_100118890 Ga0070704_1001188902 96
14 3300005614 Ga0068856_100008468 Ga0068856_1000084682 96
15 3300005616 Ga0068852_100000006 Ga0068852_100000006149 96
16 3300006178 Ga0075367_10171417 Ga0075367_101714172 96
17 3300006881 Ga0068865_100000023 Ga0068865_10000002395 96
18 3300009098 Ga0105245_10000254 Ga0105245_100002545 96
19 3300009148 Ga0105243_10162820 Ga0105243_101628203 96
20 3300009174 Ga0105241_10052214 Ga0105241_100522142 96
21 3300009177 Ga0105248_10000008 Ga0105248_10000008309 96
22 3300010375 Ga0105239_10610284 Ga0105239_106102842 96
23 3300012507 Ga0157342_1016405 Ga0157342_10164052 96
24 3300013102 Ga0157371_10004749 Ga0157371_1000474912 96
25 3300013104 Ga0157370_10023676 Ga0157370_100236763 96
26 3300013104 Ga0157370_10141010 Ga0157370_101410102 96
27 3300013105 Ga0157369_10000020 Ga0157369_10000020190 96
28 3300013105 Ga0157369_11623048 Ga0157369_116230482 96
29 3300013296 Ga0157374_10727882 Ga0157374_107278822 96
30 3300020070 Ga0206356_10199296 Ga0206356_101992962 96
31 3300022467 Ga0224712_10038893 Ga0224712_100388932 96
32 3300025907 Ga0207645_10525397 Ga0207645_105253972 96
33 3300025911 Ga0207654_10271036 Ga0207654_102710362 96
34 3300025925 Ga0207650_10130173 Ga0207650_101301732 96
35 3300025927 Ga0207687_10000007 Ga0207687_10000007431 96
36 3300025928 Ga0207700_10000027 Ga0207700_1000002754 96
37 3300025935 Ga0207709_10093921 Ga0207709_100939212 96
38 3300025938 Ga0207704_10000159 Ga0207704_1000015915 96
39 3300025941 Ga0207711_10000006 Ga0207711_10000006703 96
40 3300025972 Ga0207668_10045033 Ga0207668_100450332 96
41 3300026023 Ga0207677_10001552 Ga0207677_100015522 96
42 3300026023 Ga0207677_11461843 Ga0207677_114618432 96
43 3300026041 Ga0207639_10230174 Ga0207639_102301742 96
44 3300026078 Ga0207702_10000158 Ga0207702_1000015878 96
45 3300026142 Ga0207698_10000013 Ga0207698_1000001340 96
46 3300037466 Ga0395898_0759438 Ga0395898_0759438_467_790 96
47 3300044694 Ga0466963_0006674 Ga0466963_0006674_3940_4230 96
48 3300044842 Ga0466957_0029121 Ga0466957_0029121_788_1078 96
49 3300045836 Ga0466958_0113749 Ga0466958_0113749_1382_1672 96
50 3300045976 Ga0466967_0000009 Ga0466967_0000009_113004_113294 96
51 3300045976 Ga0466967_0046799 Ga0466967_0046799_885_1175 96
52 3300046457 Ga0495590_0250346 Ga0495590_0250346_146_469 96
53 3300046476 Ga0495662_0004365 Ga0495662_0004365_2809_3099 96
54 3300046501 Ga0495607_0214274 Ga0495607_0214274_431_754 96
55 3300046516 Ga0495628_0210425 Ga0495628_0210425_212_502 96
56 3300046523 Ga0495644_0020961 Ga0495644_0020961_617_940 96
57 3300046665 Ga0495661_0278575 Ga0495661_0278575_141_464 96
58 3300046683 Ga0495658_0150163 Ga0495658_0150163_316_606 96
59 3300047320 Ga0495672_0438509 Ga0495672_0438509_212_535 96
60 3300047673 Ga0495593_0446320 Ga0495593_0446320_193_483 96
61 3300048911 Ga0496108_0000175 Ga0496108_0000175_9445_9735 96
62 3300048911 Ga0496108_0404344 Ga0496108_0404344_257_547 96
63 3300048912 Ga0496109_0000121 Ga0496109_0000121_9437_9727 96
64 3300048912 Ga0496109_0000249 Ga0496109_0000249_42853_43143 96
65 3300048912 Ga0496109_0826775 Ga0496109_0826775_180_470 96
66 3300048913 Ga0496110_0833920 Ga0496110_0833920_170_460 96
67 3300048916 Ga0496113_0124627 Ga0496113_0124627_814_1104 96
68 3300053085 Ga0495619_0000782 Ga0495619_0000782_6177_6467 96
69 3300000532 CNAas_1011488 CNAas_10114881 97
70 3300001991 JGI24743J22301_10096452 JGI24743J22301_100964522 97
71 3300002459 JGI24751J29686_10026942 JGI24751J29686_100269423 97
72 3300003659 JGI25404J52841_10021990 JGI25404J52841_100219902 97
73 3300005327 Ga0070658_10190259 Ga0070658_101902592 97
74 3300005329 Ga0070683_100016350 Ga0070683_1000163502 97
75 3300005329 Ga0070683_100071230 Ga0070683_1000712302 97
76 3300005329 Ga0070683_100444286 Ga0070683_1004442862 97
77 3300005329 Ga0070683_101328676 Ga0070683_1013286762 97
78 3300005330 Ga0070690_100133061 Ga0070690_1001330613 97
79 3300005330 Ga0070690_101252185 Ga0070690_1012521851 97
80 3300005334 Ga0068869_102146520 Ga0068869_1021465201 97
81 3300005336 Ga0070680_100413928 Ga0070680_1004139283 97
82 3300005337 Ga0070682_100073609 Ga0070682_1000736092 97
83 3300005338 Ga0068868_100000450 Ga0068868_1000004509 97
84 3300005338 Ga0068868_100729135 Ga0068868_1007291352 97
85 3300005339 Ga0070660_100207563 Ga0070660_1002075632 97
86 3300005340 Ga0070689_100747599 Ga0070689_1007475992 97
87 3300005343 Ga0070687_100203649 Ga0070687_1002036493 97
88 3300005343 Ga0070687_100449919 Ga0070687_1004499192 97
89 3300005344 Ga0070661_100000102 Ga0070661_10000010214 97
90 3300005345 Ga0070692_10044881 Ga0070692_100448814 97
91 3300005347 Ga0070668_100031876 Ga0070668_1000318762 97
92 3300005347 Ga0070668_100203778 Ga0070668_1002037782 97
93 3300005347 Ga0070668_100497236 Ga0070668_1004972362 97
94 3300005347 Ga0070668_101320920 Ga0070668_1013209202 97
95 3300005353 Ga0070669_101232365 Ga0070669_1012323651 97
96 3300005354 Ga0070675_100000027 Ga0070675_10000002735 97
97 3300005356 Ga0070674_100092136 Ga0070674_1000921364 97
98 3300005356 Ga0070674_100857662 Ga0070674_1008576622 97
99 3300005356 Ga0070674_101169558 Ga0070674_1011695581 97
100 3300005364 Ga0070673_100291921 Ga0070673_1002919212 97
101 3300005365 Ga0070688_100323861 Ga0070688_1003238612 97
102 3300005365 Ga0070688_100587882 Ga0070688_1005878822 97
103 3300005366 Ga0070659_100119409 Ga0070659_1001194092 97
104 3300005366 Ga0070659_101071206 Ga0070659_1010712061 97
105 3300005367 Ga0070667_100006185 Ga0070667_10000618510 97
106 3300005367 Ga0070667_100167082 Ga0070667_1001670822 97
107 3300005435 Ga0070714_100090319 Ga0070714_1000903192 97
108 3300005438 Ga0070701_10440854 Ga0070701_104408542 97
109 3300005438 Ga0070701_10468127 Ga0070701_104681272 97
110 3300005438 Ga0070701_10857506 Ga0070701_108575061 97
111 3300005439 Ga0070711_100003742 Ga0070711_10000374212 97
112 3300005440 Ga0070705_100502191 Ga0070705_1005021912 97
113 3300005441 Ga0070700_100229234 Ga0070700_1002292343 97
114 3300005441 Ga0070700_100659437 Ga0070700_1006594372 97
115 3300005444 Ga0070694_100672458 Ga0070694_1006724582 97
116 3300005444 Ga0070694_100941252 Ga0070694_1009412522 97
117 3300005445 Ga0070708_101900548 Ga0070708_1019005482 97
118 3300005455 Ga0070663_100824965 Ga0070663_1008249652 97
119 3300005455 Ga0070663_101859017 Ga0070663_1018590172 97
120 3300005456 Ga0070678_100025174 Ga0070678_1000251746 97
121 3300005456 Ga0070678_100096103 Ga0070678_1000961031 97
122 3300005456 Ga0070678_100187127 Ga0070678_1001871272 97
123 3300005457 Ga0070662_100000004 Ga0070662_100000004152 97
124 3300005457 Ga0070662_101357189 Ga0070662_1013571892 97
125 3300005458 Ga0070681_10579294 Ga0070681_105792941 97
126 3300005459 Ga0068867_100528839 Ga0068867_1005288392 97
127 3300005459 Ga0068867_100892607 Ga0068867_1008926072 97
128 3300005466 Ga0070685_10128981 Ga0070685_101289813 97
129 3300005466 Ga0070685_11453797 Ga0070685_114537972 97
130 3300005467 Ga0070706_101720280 Ga0070706_1017202802 97
131 3300005468 Ga0070707_100644243 Ga0070707_1006442432 97
132 3300005535 Ga0070684_100024292 Ga0070684_1000242922 97
133 3300005535 Ga0070684_100156085 Ga0070684_1001560852 97
134 3300005535 Ga0070684_100430015 Ga0070684_1004300153 97
135 3300005544 Ga0070686_100157757 Ga0070686_1001577573 97
136 3300005545 Ga0070695_100320435 Ga0070695_1003204352 97
137 3300005546 Ga0070696_100310799 Ga0070696_1003107992 97
138 3300005547 Ga0070693_100004573 Ga0070693_1000045735 97
139 3300005548 Ga0070665_100039235 Ga0070665_1000392352 97
140 3300005548 Ga0070665_100177505 Ga0070665_1001775051 97
141 3300005548 Ga0070665_100440390 Ga0070665_1004403902 97
142 3300005549 Ga0070704_102191011 Ga0070704_1021910112 97
143 3300005564 Ga0070664_100224234 Ga0070664_1002242343 97
144 3300005577 Ga0068857_100055196 Ga0068857_1000551962 97
145 3300005578 Ga0068854_100000156 Ga0068854_10000015654 97
146 3300005578 Ga0068854_100850248 Ga0068854_1008502481 97
147 3300005614 Ga0068856_100166410 Ga0068856_1001664102 97
148 3300005616 Ga0068852_100173873 Ga0068852_1001738732 97
149 3300005616 Ga0068852_100432959 Ga0068852_1004329592 97
150 3300005618 Ga0068864_100000053 Ga0068864_10000005395 97
151 3300005718 Ga0068866_10104193 Ga0068866_101041932 97
152 3300005718 Ga0068866_10252856 Ga0068866_102528561 97
153 3300005834 Ga0068851_10001568 Ga0068851_100015683 97
154 3300005834 Ga0068851_10277035 Ga0068851_102770352 97
155 3300005840 Ga0068870_10274147 Ga0068870_102741472 97
156 3300005840 Ga0068870_10669180 Ga0068870_106691802 97
157 3300005841 Ga0068863_100013897 Ga0068863_1000138976 97
158 3300005841 Ga0068863_101116738 Ga0068863_1011167381 97
159 3300005842 Ga0068858_100133034 Ga0068858_1001330342 97
160 3300005842 Ga0068858_100848521 Ga0068858_1008485212 97
161 3300005843 Ga0068860_100099968 Ga0068860_1000999683 97
162 3300005843 Ga0068860_100213711 Ga0068860_1002137112 97
163 3300005844 Ga0068862_100000050 Ga0068862_10000005099 97
164 3300005844 Ga0068862_101871538 Ga0068862_1018715382 97
165 3300005937 Ga0081455_10015768 Ga0081455_100157684 97
166 3300005937 Ga0081455_10126014 Ga0081455_101260143 97
167 3300005981 Ga0081538_10259574 Ga0081538_102595742 97
168 3300005983 Ga0081540_1000163 Ga0081540_100016365 97
169 3300006038 Ga0075365_10000254 Ga0075365_100002546 97
170 3300006038 Ga0075365_10009768 Ga0075365_100097683 97
171 3300006038 Ga0075365_10011771 Ga0075365_100117716 97
172 3300006038 Ga0075365_10209183 Ga0075365_102091833 97
173 3300006038 Ga0075365_10565614 Ga0075365_105656142 97
174 3300006042 Ga0075368_10143636 Ga0075368_101436362 97
175 3300006042 Ga0075368_10308826 Ga0075368_103088262 97
176 3300006048 Ga0075363_100206608 Ga0075363_1002066082 97
177 3300006048 Ga0075363_101000489 Ga0075363_1010004892 97
178 3300006051 Ga0075364_10048139 Ga0075364_100481392 97
179 3300006051 Ga0075364_10073425 Ga0075364_100734253 97
180 3300006163 Ga0070715_10090788 Ga0070715_100907883 97
181 3300006175 Ga0070712_100128331 Ga0070712_1001283312 97
182 3300006178 Ga0075367_10736944 Ga0075367_107369442 97
183 3300006237 Ga0097621_101384106 Ga0097621_1013841061 97
184 3300006358 Ga0068871_100486996 Ga0068871_1004869963 97
185 3300006844 Ga0075428_100031418 Ga0075428_1000314184 97
186 3300006846 Ga0075430_100280718 Ga0075430_1002807183 97
187 3300006846 Ga0075430_100923773 Ga0075430_1009237732 97
188 3300006847 Ga0075431_100001567 Ga0075431_10000156723 97
189 3300006847 Ga0075431_101320141 Ga0075431_1013201412 97
190 3300006852 Ga0075433_10014351 Ga0075433_100143512 97
191 3300006852 Ga0075433_10111759 Ga0075433_101117594 97
192 3300006871 Ga0075434_100001678 Ga0075434_1000016786 97
193 3300006871 Ga0075434_100030706 Ga0075434_1000307062 97
194 3300006881 Ga0068865_100059820 Ga0068865_1000598204 97
195 3300006914 Ga0075436_101335070 Ga0075436_1013350702 97
196 3300007076 Ga0075435_100460636 Ga0075435_1004606362 97
197 3300007076 Ga0075435_100779849 Ga0075435_1007798492 97
198 3300009093 Ga0105240_10517701 Ga0105240_105177012 97
199 3300009093 Ga0105240_11104890 Ga0105240_111048902 97
200 3300009094 Ga0111539_10005066 Ga0111539_100050666 97
201 3300009094 Ga0111539_10300546 Ga0111539_103005462 97
202 3300009094 Ga0111539_12124471 Ga0111539_121244712 97
203 3300009098 Ga0105245_10011357 Ga0105245_100113576 97
204 3300009098 Ga0105245_10261871 Ga0105245_102618712 97
205 3300009098 Ga0105245_10770683 Ga0105245_107706832 97
206 3300009098 Ga0105245_10787908 Ga0105245_107879082 97
207 3300009147 Ga0114129_10006865 Ga0114129_1000686510 97
208 3300009147 Ga0114129_10740223 Ga0114129_107402232 97
209 3300009147 Ga0114129_11577306 Ga0114129_115773062 97
210 3300009148 Ga0105243_10287503 Ga0105243_102875033 97
211 3300009148 Ga0105243_11951245 Ga0105243_119512452 97
212 3300009176 Ga0105242_10000032 Ga0105242_1000003234 97
213 3300009176 Ga0105242_11802106 Ga0105242_118021062 97
214 3300009177 Ga0105248_10359559 Ga0105248_103595593 97
215 3300009551 Ga0105238_11268020 Ga0105238_112680202 97
216 3300009553 Ga0105249_10118734 Ga0105249_101187345 97
217 3300009553 Ga0105249_10140910 Ga0105249_101409104 97
218 3300009553 Ga0105249_11329598 Ga0105249_113295982 97
219 3300009553 Ga0105249_11635343 Ga0105249_116353432 97
220 3300010375 Ga0105239_10268371 Ga0105239_102683711 97
221 3300010375 Ga0105239_10729858 Ga0105239_107298582 97
222 3300010375 Ga0105239_13428268 Ga0105239_134282681 97
223 3300013296 Ga0157374_10308513 Ga0157374_103085132 97
224 3300013297 Ga0157378_10005986 Ga0157378_1000598613 97
225 3300013297 Ga0157378_10030467 Ga0157378_100304675 97
226 3300013297 Ga0157378_10238950 Ga0157378_102389502 97
227 3300013297 Ga0157378_10749058 Ga0157378_107490582 97
228 3300013297 Ga0157378_12450227 Ga0157378_124502271 97
229 3300013306 Ga0163162_10150512 Ga0163162_101505124 97
230 3300013306 Ga0163162_10672328 Ga0163162_106723282 97
231 3300013307 Ga0157372_10000112 Ga0157372_1000011249 97
232 3300013307 Ga0157372_10515980 Ga0157372_105159803 97
233 3300013308 Ga0157375_10101600 Ga0157375_101016002 97
234 3300013308 Ga0157375_10706131 Ga0157375_107061312 97
235 3300014325 Ga0163163_11307028 Ga0163163_113070282 97
236 3300014325 Ga0163163_11956392 Ga0163163_119563922 97
237 3300014326 Ga0157380_10000091 Ga0157380_100000913 97
238 3300014326 Ga0157380_10477609 Ga0157380_104776092 97
239 3300014745 Ga0157377_11493300 Ga0157377_114933002 97
240 3300014968 Ga0157379_10031097 Ga0157379_100310974 97
241 3300014968 Ga0157379_10068023 Ga0157379_100680236 97
242 3300014968 Ga0157379_10581618 Ga0157379_105816182 97
243 3300014969 Ga0157376_12911503 Ga0157376_129115032 97
244 3300025321 Ga0207656_10000385 Ga0207656_100003857 97
245 3300025321 Ga0207656_10187978 Ga0207656_101879783 97
246 3300025899 Ga0207642_10078160 Ga0207642_100781602 97
247 3300025901 Ga0207688_10144741 Ga0207688_101447412 97
248 3300025901 Ga0207688_10275190 Ga0207688_102751902 97
249 3300025905 Ga0207685_10212719 Ga0207685_102127191 97
250 3300025908 Ga0207643_10186047 Ga0207643_101860473 97
251 3300025909 Ga0207705_10167133 Ga0207705_101671333 97
252 3300025913 Ga0207695_10353802 Ga0207695_103538022 97
253 3300025913 Ga0207695_10515603 Ga0207695_105156032 97
254 3300025915 Ga0207693_10028297 Ga0207693_100282973 97
255 3300025915 Ga0207693_10048890 Ga0207693_100488903 97
256 3300025916 Ga0207663_10002370 Ga0207663_100023702 97
257 3300025918 Ga0207662_10128755 Ga0207662_101287552 97
258 3300025920 Ga0207649_10000009 Ga0207649_10000009238 97
259 3300025920 Ga0207649_10350271 Ga0207649_103502713 97
260 3300025923 Ga0207681_11318969 Ga0207681_113189691 97
261 3300025926 Ga0207659_10000010 Ga0207659_1000001064 97
262 3300025927 Ga0207687_10052479 Ga0207687_100524792 97
263 3300025927 Ga0207687_10082407 Ga0207687_100824074 97
264 3300025927 Ga0207687_10694306 Ga0207687_106943062 97
265 3300025929 Ga0207664_10100280 Ga0207664_101002805 97
266 3300025932 Ga0207690_10076663 Ga0207690_100766632 97
267 3300025932 Ga0207690_10141963 Ga0207690_101419632 97
268 3300025933 Ga0207706_10000012 Ga0207706_1000001266 97
269 3300025933 Ga0207706_11432935 Ga0207706_114329351 97
270 3300025934 Ga0207686_10000048 Ga0207686_1000004834 97
271 3300025935 Ga0207709_10404037 Ga0207709_104040372 97
272 3300025936 Ga0207670_10996910 Ga0207670_109969102 97
273 3300025937 Ga0207669_10209009 Ga0207669_102090093 97
274 3300025938 Ga0207704_10130732 Ga0207704_101307322 97
275 3300025944 Ga0207661_10000253 Ga0207661_1000025339 97
276 3300025944 Ga0207661_10007822 Ga0207661_100078226 97
277 3300025944 Ga0207661_10148671 Ga0207661_101486713 97
278 3300025945 Ga0207679_10293740 Ga0207679_102937402 97
279 3300025960 Ga0207651_10550904 Ga0207651_105509042 97
280 3300025961 Ga0207712_10096320 Ga0207712_100963204 97
281 3300025961 Ga0207712_10859340 Ga0207712_108593402 97
282 3300025972 Ga0207668_10019945 Ga0207668_100199454 97
283 3300025972 Ga0207668_10027927 Ga0207668_100279272 97
284 3300025972 Ga0207668_10409174 Ga0207668_104091742 97
285 3300025972 Ga0207668_10460501 Ga0207668_104605012 97
286 3300025981 Ga0207640_10000038 Ga0207640_1000003853 97
287 3300025981 Ga0207640_10404440 Ga0207640_104044402 97
288 3300025986 Ga0207658_10013822 Ga0207658_100138226 97
289 3300026023 Ga0207677_10000200 Ga0207677_1000020027 97
290 3300026023 Ga0207677_10039577 Ga0207677_100395773 97
291 3300026023 Ga0207677_10972498 Ga0207677_109724982 97
292 3300026035 Ga0207703_11322304 Ga0207703_113223042 97
293 3300026067 Ga0207678_10334328 Ga0207678_103343283 97
294 3300026075 Ga0207708_10047844 Ga0207708_100478443 97
295 3300026075 Ga0207708_10193019 Ga0207708_101930192 97
296 3300026075 Ga0207708_12002187 Ga0207708_120021872 97
297 3300026088 Ga0207641_10005198 Ga0207641_100051988 97
298 3300026088 Ga0207641_10703844 Ga0207641_107038442 97
299 3300026089 Ga0207648_10006385 Ga0207648_100063859 97
300 3300026089 Ga0207648_10801368 Ga0207648_108013682 97
301 3300026089 Ga0207648_11083934 Ga0207648_110839342 97
302 3300026095 Ga0207676_10000195 Ga0207676_1000019525 97
303 3300026116 Ga0207674_10107055 Ga0207674_101070555 97
304 3300026121 Ga0207683_10011741 Ga0207683_100117415 97
305 3300026121 Ga0207683_10334641 Ga0207683_103346412 97
306 3300026142 Ga0207698_10068043 Ga0207698_100680432 97
307 3300026142 Ga0207698_10526067 Ga0207698_105260672 97
308 3300026142 Ga0207698_10643432 Ga0207698_106434322 97
309 3300027866 Ga0209813_10106604 Ga0209813_101066042 97
310 3300027907 Ga0207428_10053592 Ga0207428_100535923 97
311 3300028379 Ga0268266_10009710 Ga0268266_100097103 97
312 3300028379 Ga0268266_10113867 Ga0268266_101138674 97
313 3300028379 Ga0268266_10626190 Ga0268266_106261901 97
314 3300028380 Ga0268265_10001136 Ga0268265_100011368 97
315 3300028380 Ga0268265_10726034 Ga0268265_107260342 97
316 3300028381 Ga0268264_10238155 Ga0268264_102381552 97
317 3300028381 Ga0268264_11502190 Ga0268264_115021902 97
318 3300028381 Ga0268264_12015981 Ga0268264_120159812 97
319 3300028556 Ga0265337_1000807 Ga0265337_10008071 97
320 3300028558 Ga0265326_10000252 Ga0265326_1000025212 97
321 3300028563 Ga0265319_1044415 Ga0265319_10444152 97
322 3300028573 Ga0265334_10116393 Ga0265334_101163932 97
323 3300028573 Ga0265334_10283867 Ga0265334_102838671 97
324 3300028654 Ga0265322_10000001 Ga0265322_10000001372 97
325 3300028666 Ga0265336_10004887 Ga0265336_100048874 97
326 3300028800 Ga0265338_10284399 Ga0265338_102843991 97
327 3300029957 Ga0265324_10000498 Ga0265324_100004982 97
328 3300031238 Ga0265332_10017744 Ga0265332_100177442 97
329 3300031239 Ga0265328_10001094 Ga0265328_100010942 97
330 3300031240 Ga0265320_10000002 Ga0265320_10000002371 97
331 3300031242 Ga0265329_10010170 Ga0265329_100101703 97
332 3300031249 Ga0265339_10033137 Ga0265339_100331372 97
333 3300031250 Ga0265331_10008961 Ga0265331_100089612 97
334 3300031251 Ga0265327_10000011 Ga0265327_10000011371 97
335 3300031548 Ga0307408_100304669 Ga0307408_1003046692 97
336 3300031711 Ga0265314_10000062 Ga0265314_10000062105 97
337 3300032126 Ga0307415_100001241 Ga0307415_1000012418 97
338 3300035170 Ga0373943_0224989 Ga0373943_0224989_405_701 97
339 3300035241 Ga0373961_0280663 Ga0373961_0280663_10_324 97
340 3300035398 Ga0316574_0035851 Ga0316574_0035851_556_849 97
341 3300035725 Ga0373947_0862950 Ga0373947_0862950_29_343 97
342 3300037312 Ga0395899_0019253 Ga0395899_0019253_4609_4926 97
343 3300037418 Ga0395900_0240995 Ga0395900_0240995_981_1295 97
344 3300037418 Ga0395900_0325411 Ga0395900_0325411_592_909 97
345 3300037466 Ga0395898_0001408 Ga0395898_0001408_1183_1500 97
346 3300037466 Ga0395898_0178368 Ga0395898_0178368_168_482 97
347 3300037466 Ga0395898_1093279 Ga0395898_1093279_187_501 97
348 3300037471 Ga0395905_0013982 Ga0395905_0013982_1622_1939 97
349 3300037471 Ga0395905_0149279 Ga0395905_0149279_689_1003 97
350 3300038443 Ga0395901_0004783 Ga0395901_0004783_512_829 97
351 3300038443 Ga0395901_0200958 Ga0395901_0200958_481_795 97
352 3300038443 Ga0395901_1530705 Ga0395901_1530705_159_473 97
353 3300038996 Ga0242420_039261 Ga0242420_039261_284_595 97
354 3300041463 Ga0451804_0586164 Ga0451804_0586164_19_333 97
355 3300041486 Ga0451807_2276071 Ga0451807_2276071_629_922 97
356 3300041494 Ga0451837_1359903 Ga0451837_1359903_247_540 97
357 3300041511 Ga0451855_0011574 Ga0451855_0011574_239_532 97
358 3300041512 Ga0451853_2385083 Ga0451853_2385083_166_480 97
359 3300044706 Ga0466964_0249778 Ga0466964_0249778_293_604 97
360 3300044842 Ga0466957_0287140 Ga0466957_0287140_548_841 97
361 3300046454 Ga0495592_0392807 Ga0495592_0392807_543_836 97
362 3300046455 Ga0495603_0000016 Ga0495603_0000016_2657_2950 97
363 3300046455 Ga0495603_0117873 Ga0495603_0117873_795_1109 97
364 3300046459 Ga0495629_0001726 Ga0495629_0001726_13389_13682 97
365 3300046459 Ga0495629_0071888 Ga0495629_0071888_1724_2017 97
366 3300046459 Ga0495629_0505314 Ga0495629_0505314_54_368 97
367 3300046459 Ga0495629_1028965 Ga0495629_1028965_113_406 97
368 3300046461 Ga0495641_0007825 Ga0495641_0007825_4124_4417 97
369 3300046461 Ga0495641_0143819 Ga0495641_0143819_540_854 97
370 3300046473 Ga0495582_0162122 Ga0495582_0162122_92_406 97
371 3300046507 Ga0495606_0000072 Ga0495606_0000072_14072_14365 97
372 3300046512 Ga0495610_0104506 Ga0495610_0104506_746_1039 97
373 3300046517 Ga0495630_0000020 Ga0495630_0000020_85173_85466 97
374 3300046517 Ga0495630_0137874 Ga0495630_0137874_425_721 97
375 3300046523 Ga0495644_0003786 Ga0495644_0003786_4947_5240 97
376 3300046526 Ga0495666_0346009 Ga0495666_0346009_16_330 97
377 3300046533 Ga0495640_0704543 Ga0495640_0704543_104_400 97
378 3300046536 Ga0495587_0758295 Ga0495587_0758295_109_402 97
379 3300046537 Ga0495598_0056702 Ga0495598_0056702_206_499 97
380 3300046559 Ga0495667_0410266 Ga0495667_0410266_74_367 97
381 3300046660 Ga0495625_0568084 Ga0495625_0568084_124_417 97
382 3300046663 Ga0495635_0100682 Ga0495635_0100682_1034_1330 97
383 3300046663 Ga0495635_0188788 Ga0495635_0188788_384_677 97
384 3300046674 Ga0495588_0000134 Ga0495588_0000134_16397_16690 97
385 3300046681 Ga0495647_0000156 Ga0495647_0000156_8072_8365 97
386 3300046681 Ga0495647_0032967 Ga0495647_0032967_1220_1534 97
387 3300046689 Ga0495613_0000801 Ga0495613_0000801_14807_15100 97
388 3300046690 Ga0495624_0000647 Ga0495624_0000647_14595_14888 97
389 3300046690 Ga0495624_0118680 Ga0495624_0118680_265_561 97
390 3300046690 Ga0495624_0404917 Ga0495624_0404917_253_546 97
391 3300047315 Ga0495581_0041693 Ga0495581_0041693_2178_2492 97
392 3300047320 Ga0495672_0054930 Ga0495672_0054930_736_1041 97
393 3300047321 Ga0495676_0034423 Ga0495676_0034423_173_487 97
394 3300047321 Ga0495676_0210851 Ga0495676_0210851_949_1242 97
395 3300047321 Ga0495676_0255640 Ga0495676_0255640_816_1109 97
396 3300047321 Ga0495676_0373998 Ga0495676_0373998_381_674 97
397 3300047322 Ga0495680_0004286 Ga0495680_0004286_9190_9489 97
398 3300047322 Ga0495680_0087866 Ga0495680_0087866_509_802 97
399 3300047322 Ga0495680_0162728 Ga0495680_0162728_710_1003 97
400 3300048089 Ga0495614_0348313 Ga0495614_0348313_353_667 97
401 3300048903 Ga0496100_0003241 Ga0496100_0003241_6576_6890 97
402 3300048904 Ga0496101_0045653 Ga0496101_0045653_880_1194 97
403 3300048905 Ga0496102_0000115 Ga0496102_0000115_106140_106433 97
404 3300048905 Ga0496102_0033079 Ga0496102_0033079_2394_2708 97
405 3300048905 Ga0496102_0436598 Ga0496102_0436598_861_1172 97
406 3300048905 Ga0496102_0553888 Ga0496102_0553888_452_757 97
407 3300048905 Ga0496102_1042455 Ga0496102_1042455_227_541 97
408 3300048906 Ga0496103_0000008 Ga0496103_0000008_113165_113458 97
409 3300048906 Ga0496103_0005173 Ga0496103_0005173_6779_7093 97
410 3300048906 Ga0496103_0196322 Ga0496103_0196322_202_516 97
411 3300048907 Ga0496104_0000004 Ga0496104_0000004_349748_350041 97
412 3300048907 Ga0496104_0380101 Ga0496104_0380101_457_750 97
413 3300048907 Ga0496104_1377168 Ga0496104_1377168_134_448 97
414 3300048908 Ga0496105_0000001 Ga0496105_0000001_291790_292083 97
415 3300048908 Ga0496105_0199680 Ga0496105_0199680_133_447 97
416 3300048909 Ga0496106_0006555 Ga0496106_0006555_4718_5032 97
417 3300048909 Ga0496106_0192776 Ga0496106_0192776_869_1180 97
418 3300048910 Ga0496107_0018938 Ga0496107_0018938_1667_1981 97
419 3300048910 Ga0496107_0039557 Ga0496107_0039557_2258_2569 97
420 3300048910 Ga0496107_0268895 Ga0496107_0268895_569_874 97
421 3300048911 Ga0496108_0174293 Ga0496108_0174293_869_1183 97
422 3300048912 Ga0496109_0111597 Ga0496109_0111597_1472_1786 97
423 3300048913 Ga0496110_0001510 Ga0496110_0001510_2601_2894 97
424 3300048913 Ga0496110_0021318 Ga0496110_0021318_770_1084 97
425 3300048913 Ga0496110_0270238 Ga0496110_0270238_158_451 97
426 3300048914 Ga0496111_0000009 Ga0496111_0000009_79693_79986 97
427 3300048914 Ga0496111_0017476 Ga0496111_0017476_1644_1958 97
428 3300048914 Ga0496111_0229400 Ga0496111_0229400_1026_1319 97
429 3300048915 Ga0496112_0003135 Ga0496112_0003135_3747_4061 97
430 3300048916 Ga0496113_0023007 Ga0496113_0023007_870_1184 97
431 3300048917 Ga0496114_0013450 Ga0496114_0013450_4053_4367 97
432 3300048917 Ga0496114_0620830 Ga0496114_0620830_610_903 97
433 3300048917 Ga0496114_1310020 Ga0496114_1310020_197_490 97
434 3300048918 Ga0496115_0012444 Ga0496115_0012444_5523_5816 97
435 3300048918 Ga0496115_0077192 Ga0496115_0077192_1707_2021 97
436 3300048922 Ga0496119_0005911 Ga0496119_0005911_7256_7549 97
437 3300048923 Ga0496120_0141614 Ga0496120_0141614_104_397 97
438 3300049568 Ga0501031_0197227 Ga0501031_0197227_78_395 97
439 3300049568 Ga0501031_0918858 Ga0501031_0918858_174_491 97
440 3300049570 Ga0501033_0226434 Ga0501033_0226434_61_369 97
441 3300049572 Ga0501036_0140288 Ga0501036_0140288_818_1135 97
442 3300049574 Ga0501038_0355219 Ga0501038_0355219_318_626 97
443 3300049575 Ga0501039_0231756 Ga0501039_0231756_838_1146 97
444 3300049576 Ga0501040_1128466 Ga0501040_1128466_13_330 97
445 3300049577 Ga0501041_0153342 Ga0501041_0153342_803_1120 97
446 3300049577 Ga0501041_0649779 Ga0501041_0649779_250_567 97
447 3300049578 Ga0501042_0180552 Ga0501042_0180552_1190_1507 97
448 3300049578 Ga0501042_0607065 Ga0501042_0607065_79_396 97
449 3300049578 Ga0501042_0968291 Ga0501042_0968291_39_332 97
450 3300049580 Ga0501046_0794413 Ga0501046_0794413_329_646 97
451 3300049582 Ga0501048_0113075 Ga0501048_0113075_192_500 97
452 3300049582 Ga0501048_0406323 Ga0501048_0406323_332_649 97
453 3300049582 Ga0501048_0552602 Ga0501048_0552602_378_695 97
454 3300049582 Ga0501048_0700740 Ga0501048_0700740_107_400 97
455 3300049584 Ga0501068_0245467 Ga0501068_0245467_651_959 97
456 3300049584 Ga0501068_0736809 Ga0501068_0736809_152_469 97
457 3300049586 Ga0501070_0397013 Ga0501070_0397013_406_723 97
458 3300049586 Ga0501070_1306118 Ga0501070_1306118_210_518 97
459 3300049587 Ga0501071_0106318 Ga0501071_0106318_1558_1875 97
460 3300049587 Ga0501071_0140618 Ga0501071_0140618_1041_1349 97
461 3300049587 Ga0501071_0382511 Ga0501071_0382511_177_470 97
462 3300049588 Ga0501072_0115365 Ga0501072_0115365_1362_1679 97
463 3300049588 Ga0501072_0115413 Ga0501072_0115413_383_700 97
464 3300049588 Ga0501072_0289943 Ga0501072_0289943_123_440 97
465 3300049588 Ga0501072_1107092 Ga0501072_1107092_61_378 97
466 3300049588 Ga0501072_1531061 Ga0501072_1531061_39_332 97
467 3300049590 Ga0501074_0178944 Ga0501074_0178944_937_1254 97
468 3300049590 Ga0501074_0476818 Ga0501074_0476818_374_691 97
469 3300049590 Ga0501074_0862285 Ga0501074_0862285_75_368 97
470 3300049590 Ga0501074_1092053 Ga0501074_1092053_110_427 97
471 3300049591 Ga0501075_0009392 Ga0501075_0009392_836_1129 97
472 3300049591 Ga0501075_0065292 Ga0501075_0065292_1514_1831 97
473 3300049591 Ga0501075_0275108 Ga0501075_0275108_217_534 97
474 3300049591 Ga0501075_0353514 Ga0501075_0353514_583_900 97
475 3300049591 Ga0501075_0480444 Ga0501075_0480444_354_671 97
476 3300049592 Ga0501076_0111839 Ga0501076_0111839_1150_1467 97
477 3300049592 Ga0501076_0621651 Ga0501076_0621651_533_841 97
478 3300049592 Ga0501076_0660828 Ga0501076_0660828_432_749 97
479 3300049593 Ga0501077_0741094 Ga0501077_0741094_197_514 97
480 3300049741 Ga0501079_0061586 Ga0501079_0061586_1139_1456 97
481 3300049741 Ga0501079_0400147 Ga0501079_0400147_698_1015 97
482 3300049743 Ga0501081_0341470 Ga0501081_0341470_632_949 97
483 3300049743 Ga0501081_0367379 Ga0501081_0367379_223_540 97
484 3300049743 Ga0501081_0398740 Ga0501081_0398740_377_694 97
485 3300049743 Ga0501081_1153049 Ga0501081_1153049_182_475 97
486 3300049824 Ga0501045_0061312 Ga0501045_0061312_1925_2233 97
487 3300049824 Ga0501045_0252710 Ga0501045_0252710_829_1122 97
488 3300049824 Ga0501045_0314229 Ga0501045_0314229_47_364 97
489 3300050490 nmdc:mga03n38_140808_c1 nmdc:mga03n38_140808_c1_149_463 97
490 3300050490 nmdc:mga03n38_240000_c1 nmdc:mga03n38_240000_c1_133_444 97
491 3300050490 nmdc:mga03n38_919781_c1 nmdc:mga03n38_919781_c1_16_330 97
492 3300050491 nmdc:mga00v17_15328_c1 nmdc:mga00v17_15328_c1_3109_3426 97
493 3300050491 nmdc:mga00v17_36527_c1 nmdc:mga00v17_36527_c1_1610_1924 97
494 3300050492 nmdc:mga0yw44_206536_c1 nmdc:mga0yw44_206536_c1_782_1096 97
495 3300050492 nmdc:mga0yw44_2428_c2 nmdc:mga0yw44_2428_c2_4728_5042 97
496 3300050492 nmdc:mga0yw44_3349_c1 nmdc:mga0yw44_3349_c1_1637_1954 97
497 3300050492 nmdc:mga0yw44_5644_c1 nmdc:mga0yw44_5644_c1_2511_2825 97
498 3300050495 nmdc:mga04h51_253280_c1 nmdc:mga04h51_253280_c1_160_474 97
499 3300050507 nmdc:mga05p37_590184_c1 nmdc:mga05p37_590184_c1_525_836 97
500 3300050507 nmdc:mga05p37_853842_c1 nmdc:mga05p37_853842_c1_350_661 97
501 3300050509 nmdc:mga0qj67_273240_c1 nmdc:mga0qj67_273240_c1_987_1304 97
502 3300050510 nmdc:mga06r32_9219_c1 nmdc:mga06r32_9219_c1_4478_4792 97
503 3300050511 nmdc:mga08y16_1757707_c1 nmdc:mga08y16_1757707_c1_193_507 97
504 3300050511 nmdc:mga08y16_58359_c1 nmdc:mga08y16_58359_c1_2483_2797 97
505 3300050511 nmdc:mga08y16_9469_c1 nmdc:mga08y16_9469_c1_2595_2909 97
506 3300050512 nmdc:mga0n895_3781_c1 nmdc:mga0n895_3781_c1_2159_2473 97
507 3300050512 nmdc:mga0n895_906732_c1 nmdc:mga0n895_906732_c1_307_618 97
508 3300050513 nmdc:mga0rr50_13332_c1 nmdc:mga0rr50_13332_c1_488_799 97
509 3300050515 nmdc:mga0a205_72741_c1 nmdc:mga0a205_72741_c1_750_1061 97
510 3300050515 nmdc:mga0a205_98154_c1 nmdc:mga0a205_98154_c1_1567_1881 97
511 3300053077 Ga0495601_0000013 Ga0495601_0000013_29963_30256 97
512 3300053077 Ga0495601_0256051 Ga0495601_0256051_467_760 97
513 3300053077 Ga0495601_0277206 Ga0495601_0277206_402_698 97
514 3300053078 Ga0495612_0088014 Ga0495612_0088014_245_538 97
515 3300053083 Ga0495655_0000001 Ga0495655_0000001_286237_286530 97
516 3300053085 Ga0495619_0000157 Ga0495619_0000157_38283_38576 97
517 3300053085 Ga0495619_0003131 Ga0495619_0003131_152_448 97
518 3300053094 Ga0500566_0185740 Ga0500566_0185740_395_688 97
519 3300053129 Ga0500628_000033 Ga0500628_000033_38268_38561 97
520 3300054114 Ga0501084_0045121 Ga0501084_0045121_2090_2407 97
521 3300054114 Ga0501084_0225936 Ga0501084_0225936_1013_1330 97
522 3300054114 Ga0501084_0399577 Ga0501084_0399577_130_447 97
523 3300054114 Ga0501084_1202984 Ga0501084_1202984_142_459 97
524 3300060353 Ga0501082_0931684 Ga0501082_0931684_237_554 97
525 3300061734 Ga0530510_0041671 Ga0530510_0041671_1383_1700 97
526 3300061734 Ga0530510_0060860 Ga0530510_0060860_1831_2139 97
527 3300061734 Ga0530510_0204064 Ga0530510_0204064_154_471 97
528 3300061734 Ga0530510_0470631 Ga0530510_0470631_358_675 97
529 3300061734 Ga0530510_0492166 Ga0530510_0492166_282_599 97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9291 2 94
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9187 3 95
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9037 1 91
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.9036 2 90
3qmq-assembly2.cif.gz_B crystal structure of e. coli lsrg 0.8983 1 96
ID Description Score Start End Superfamily
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8983 1 96 3.30.70.100
2omoE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8956 4 95 3.30.70.100
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8883 2 91 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8858 2 91 3.30.70.100
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8821 2 93 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A838V4U8-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9956 1 97
AF-A0A7V9S2F7-F1-model_v4 ABM domain-containing protein 0.9762 3 97
AF-A0A7W0RCL5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9701 3 97
AF-A0A6J7CXM4-F1-model_v4 Unannotated protein 0.9504 1 97
AF-A0A7W1NI50-F1-model_v4 deleted 0.9481 1 68

Feature Viewer

pLDDT pTM Quality
96.35 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map