F459781
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 270 | 521 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100488907|Ga0068854_1004889071 |
| Length | 226 |
| Sequence | MAQIAEDLFLLLLDNASAQPGLDRARRERVLSGAVLMDLAYACRIRPAMAGESVEPGRLVALAVPGPMDPVVAPAFELLQRRPLRPATAVKRLSKHTEEKLANYLEYTGQIRRVRLNSKLLSHPYAWPLTNRERVGHARSALLAALFDGRPPAPPTAAIISLLHAVDGLGALLSLNDRGWRWVHARAGEIASGSWVDDYPTALPEVNLAITASAVREALVVCPVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 5 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 6 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 7 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 8 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 167 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 178 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 179 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 182 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 183 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 184 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 185 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 186 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 187 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 188 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 189 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 195 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 196 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 232 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 233 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 234 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 235 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 236 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 237 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 238 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 239 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 240 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 241 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 254 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 255 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 258 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 259 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 266 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 267 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 268 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 269 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 270 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 0 |
| Isolates | 1.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.48 |
| Nodule | 0.19 |
| Rhizoplane | 13.61 |
| Rhizosphere | 66.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1008668 | 3300001977 | Bacteria | 1532 |
| 2 | JGI24743J22301_10001109 | 3300001991 | Bacteria | 3599 |
| 3 | JGI24744J21845_10016468 | 3300002077 | Bacteria | 1471 |
| 4 | JGI24751J29686_10006698 | 3300002459 | Bacteria | 2348 |
| 5 | Ga0055540_1000043 | 3300003792 | Bacteria | 155228 |
| 6 | Ga0055540_1000702 | 3300003792 | Bacteria | 23030 |
| 7 | Ga0055540_1000980 | 3300003792 | Bacteria | 18425 |
| 8 | Ga0055540_1009458 | 3300003792 | Bacteria | 3362 |
| 9 | Ga0070676_10024123 | 3300005328 | Bacteria | 3423 |
| 10 | Ga0070683_100055090 | 3300005329 | Bacteria | 3689 |
| 11 | Ga0070690_100029432 | 3300005330 | Bacteria | 3407 |
| 12 | Ga0070677_10027081 | 3300005333 | Bacteria | 2155 |
| 13 | Ga0068869_100107462 | 3300005334 | Bacteria | 2118 |
| 14 | Ga0068869_100500864 | 3300005334 | Bacteria | 1014 |
| 15 | Ga0068868_100001734 | 3300005338 | Bacteria | 14943 |
| 16 | Ga0068868_100025807 | 3300005338 | Bacteria | 4473 |
| 17 | Ga0070689_100209842 | 3300005340 | Bacteria | 1593 |
| 18 | Ga0070668_100016270 | 3300005347 | Bacteria | 5563 |
| 19 | Ga0070668_100035317 | 3300005347 | Bacteria | 3812 |
| 20 | Ga0070669_100001560 | 3300005353 | Bacteria | 16596 |
| 21 | Ga0070669_100207630 | 3300005353 | Bacteria | 1544 |
| 22 | Ga0070669_100713424 | 3300005353 | Bacteria | 848 |
| 23 | Ga0070671_100002251 | 3300005355 | Bacteria | 14896 |
| 24 | Ga0070671_100092563 | 3300005355 | Bacteria | 2533 |
| 25 | Ga0070671_100470927 | 3300005355 | Bacteria | 1079 |
| 26 | Ga0070674_100001623 | 3300005356 | Bacteria | 12087 |
| 27 | Ga0070674_100292270 | 3300005356 | Bacteria | 1296 |
| 28 | Ga0070673_100109160 | 3300005364 | Bacteria | 2292 |
| 29 | Ga0070667_100000190 | 3300005367 | Bacteria | 73682 |
| 30 | Ga0070667_100000658 | 3300005367 | Bacteria | 33550 |
| 31 | Ga0070667_100014989 | 3300005367 | Bacteria | 6404 |
| 32 | Ga0070667_100047859 | 3300005367 | Bacteria | 3599 |
| 33 | Ga0070667_100071672 | 3300005367 | Bacteria | 2951 |
| 34 | Ga0070667_100923008 | 3300005367 | Bacteria | 813 |
| 35 | Ga0070709_10011186 | 3300005434 | Bacteria | 4992 |
| 36 | Ga0070713_100275235 | 3300005436 | Bacteria | 1543 |
| 37 | Ga0070710_10012792 | 3300005437 | Bacteria | 4179 |
| 38 | Ga0070701_10001036 | 3300005438 | Bacteria | 10124 |
| 39 | Ga0070711_100005803 | 3300005439 | Bacteria | 7412 |
| 40 | Ga0070711_100018139 | 3300005439 | Bacteria | 4489 |
| 41 | Ga0070711_100755347 | 3300005439 | Bacteria | 822 |
| 42 | Ga0070700_100057808 | 3300005441 | Bacteria | 2434 |
| 43 | Ga0070700_100192507 | 3300005441 | Bacteria | 1427 |
| 44 | Ga0070694_100029737 | 3300005444 | Bacteria | 3568 |
| 45 | Ga0070663_100027368 | 3300005455 | Bacteria | 3871 |
| 46 | Ga0070663_100084669 | 3300005455 | Bacteria | 2338 |
| 47 | Ga0070663_100443222 | 3300005455 | Bacteria | 1069 |
| 48 | Ga0070678_100000951 | 3300005456 | Bacteria | 14917 |
| 49 | Ga0070678_100239638 | 3300005456 | Bacteria | 1516 |
| 50 | Ga0070662_100015863 | 3300005457 | Bacteria | 5053 |
| 51 | Ga0068867_100001628 | 3300005459 | Bacteria | 15617 |
| 52 | Ga0070684_100123126 | 3300005535 | Bacteria | 2334 |
| 53 | Ga0070697_100642687 | 3300005536 | Bacteria | 934 |
| 54 | Ga0068853_100103388 | 3300005539 | Bacteria | 2521 |
| 55 | Ga0070672_100049966 | 3300005543 | Bacteria | 3256 |
| 56 | Ga0070686_100358953 | 3300005544 | Bacteria | 1097 |
| 57 | Ga0070695_100222383 | 3300005545 | Bacteria | 1361 |
| 58 | Ga0070696_100075314 | 3300005546 | Bacteria | 2381 |
| 59 | Ga0070693_100003536 | 3300005547 | Bacteria | 7287 |
| 60 | Ga0070665_100003854 | 3300005548 | Bacteria | 15870 |
| 61 | Ga0070665_100014251 | 3300005548 | Bacteria | 7984 |
| 62 | Ga0070665_100073934 | 3300005548 | Bacteria | 3414 |
| 63 | Ga0070665_100075325 | 3300005548 | Bacteria | 3382 |
| 64 | Ga0070665_100291312 | 3300005548 | Bacteria | 1635 |
| 65 | Ga0070704_100000104 | 3300005549 | Bacteria | 29724 |
| 66 | Ga0068854_100000198 | 3300005578 | Bacteria | 40596 |
| 67 | Ga0068854_100488907 | 3300005578 | Bacteria | 1034 |
| 68 | Ga0070702_100012280 | 3300005615 | Bacteria | 4286 |
| 69 | Ga0070702_100363600 | 3300005615 | Bacteria | 1023 |
| 70 | Ga0068852_100222165 | 3300005616 | Bacteria | 1797 |
| 71 | Ga0068852_100304780 | 3300005616 | Bacteria | 1543 |
| 72 | Ga0068859_100003525 | 3300005617 | Bacteria | 15932 |
| 73 | Ga0068859_100007646 | 3300005617 | Bacteria | 10982 |
| 74 | Ga0068859_100135370 | 3300005617 | Bacteria | 2536 |
| 75 | Ga0068859_100715821 | 3300005617 | Bacteria | 1091 |
| 76 | Ga0068864_100363782 | 3300005618 | Bacteria | 1368 |
| 77 | Ga0068864_100820276 | 3300005618 | Bacteria | 915 |
| 78 | Ga0068866_10222711 | 3300005718 | Bacteria | 1139 |
| 79 | Ga0068861_100035517 | 3300005719 | Bacteria | 3693 |
| 80 | Ga0068861_100068354 | 3300005719 | Bacteria | 2745 |
| 81 | Ga0068861_100080696 | 3300005719 | Bacteria | 2545 |
| 82 | Ga0068861_100086280 | 3300005719 | Bacteria | 2467 |
| 83 | Ga0068863_100000260 | 3300005841 | Bacteria | 55182 |
| 84 | Ga0068863_100005671 | 3300005841 | Bacteria | 12263 |
| 85 | Ga0068863_100822522 | 3300005841 | Bacteria | 927 |
| 86 | Ga0068858_100017445 | 3300005842 | Bacteria | 6734 |
| 87 | Ga0068858_100105923 | 3300005842 | Bacteria | 2624 |
| 88 | Ga0068860_100000099 | 3300005843 | Bacteria | 145436 |
| 89 | Ga0068860_100104257 | 3300005843 | Bacteria | 2707 |
| 90 | Ga0068860_100126558 | 3300005843 | Bacteria | 2449 |
| 91 | Ga0068862_100000086 | 3300005844 | Bacteria | 110489 |
| 92 | Ga0068862_100015564 | 3300005844 | Bacteria | 6317 |
| 93 | Ga0068862_100381718 | 3300005844 | Bacteria | 1314 |
| 94 | Ga0081455_10019845 | 3300005937 | Bacteria | 6348 |
| 95 | Ga0075365_10040337 | 3300006038 | Bacteria | 3044 |
| 96 | Ga0075365_10043712 | 3300006038 | Bacteria | 2933 |
| 97 | Ga0075365_10110800 | 3300006038 | Bacteria | 1886 |
| 98 | Ga0075368_10088826 | 3300006042 | Bacteria | 1263 |
| 99 | Ga0075363_100005604 | 3300006048 | Bacteria | 5609 |
| 100 | Ga0075363_100011207 | 3300006048 | Bacteria | 4287 |
| 101 | Ga0075363_100011781 | 3300006048 | Bacteria | 4196 |
| 102 | Ga0075363_100018588 | 3300006048 | Bacteria | 3466 |
| 103 | Ga0075363_100027946 | 3300006048 | Bacteria | 2897 |
| 104 | Ga0075363_100111288 | 3300006048 | Bacteria | 1522 |
| 105 | Ga0075364_10001316 | 3300006051 | Bacteria | 13362 |
| 106 | Ga0075364_10005926 | 3300006051 | Bacteria | 7144 |
| 107 | Ga0075364_10019759 | 3300006051 | Bacteria | 4231 |
| 108 | Ga0075364_10028678 | 3300006051 | Bacteria | 3565 |
| 109 | Ga0075364_10212769 | 3300006051 | Bacteria | 1311 |
| 110 | Ga0070715_10128011 | 3300006163 | Bacteria | 1219 |
| 111 | Ga0070716_100010650 | 3300006173 | Bacteria | 4615 |
| 112 | Ga0070716_100141516 | 3300006173 | Bacteria | 1535 |
| 113 | Ga0075362_10111175 | 3300006177 | Bacteria | 1290 |
| 114 | Ga0075367_10024689 | 3300006178 | Bacteria | 3391 |
| 115 | Ga0075367_10031003 | 3300006178 | Bacteria | 3069 |
| 116 | Ga0075369_10006736 | 3300006186 | Bacteria | 4357 |
| 117 | Ga0075369_10013662 | 3300006186 | Bacteria | 3229 |
| 118 | Ga0075369_10155246 | 3300006186 | Bacteria | 1047 |
| 119 | Ga0097621_100571153 | 3300006237 | Bacteria | 1031 |
| 120 | Ga0097621_100890293 | 3300006237 | Bacteria | 829 |
| 121 | Ga0075370_10012251 | 3300006353 | Bacteria | 4526 |
| 122 | Ga0075370_10014423 | 3300006353 | Bacteria | 4215 |
| 123 | Ga0075370_10094810 | 3300006353 | Bacteria | 1723 |
| 124 | Ga0075428_100004646 | 3300006844 | Bacteria | 15196 |
| 125 | Ga0075430_100305521 | 3300006846 | Bacteria | 1316 |
| 126 | Ga0075431_100067323 | 3300006847 | Bacteria | 3697 |
| 127 | Ga0068865_100026719 | 3300006881 | Bacteria | 3807 |
| 128 | Ga0068865_100268582 | 3300006881 | Bacteria | 1353 |
| 129 | Ga0097620_100003525 | 3300006931 | Bacteria | 15932 |
| 130 | Ga0097620_100007646 | 3300006931 | Bacteria | 10982 |
| 131 | Ga0097620_100135363 | 3300006931 | Bacteria | 2536 |
| 132 | Ga0097620_100715736 | 3300006931 | Bacteria | 1091 |
| 133 | Ga0099795_10013890 | 3300007788 | Bacteria | 2483 |
| 134 | Ga0105250_10009943 | 3300009092 | Bacteria | 3990 |
| 135 | Ga0111539_10643054 | 3300009094 | Bacteria | 1235 |
| 136 | Ga0105245_10013909 | 3300009098 | Bacteria | 7008 |
| 137 | Ga0105245_10039068 | 3300009098 | Bacteria | 4224 |
| 138 | Ga0105245_10092421 | 3300009098 | Bacteria | 2786 |
| 139 | Ga0105245_10909133 | 3300009098 | Bacteria | 922 |
| 140 | Ga0105247_10000051 | 3300009101 | Bacteria | 145981 |
| 141 | Ga0105247_10002033 | 3300009101 | Bacteria | 14016 |
| 142 | Ga0105247_10239659 | 3300009101 | Bacteria | 1235 |
| 143 | Ga0114129_10038950 | 3300009147 | Bacteria | 6700 |
| 144 | Ga0105243_10004906 | 3300009148 | Bacteria | 10489 |
| 145 | Ga0105243_10031725 | 3300009148 | Bacteria | 4076 |
| 146 | Ga0105241_10237635 | 3300009174 | Bacteria | 1539 |
| 147 | Ga0105242_10004844 | 3300009176 | Bacteria | 10423 |
| 148 | Ga0105242_10081882 | 3300009176 | Bacteria | 2700 |
| 149 | Ga0105248_10000281 | 3300009177 | Bacteria | 60208 |
| 150 | Ga0105248_10012267 | 3300009177 | Bacteria | 9450 |
| 151 | Ga0105248_10064198 | 3300009177 | Bacteria | 4122 |
| 152 | Ga0105237_10006641 | 3300009545 | Bacteria | 12785 |
| 153 | Ga0105237_10042955 | 3300009545 | Bacteria | 4556 |
| 154 | Ga0105237_10626982 | 3300009545 | Bacteria | 1082 |
| 155 | Ga0105238_10071986 | 3300009551 | Bacteria | 3454 |
| 156 | Ga0105238_10548710 | 3300009551 | Bacteria | 1160 |
| 157 | Ga0105249_10000020 | 3300009553 | Bacteria | 260634 |
| 158 | Ga0105249_10003714 | 3300009553 | Bacteria | 13165 |
| 159 | Ga0105249_10110702 | 3300009553 | Bacteria | 2595 |
| 160 | Ga0105239_10012351 | 3300010375 | Bacteria | 9512 |
| 161 | Ga0105239_10042126 | 3300010375 | Bacteria | 5003 |
| 162 | Ga0105239_10079607 | 3300010375 | Bacteria | 3605 |
| 163 | Ga0105246_10601833 | 3300011119 | Bacteria | 950 |
| 164 | Ga0157374_10035687 | 3300013296 | Bacteria | 4550 |
| 165 | Ga0157374_10702745 | 3300013296 | Bacteria | 1024 |
| 166 | Ga0157378_10004748 | 3300013297 | Bacteria | 11910 |
| 167 | Ga0157378_10149774 | 3300013297 | Bacteria | 2173 |
| 168 | Ga0163162_10009938 | 3300013306 | Bacteria | 9256 |
| 169 | Ga0163162_10611665 | 3300013306 | Bacteria | 1215 |
| 170 | Ga0157372_10005118 | 3300013307 | Bacteria | 13933 |
| 171 | Ga0157372_10378192 | 3300013307 | Bacteria | 1650 |
| 172 | Ga0157375_10008395 | 3300013308 | Bacteria | 9046 |
| 173 | Ga0157375_10378368 | 3300013308 | Bacteria | 1582 |
| 174 | Ga0157375_10494603 | 3300013308 | Bacteria | 1387 |
| 175 | Ga0157375_10801365 | 3300013308 | Bacteria | 1091 |
| 176 | Ga0163163_10009624 | 3300014325 | Bacteria | 8641 |
| 177 | Ga0163163_10014582 | 3300014325 | Bacteria | 7230 |
| 178 | Ga0157380_10006508 | 3300014326 | Bacteria | 8236 |
| 179 | Ga0182008_10184155 | 3300014497 | Bacteria | 1058 |
| 180 | Ga0157377_10055109 | 3300014745 | Bacteria | 2253 |
| 181 | Ga0157377_10376452 | 3300014745 | Bacteria | 960 |
| 182 | Ga0157379_10008800 | 3300014968 | Bacteria | 8805 |
| 183 | Ga0157379_10181415 | 3300014968 | Bacteria | 1902 |
| 184 | Ga0163161_10003327 | 3300017792 | Bacteria | 11267 |
| 185 | Ga0163161_10048455 | 3300017792 | Bacteria | 3068 |
| 186 | Ga0163161_10207593 | 3300017792 | Bacteria | 1512 |
| 187 | Ga0213876_10034214 | 3300021384 | Bacteria | 2680 |
| 188 | Ga0213875_10033385 | 3300021388 | Bacteria | 2430 |
| 189 | Ga0209673_1005791 | 3300025273 | Bacteria | 6142 |
| 190 | Ga0209051_1000108 | 3300025303 | Bacteria | 155280 |
| 191 | Ga0209051_1000337 | 3300025303 | Bacteria | 70482 |
| 192 | Ga0209051_1001005 | 3300025303 | Bacteria | 27084 |
| 193 | Ga0207696_1018610 | 3300025711 | Bacteria | 2277 |
| 194 | Ga0207692_10105812 | 3300025898 | Bacteria | 1552 |
| 195 | Ga0207642_10000267 | 3300025899 | Bacteria | 15671 |
| 196 | Ga0207642_10149034 | 3300025899 | Bacteria | 1243 |
| 197 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 198 | Ga0207710_10032856 | 3300025900 | Bacteria | 2274 |
| 199 | Ga0207688_10008080 | 3300025901 | Bacteria | 5723 |
| 200 | Ga0207688_10019117 | 3300025901 | Bacteria | 3730 |
| 201 | Ga0207647_10028903 | 3300025904 | Bacteria | 3595 |
| 202 | Ga0207685_10077724 | 3300025905 | Bacteria | 1364 |
| 203 | Ga0207699_10137763 | 3300025906 | Bacteria | 1600 |
| 204 | Ga0207645_10073119 | 3300025907 | Bacteria | 2195 |
| 205 | Ga0207671_10087402 | 3300025914 | Bacteria | 2344 |
| 206 | Ga0207671_10156722 | 3300025914 | Bacteria | 1762 |
| 207 | Ga0207693_10000430 | 3300025915 | Bacteria | 38189 |
| 208 | Ga0207693_10006063 | 3300025915 | Bacteria | 10010 |
| 209 | Ga0207663_10006540 | 3300025916 | Bacteria | 5976 |
| 210 | Ga0207657_10025944 | 3300025919 | Bacteria | 5395 |
| 211 | Ga0207657_10326445 | 3300025919 | Bacteria | 1213 |
| 212 | Ga0207652_10342346 | 3300025921 | Bacteria | 1350 |
| 213 | Ga0207681_10002745 | 3300025923 | Bacteria | 11145 |
| 214 | Ga0207681_10490089 | 3300025923 | Bacteria | 1005 |
| 215 | Ga0207694_10291796 | 3300025924 | Bacteria | 1341 |
| 216 | Ga0207694_10490804 | 3300025924 | Bacteria | 1028 |
| 217 | Ga0207687_10001991 | 3300025927 | Bacteria | 14042 |
| 218 | Ga0207687_10289358 | 3300025927 | Bacteria | 1316 |
| 219 | Ga0207700_10283271 | 3300025928 | Bacteria | 1426 |
| 220 | Ga0207664_10164583 | 3300025929 | Bacteria | 1894 |
| 221 | Ga0207644_10005098 | 3300025931 | Bacteria | 8579 |
| 222 | Ga0207644_10129202 | 3300025931 | Bacteria | 1932 |
| 223 | Ga0207690_10007060 | 3300025932 | Bacteria | 6667 |
| 224 | Ga0207706_10215748 | 3300025933 | Bacteria | 1681 |
| 225 | Ga0207670_10013622 | 3300025936 | Bacteria | 4801 |
| 226 | Ga0207669_10003498 | 3300025937 | Bacteria | 6794 |
| 227 | Ga0207669_10277900 | 3300025937 | Bacteria | 1261 |
| 228 | Ga0207704_10000321 | 3300025938 | Bacteria | 22424 |
| 229 | Ga0207704_10072162 | 3300025938 | Bacteria | 2193 |
| 230 | Ga0207665_10015862 | 3300025939 | Bacteria | 4944 |
| 231 | Ga0207665_10018381 | 3300025939 | Bacteria | 4593 |
| 232 | Ga0207691_10069377 | 3300025940 | Bacteria | 3184 |
| 233 | Ga0207711_10000364 | 3300025941 | Bacteria | 48006 |
| 234 | Ga0207711_10143131 | 3300025941 | Bacteria | 2152 |
| 235 | Ga0207689_10023094 | 3300025942 | Bacteria | 5223 |
| 236 | Ga0207689_10047080 | 3300025942 | Bacteria | 3562 |
| 237 | Ga0207661_10040444 | 3300025944 | Bacteria | 3665 |
| 238 | Ga0207667_10197156 | 3300025949 | Bacteria | 2066 |
| 239 | Ga0207667_10276943 | 3300025949 | Bacteria | 1715 |
| 240 | Ga0207651_10126327 | 3300025960 | Bacteria | 1949 |
| 241 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 242 | Ga0207712_10029548 | 3300025961 | Bacteria | 3678 |
| 243 | Ga0207668_10001252 | 3300025972 | Bacteria | 15141 |
| 244 | Ga0207668_10017900 | 3300025972 | Bacteria | 4449 |
| 245 | Ga0207668_10559622 | 3300025972 | Bacteria | 992 |
| 246 | Ga0207640_10024703 | 3300025981 | Bacteria | 3629 |
| 247 | Ga0207658_10001232 | 3300025986 | Bacteria | 20240 |
| 248 | Ga0207658_10009397 | 3300025986 | Bacteria | 6632 |
| 249 | Ga0207658_10086462 | 3300025986 | Bacteria | 2418 |
| 250 | Ga0207658_10242190 | 3300025986 | Bacteria | 1528 |
| 251 | Ga0207658_10538919 | 3300025986 | Bacteria | 1043 |
| 252 | Ga0207658_10791979 | 3300025986 | Bacteria | 860 |
| 253 | Ga0207703_10003382 | 3300026035 | Bacteria | 13397 |
| 254 | Ga0207703_10405499 | 3300026035 | Bacteria | 1266 |
| 255 | Ga0207639_10005886 | 3300026041 | Bacteria | 8308 |
| 256 | Ga0207678_10010154 | 3300026067 | Bacteria | 8263 |
| 257 | Ga0207678_10010796 | 3300026067 | Bacteria | 8024 |
| 258 | Ga0207678_10018387 | 3300026067 | Bacteria | 6137 |
| 259 | Ga0207678_10233960 | 3300026067 | Bacteria | 1573 |
| 260 | Ga0207708_10006037 | 3300026075 | Bacteria | 8978 |
| 261 | Ga0207641_10000445 | 3300026088 | Bacteria | 47406 |
| 262 | Ga0207641_10008412 | 3300026088 | Bacteria | 8527 |
| 263 | Ga0207641_10075567 | 3300026088 | Bacteria | 2909 |
| 264 | Ga0207641_10320828 | 3300026088 | Bacteria | 1469 |
| 265 | Ga0207648_10001738 | 3300026089 | Bacteria | 23842 |
| 266 | Ga0207648_10008737 | 3300026089 | Bacteria | 9763 |
| 267 | Ga0207676_10260385 | 3300026095 | Bacteria | 1566 |
| 268 | Ga0207676_10895178 | 3300026095 | Bacteria | 870 |
| 269 | Ga0207675_100060197 | 3300026118 | Bacteria | 3545 |
| 270 | Ga0207675_100065641 | 3300026118 | Bacteria | 3392 |
| 271 | Ga0207675_100109085 | 3300026118 | Bacteria | 2611 |
| 272 | Ga0207675_100111671 | 3300026118 | Bacteria | 2579 |
| 273 | Ga0207683_10014544 | 3300026121 | Bacteria | 6704 |
| 274 | Ga0207683_10039841 | 3300026121 | Bacteria | 4099 |
| 275 | Ga0207683_10276020 | 3300026121 | Bacteria | 1536 |
| 276 | Ga0207683_10476896 | 3300026121 | Bacteria | 1151 |
| 277 | Ga0207698_10179214 | 3300026142 | Bacteria | 1875 |
| 278 | Ga0209813_10007615 | 3300027866 | Bacteria | 2703 |
| 279 | Ga0268266_10002054 | 3300028379 | Bacteria | 22324 |
| 280 | Ga0268266_10049634 | 3300028379 | Bacteria | 3599 |
| 281 | Ga0268266_10081470 | 3300028379 | Bacteria | 2822 |
| 282 | Ga0268266_10526272 | 3300028379 | Bacteria | 1131 |
| 283 | Ga0268265_10000014 | 3300028380 | Bacteria | 330186 |
| 284 | Ga0268264_10000137 | 3300028381 | Bacteria | 176081 |
| 285 | Ga0268264_10001869 | 3300028381 | Bacteria | 19143 |
| 286 | Ga0265327_10000662 | 3300031251 | Bacteria | 55374 |
| 287 | Ga0307405_10569862 | 3300031731 | Bacteria | 919 |
| 288 | Ga0307413_10058299 | 3300031824 | Bacteria | 2366 |
| 289 | Ga0307413_10309337 | 3300031824 | Bacteria | 1202 |
| 290 | Ga0307410_10582332 | 3300031852 | Bacteria | 931 |
| 291 | Ga0307406_10457194 | 3300031901 | Bacteria | 1026 |
| 292 | Ga0307412_10022222 | 3300031911 | Bacteria | 3886 |
| 293 | Ga0307409_100241070 | 3300031995 | Bacteria | 1646 |
| 294 | Ga0307409_100643467 | 3300031995 | Bacteria | 1053 |
| 295 | Ga0307416_100071205 | 3300032002 | Bacteria | 2887 |
| 296 | Ga0307411_10192228 | 3300032005 | Bacteria | 1559 |
| 297 | Ga0307415_100010496 | 3300032126 | Bacteria | 5250 |
| 298 | Ga0373958_0062105 | 3300034819 | Bacteria | 812 |
| 299 | Ga0373959_0074166 | 3300034820 | Bacteria | 774 |
| 300 | Ga0373941_0029703 | 3300035115 | Bacteria | 1615 |
| 301 | Ga0373960_0016773 | 3300035121 | Bacteria | 1889 |
| 302 | Ga0373931_0033597 | 3300035691 | Bacteria | 2659 |
| 303 | Ga0373931_0269128 | 3300035691 | Bacteria | 1042 |
| 304 | Ga0373933_0394717 | 3300035724 | Bacteria | 902 |
| 305 | Ga0373947_0353499 | 3300035725 | Bacteria | 986 |
| 306 | Ga0373925_0547925 | 3300037068 | Bacteria | 951 |
| 307 | Ga0436364_0204668 | 3300037853 | Bacteria | 11549 |
| 308 | Ga0436361_1210779 | 3300039447 | Bacteria | 1525 |
| 309 | Ga0436363_0375672 | 3300039450 | Bacteria | 2485 |
| 310 | Ga0436363_1689608 | 3300039450 | Bacteria | 1091 |
| 311 | Ga0439466_0003909 | 3300041411 | Bacteria | 5746 |
| 312 | Ga0439466_0008306 | 3300041411 | Bacteria | 3913 |
| 313 | Ga0439466_0042416 | 3300041411 | Bacteria | 1515 |
| 314 | Ga0439465_0007839 | 3300041413 | Bacteria | 3383 |
| 315 | Ga0451795_1658859 | 3300041456 | Bacteria | 2345 |
| 316 | Ga0451806_337869 | 3300041462 | Bacteria | 905 |
| 317 | Ga0451855_0621036 | 3300041511 | Bacteria | 748 |
| 318 | Ga0439431_0000466 | 3300041997 | Bacteria | 8585 |
| 319 | Ga0439442_020862 | 3300042002 | Bacteria | 1358 |
| 320 | Ga0439445_0000791 | 3300042004 | Bacteria | 6652 |
| 321 | Ga0439445_0044251 | 3300042004 | Bacteria | 1189 |
| 322 | Ga0439445_0044749 | 3300042004 | Bacteria | 1183 |
| 323 | Ga0439448_0112850 | 3300042005 | Bacteria | 929 |
| 324 | Ga0439434_0001376 | 3300042435 | Bacteria | 7021 |
| 325 | Ga0439434_0015932 | 3300042435 | Bacteria | 2242 |
| 326 | Ga0439435_0131608 | 3300042436 | Bacteria | 791 |
| 327 | Ga0439459_0008449 | 3300042438 | Bacteria | 1760 |
| 328 | Ga0466969_0030153 | 3300044656 | Bacteria | 2765 |
| 329 | Ga0466972_0028426 | 3300044658 | Bacteria | 2758 |
| 330 | Ga0466965_0008459 | 3300044683 | Bacteria | 4762 |
| 331 | Ga0466965_0040561 | 3300044683 | Bacteria | 2292 |
| 332 | Ga0466965_0087672 | 3300044683 | Bacteria | 1580 |
| 333 | Ga0466965_0408994 | 3300044683 | Bacteria | 751 |
| 334 | Ga0466966_0255878 | 3300044684 | Bacteria | 1054 |
| 335 | Ga0466961_0055574 | 3300044693 | Bacteria | 2523 |
| 336 | Ga0466964_0044986 | 3300044706 | Bacteria | 1795 |
| 337 | Ga0466964_0233728 | 3300044706 | Bacteria | 898 |
| 338 | Ga0466971_0003465 | 3300044719 | Bacteria | 6737 |
| 339 | Ga0466968_0001090 | 3300044735 | Bacteria | 9612 |
| 340 | Ga0466970_0007705 | 3300044765 | Bacteria | 5403 |
| 341 | Ga0466970_0040912 | 3300044765 | Bacteria | 2462 |
| 342 | Ga0466957_0008089 | 3300044842 | Bacteria | 5966 |
| 343 | Ga0466957_0025888 | 3300044842 | Bacteria | 3478 |
| 344 | Ga0466957_0721122 | 3300044842 | Bacteria | 705 |
| 345 | Ga0466960_0365485 | 3300044901 | Bacteria | 825 |
| 346 | Ga0466959_0016742 | 3300045049 | Bacteria | 5364 |
| 347 | Ga0466959_0037597 | 3300045049 | Bacteria | 3577 |
| 348 | Ga0466967_0029824 | 3300045976 | Bacteria | 4571 |
| 349 | Ga0466967_0053339 | 3300045976 | Bacteria | 3553 |
| 350 | Ga0466967_0060162 | 3300045976 | Bacteria | 3365 |
| 351 | Ga0466967_0074824 | 3300045976 | Bacteria | 3043 |
| 352 | Ga0466967_0079011 | 3300045976 | Bacteria | 2965 |
| 353 | Ga0466967_0194987 | 3300045976 | Bacteria | 1916 |
| 354 | Ga0466967_0297948 | 3300045976 | Bacteria | 1551 |
| 355 | Ga0466967_0806831 | 3300045976 | Bacteria | 932 |
| 356 | Ga0495603_0093918 | 3300046455 | Bacteria | 1753 |
| 357 | Ga0495629_0017856 | 3300046459 | Bacteria | 5085 |
| 358 | Ga0495638_0005104 | 3300046460 | Bacteria | 9831 |
| 359 | Ga0495641_0082069 | 3300046461 | Bacteria | 1444 |
| 360 | Ga0495648_0141956 | 3300046524 | Bacteria | 1263 |
| 361 | Ga0495665_0077349 | 3300046531 | Bacteria | 1751 |
| 362 | Ga0495640_0113949 | 3300046533 | Bacteria | 1763 |
| 363 | Ga0495640_0368917 | 3300046533 | Bacteria | 884 |
| 364 | Ga0495625_0159156 | 3300046660 | Bacteria | 1514 |
| 365 | Ga0495581_0006457 | 3300047315 | Bacteria | 6805 |
| 366 | Ga0495672_0058182 | 3300047320 | Bacteria | 2242 |
| 367 | Ga0495686_0002464 | 3300047472 | Bacteria | 17454 |
| 368 | Ga0495593_0013334 | 3300047673 | Bacteria | 4691 |
| 369 | Ga0495626_0030223 | 3300048091 | Bacteria | 2614 |
| 370 | Ga0496100_0000110 | 3300048903 | Bacteria | 47145 |
| 371 | Ga0496100_0002409 | 3300048903 | Bacteria | 9476 |
| 372 | Ga0496100_0007114 | 3300048903 | Bacteria | 6145 |
| 373 | Ga0496100_0437743 | 3300048903 | Bacteria | 1001 |
| 374 | Ga0496101_0000054 | 3300048904 | Bacteria | 137699 |
| 375 | Ga0496101_0000073 | 3300048904 | Bacteria | 113870 |
| 376 | Ga0496101_0000790 | 3300048904 | Bacteria | 18712 |
| 377 | Ga0496101_0015768 | 3300048904 | Bacteria | 5099 |
| 378 | Ga0496101_0055903 | 3300048904 | Bacteria | 2852 |
| 379 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 380 | Ga0496102_0000118 | 3300048905 | Bacteria | 113499 |
| 381 | Ga0496102_0002514 | 3300048905 | Bacteria | 15646 |
| 382 | Ga0496102_0011206 | 3300048905 | Bacteria | 7723 |
| 383 | Ga0496102_0095785 | 3300048905 | Bacteria | 2751 |
| 384 | Ga0496102_0101095 | 3300048905 | Bacteria | 2678 |
| 385 | Ga0496102_0166971 | 3300048905 | Bacteria | 2071 |
| 386 | Ga0496102_0195758 | 3300048905 | Bacteria | 1905 |
| 387 | Ga0496102_0499884 | 3300048905 | Bacteria | 1138 |
| 388 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 389 | Ga0496103_0000227 | 3300048906 | Bacteria | 54745 |
| 390 | Ga0496103_0001393 | 3300048906 | Bacteria | 16261 |
| 391 | Ga0496103_0006809 | 3300048906 | Bacteria | 6821 |
| 392 | Ga0496103_0058746 | 3300048906 | Bacteria | 2389 |
| 393 | Ga0496103_0091577 | 3300048906 | Bacteria | 1919 |
| 394 | Ga0496104_0029417 | 3300048907 | Bacteria | 5096 |
| 395 | Ga0496104_0038232 | 3300048907 | Bacteria | 4490 |
| 396 | Ga0496104_0162493 | 3300048907 | Bacteria | 2142 |
| 397 | Ga0496104_0213096 | 3300048907 | Bacteria | 1843 |
| 398 | Ga0496105_0031658 | 3300048908 | Bacteria | 4336 |
| 399 | Ga0496105_0047644 | 3300048908 | Bacteria | 3537 |
| 400 | Ga0496105_0309205 | 3300048908 | Bacteria | 1269 |
| 401 | Ga0496106_0008927 | 3300048909 | Bacteria | 7410 |
| 402 | Ga0496106_0015842 | 3300048909 | Bacteria | 5575 |
| 403 | Ga0496106_0029821 | 3300048909 | Bacteria | 4066 |
| 404 | Ga0496106_0035196 | 3300048909 | Bacteria | 3744 |
| 405 | Ga0496106_0041068 | 3300048909 | Bacteria | 3466 |
| 406 | Ga0496106_0646855 | 3300048909 | Bacteria | 845 |
| 407 | Ga0496107_0000261 | 3300048910 | Bacteria | 28034 |
| 408 | Ga0496107_0004000 | 3300048910 | Bacteria | 9926 |
| 409 | Ga0496107_0024289 | 3300048910 | Bacteria | 4288 |
| 410 | Ga0496107_0085013 | 3300048910 | Bacteria | 2309 |
| 411 | Ga0496108_0004834 | 3300048911 | Bacteria | 10872 |
| 412 | Ga0496108_0006027 | 3300048911 | Bacteria | 9811 |
| 413 | Ga0496108_0022834 | 3300048911 | Bacteria | 5148 |
| 414 | Ga0496108_0270674 | 3300048911 | Bacteria | 1478 |
| 415 | Ga0496109_0000152 | 3300048912 | Bacteria | 68036 |
| 416 | Ga0496109_0001995 | 3300048912 | Bacteria | 16923 |
| 417 | Ga0496109_0014634 | 3300048912 | Bacteria | 6826 |
| 418 | Ga0496110_0000446 | 3300048913 | Bacteria | 28095 |
| 419 | Ga0496110_0049486 | 3300048913 | Bacteria | 3687 |
| 420 | Ga0496110_0059784 | 3300048913 | Bacteria | 3360 |
| 421 | Ga0496110_0105364 | 3300048913 | Bacteria | 2530 |
| 422 | Ga0496110_0345563 | 3300048913 | Bacteria | 1355 |
| 423 | Ga0496111_0018923 | 3300048914 | Bacteria | 4775 |
| 424 | Ga0496111_0384428 | 3300048914 | Bacteria | 1038 |
| 425 | Ga0496112_0013692 | 3300048915 | Bacteria | 7497 |
| 426 | Ga0496112_0040665 | 3300048915 | Bacteria | 4546 |
| 427 | Ga0496112_0075199 | 3300048915 | Bacteria | 3341 |
| 428 | Ga0496112_0179114 | 3300048915 | Bacteria | 2083 |
| 429 | Ga0496113_0012706 | 3300048916 | Bacteria | 5668 |
| 430 | Ga0496113_0209060 | 3300048916 | Bacteria | 1553 |
| 431 | Ga0496114_0000047 | 3300048917 | Bacteria | 119106 |
| 432 | Ga0496114_0000920 | 3300048917 | Bacteria | 22028 |
| 433 | Ga0496114_0001652 | 3300048917 | Bacteria | 16924 |
| 434 | Ga0496114_0318741 | 3300048917 | Bacteria | 1373 |
| 435 | Ga0496114_0640023 | 3300048917 | Bacteria | 936 |
| 436 | Ga0496115_0012234 | 3300048918 | Bacteria | 6453 |
| 437 | Ga0496115_0017964 | 3300048918 | Bacteria | 5418 |
| 438 | Ga0496115_0020390 | 3300048918 | Bacteria | 5114 |
| 439 | Ga0496115_0389089 | 3300048918 | Bacteria | 1133 |
| 440 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 441 | Ga0496116_0000968 | 3300048919 | Bacteria | 35439 |
| 442 | Ga0496116_0003154 | 3300048919 | Bacteria | 16511 |
| 443 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 444 | Ga0496117_0001082 | 3300048920 | Bacteria | 41248 |
| 445 | Ga0496117_0025351 | 3300048920 | Bacteria | 4665 |
| 446 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 447 | Ga0496118_0001424 | 3300048921 | Bacteria | 36051 |
| 448 | Ga0496118_0007848 | 3300048921 | Bacteria | 11190 |
| 449 | Ga0496118_0192602 | 3300048921 | Bacteria | 1218 |
| 450 | Ga0496118_0389995 | 3300048921 | Bacteria | 727 |
| 451 | Ga0496119_0000041 | 3300048922 | Bacteria | 203687 |
| 452 | Ga0496119_0001956 | 3300048922 | Bacteria | 23443 |
| 453 | Ga0496119_0013686 | 3300048922 | Bacteria | 6435 |
| 454 | Ga0496120_0000027 | 3300048923 | Bacteria | 231507 |
| 455 | Ga0496120_0018829 | 3300048923 | Bacteria | 4436 |
| 456 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 457 | Ga0496121_0000171 | 3300048924 | Bacteria | 144073 |
| 458 | Ga0496122_0000313 | 3300048925 | Bacteria | 107106 |
| 459 | Ga0496123_0012714 | 3300048926 | Bacteria | 7142 |
| 460 | Ga0496124_0000117 | 3300048927 | Bacteria | 164439 |
| 461 | Ga0496124_0078547 | 3300048927 | Bacteria | 2719 |
| 462 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 463 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 464 | Ga0496126_0004545 | 3300048929 | Bacteria | 16497 |
| 465 | Ga0496126_0005051 | 3300048929 | Bacteria | 15319 |
| 466 | Ga0496126_0068271 | 3300048929 | Bacteria | 3175 |
| 467 | Ga0501032_0000802 | 3300049569 | Bacteria | 25536 |
| 468 | Ga0501034_0018563 | 3300049571 | Bacteria | 7129 |
| 469 | Ga0501036_0114823 | 3300049572 | Bacteria | 2275 |
| 470 | Ga0501037_0004004 | 3300049573 | Bacteria | 10681 |
| 471 | Ga0501038_0002117 | 3300049574 | Bacteria | 18420 |
| 472 | Ga0501039_0002618 | 3300049575 | Bacteria | 13433 |
| 473 | Ga0501043_0002150 | 3300049579 | Bacteria | 16803 |
| 474 | Ga0501070_0003703 | 3300049586 | Bacteria | 13207 |
| 475 | Ga0501070_0038311 | 3300049586 | Bacteria | 4000 |
| 476 | Ga0501073_0090176 | 3300049589 | Bacteria | 2131 |
| 477 | Ga0501080_0232394 | 3300049742 | Bacteria | 1685 |
| 478 | Ga0501080_0821289 | 3300049742 | Bacteria | 814 |
| 479 | Ga0501044_0025823 | 3300049823 | Bacteria | 6227 |
| 480 | Ga0501044_0037093 | 3300049823 | Bacteria | 5097 |
| 481 | nmdc:mga03683_84897_c1 | 3300050489 | Bacteria | 1372 |
| 482 | nmdc:mga03n38_20343_c1 | 3300050490 | Bacteria | 2654 |
| 483 | nmdc:mga03n38_229271_c1 | 3300050490 | Bacteria | 973 |
| 484 | nmdc:mga03n38_301215_c1 | 3300050490 | Bacteria | 861 |
| 485 | nmdc:mga03n38_44155_c1 | 3300050490 | Bacteria | 1956 |
| 486 | nmdc:mga03n38_6741_c1 | 3300050490 | Bacteria | 4015 |
| 487 | nmdc:mga03n38_8096_c1 | 3300050490 | Bacteria | 3753 |
| 488 | nmdc:mga03n38_8584_c1 | 3300050490 | Bacteria | 3674 |
| 489 | nmdc:mga00v17_11911_c2 | 3300050491 | Bacteria | 4450 |
| 490 | nmdc:mga00v17_34112_c1 | 3300050491 | Bacteria | 3020 |
| 491 | nmdc:mga00v17_41508_c1 | 3300050491 | Bacteria | 2764 |
| 492 | nmdc:mga00v17_47663_c1 | 3300050491 | Bacteria | 2596 |
| 493 | nmdc:mga00v17_954_c1 | 3300050491 | Bacteria | 15500 |
| 494 | nmdc:mga0yw44_11339_c1 | 3300050492 | Bacteria | 4595 |
| 495 | nmdc:mga0yw44_9480_c2 | 3300050492 | Bacteria | 4525 |
| 496 | nmdc:mga06z11_13199_c1 | 3300050494 | Bacteria | 3618 |
| 497 | nmdc:mga06z11_6731_c1 | 3300050494 | Bacteria | 4696 |
| 498 | nmdc:mga04h51_8549_c1 | 3300050495 | Bacteria | 2741 |
| 499 | nmdc:mga07m45_213722_c1 | 3300050496 | Bacteria | 1122 |
| 500 | nmdc:mga07m45_3066_c1 | 3300050496 | Bacteria | 5870 |
| 501 | nmdc:mga07m45_71818_c1 | 3300050496 | Bacteria | 1500 |
| 502 | nmdc:mga05p37_11243_c1 | 3300050507 | Bacteria | 10646 |
| 503 | nmdc:mga0qj67_13317_c1 | 3300050509 | Bacteria | 6207 |
| 504 | nmdc:mga0qj67_249215_c1 | 3300050509 | Bacteria | 1441 |
| 505 | nmdc:mga0qj67_653072_c1 | 3300050509 | Bacteria | 839 |
| 506 | nmdc:mga06r32_48221_c1 | 3300050510 | Bacteria | 4071 |
| 507 | nmdc:mga0sz30_119319_c1 | 3300050516 | Bacteria | 1159 |
| 508 | nmdc:mga0sz30_1564_c1 | 3300050516 | Bacteria | 8160 |
| 509 | nmdc:mga0sz30_2532_c1 | 3300050516 | Bacteria | 6515 |
| 510 | nmdc:mga0sz30_49661_c1 | 3300050516 | Bacteria | 1778 |
| 511 | nmdc:mga0sz30_96022_c1 | 3300050516 | Bacteria | 1292 |
| 512 | Ga0495619_0235701 | 3300053085 | Bacteria | 1268 |
| 513 | Ga0500556_0001549 | 3300053104 | Bacteria | 9366 |
| 514 | Ga0500556_0041723 | 3300053104 | Bacteria | 1619 |
| 515 | Ga0500562_006808 | 3300053108 | Bacteria | 2883 |
| 516 | Ga0500568_0034795 | 3300053139 | Bacteria | 2059 |
| 517 | Ga0500577_0115249 | 3300053142 | Bacteria | 1113 |
| 518 | Ga0500616_0031099 | 3300053153 | Bacteria | 2926 |
| 519 | Ga0500616_0037529 | 3300053153 | Bacteria | 2622 |
| 520 | Ga0466962_0034749 | 3300061719 | Bacteria | 2413 |
| 521 | Ga0466962_0207148 | 3300061719 | Bacteria | 959 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042438 | Ga0439459_0008449 | Ga0439459_0008449_182_736 | 184 |
| 2 | 3300041462 | Ga0451806_337869 | Ga0451806_337869_33_590 | 185 |
| 3 | 3300048921 | Ga0496118_0389995 | Ga0496118_0389995_117_680 | 186 |
| 4 | 3300041511 | Ga0451855_0621036 | Ga0451855_0621036_39_620 | 190 |
| 5 | 3300044842 | Ga0466957_0721122 | Ga0466957_0721122_81_659 | 191 |
| 6 | 3300017792 | Ga0163161_10003327 | Ga0163161_100033276 | 203 |
| 7 | 3300044683 | Ga0466965_0008459 | Ga0466965_0008459_449_1099 | 204 |
| 8 | 3300044735 | Ga0466968_0001090 | Ga0466968_0001090_8846_9496 | 204 |
| 9 | 3300044842 | Ga0466957_0008089 | Ga0466957_0008089_3272_3922 | 204 |
| 10 | 3300044901 | Ga0466960_0365485 | Ga0466960_0365485_84_734 | 204 |
| 11 | 3300045976 | Ga0466967_0060162 | Ga0466967_0060162_1030_1680 | 204 |
| 12 | 3300045976 | Ga0466967_0297948 | Ga0466967_0297948_588_1220 | 210 |
| 13 | 3300005367 | Ga0070667_100923008 | Ga0070667_1009230081 | 211 |
| 14 | 3300005535 | Ga0070684_100123126 | Ga0070684_1001231262 | 211 |
| 15 | 3300045049 | Ga0466959_0016742 | Ga0466959_0016742_1780_2430 | 215 |
| 16 | 3300044683 | Ga0466965_0087672 | Ga0466965_0087672_162_815 | 216 |
| 17 | iso_pu_bacteria | 2643221687 | 2644490840 | 216 |
| 18 | iso_pu_bacteria | 2643221715 | 2644634239 | 216 |
| 19 | iso_pu_bacteria | 2738541264 | 2738668449 | 216 |
| 20 | iso_pu_bacteria | 2738541356 | 2739147519 | 216 |
| 21 | iso_pu_bacteria | 2842134933 | 2842139371 | 216 |
| 22 | iso_pu_bacteria | 2902810491 | 2902810603 | 216 |
| 23 | iso_pu_bacteria | 2902837492 | 2902844006 | 216 |
| 24 | iso_pu_bacteria | 2939582691 | 2939584534 | 216 |
| 25 | 3300049823 | Ga0501044_0037093 | Ga0501044_0037093_800_1456 | 217 |
| 26 | 3300039447 | Ga0436361_1210779 | Ga0436361_1210779_468_1124 | 218 |
| 27 | 3300001977 | JGI24746J21847_1008668 | JGI24746J21847_10086682 | 220 |
| 28 | 3300001991 | JGI24743J22301_10001109 | JGI24743J22301_100011092 | 220 |
| 29 | 3300002077 | JGI24744J21845_10016468 | JGI24744J21845_100164681 | 220 |
| 30 | 3300002459 | JGI24751J29686_10006698 | JGI24751J29686_100066982 | 220 |
| 31 | 3300003792 | Ga0055540_1000043 | Ga0055540_1000043108 | 220 |
| 32 | 3300003792 | Ga0055540_1000702 | Ga0055540_100070224 | 220 |
| 33 | 3300003792 | Ga0055540_1000980 | Ga0055540_10009804 | 220 |
| 34 | 3300003792 | Ga0055540_1009458 | Ga0055540_10094584 | 220 |
| 35 | 3300005328 | Ga0070676_10024123 | Ga0070676_100241233 | 220 |
| 36 | 3300005329 | Ga0070683_100055090 | Ga0070683_1000550903 | 220 |
| 37 | 3300005330 | Ga0070690_100029432 | Ga0070690_1000294323 | 220 |
| 38 | 3300005333 | Ga0070677_10027081 | Ga0070677_100270813 | 220 |
| 39 | 3300005334 | Ga0068869_100107462 | Ga0068869_1001074623 | 220 |
| 40 | 3300005334 | Ga0068869_100500864 | Ga0068869_1005008641 | 220 |
| 41 | 3300005338 | Ga0068868_100001734 | Ga0068868_1000017348 | 220 |
| 42 | 3300005338 | Ga0068868_100025807 | Ga0068868_1000258074 | 220 |
| 43 | 3300005340 | Ga0070689_100209842 | Ga0070689_1002098421 | 220 |
| 44 | 3300005347 | Ga0070668_100016270 | Ga0070668_1000162705 | 220 |
| 45 | 3300005347 | Ga0070668_100035317 | Ga0070668_1000353174 | 220 |
| 46 | 3300005353 | Ga0070669_100001560 | Ga0070669_10000156012 | 220 |
| 47 | 3300005353 | Ga0070669_100207630 | Ga0070669_1002076302 | 220 |
| 48 | 3300005353 | Ga0070669_100713424 | Ga0070669_1007134241 | 220 |
| 49 | 3300005355 | Ga0070671_100002251 | Ga0070671_1000022517 | 220 |
| 50 | 3300005355 | Ga0070671_100092563 | Ga0070671_1000925632 | 220 |
| 51 | 3300005355 | Ga0070671_100470927 | Ga0070671_1004709272 | 220 |
| 52 | 3300005356 | Ga0070674_100001623 | Ga0070674_1000016238 | 220 |
| 53 | 3300005356 | Ga0070674_100292270 | Ga0070674_1002922702 | 220 |
| 54 | 3300005364 | Ga0070673_100109160 | Ga0070673_1001091602 | 220 |
| 55 | 3300005367 | Ga0070667_100000190 | Ga0070667_10000019051 | 220 |
| 56 | 3300005367 | Ga0070667_100000658 | Ga0070667_10000065821 | 220 |
| 57 | 3300005367 | Ga0070667_100014989 | Ga0070667_1000149892 | 220 |
| 58 | 3300005367 | Ga0070667_100047859 | Ga0070667_1000478592 | 220 |
| 59 | 3300005367 | Ga0070667_100071672 | Ga0070667_1000716723 | 220 |
| 60 | 3300005434 | Ga0070709_10011186 | Ga0070709_100111861 | 220 |
| 61 | 3300005436 | Ga0070713_100275235 | Ga0070713_1002752352 | 220 |
| 62 | 3300005437 | Ga0070710_10012792 | Ga0070710_100127923 | 220 |
| 63 | 3300005438 | Ga0070701_10001036 | Ga0070701_1000103610 | 220 |
| 64 | 3300005439 | Ga0070711_100005803 | Ga0070711_1000058034 | 220 |
| 65 | 3300005439 | Ga0070711_100018139 | Ga0070711_1000181392 | 220 |
| 66 | 3300005439 | Ga0070711_100755347 | Ga0070711_1007553471 | 220 |
| 67 | 3300005441 | Ga0070700_100057808 | Ga0070700_1000578084 | 220 |
| 68 | 3300005441 | Ga0070700_100192507 | Ga0070700_1001925072 | 220 |
| 69 | 3300005444 | Ga0070694_100029737 | Ga0070694_1000297372 | 220 |
| 70 | 3300005455 | Ga0070663_100027368 | Ga0070663_1000273683 | 220 |
| 71 | 3300005455 | Ga0070663_100084669 | Ga0070663_1000846692 | 220 |
| 72 | 3300005455 | Ga0070663_100443222 | Ga0070663_1004432222 | 220 |
| 73 | 3300005456 | Ga0070678_100000951 | Ga0070678_10000095113 | 220 |
| 74 | 3300005456 | Ga0070678_100239638 | Ga0070678_1002396381 | 220 |
| 75 | 3300005457 | Ga0070662_100015863 | Ga0070662_1000158633 | 220 |
| 76 | 3300005459 | Ga0068867_100001628 | Ga0068867_1000016287 | 220 |
| 77 | 3300005536 | Ga0070697_100642687 | Ga0070697_1006426872 | 220 |
| 78 | 3300005539 | Ga0068853_100103388 | Ga0068853_1001033883 | 220 |
| 79 | 3300005543 | Ga0070672_100049966 | Ga0070672_1000499664 | 220 |
| 80 | 3300005544 | Ga0070686_100358953 | Ga0070686_1003589532 | 220 |
| 81 | 3300005545 | Ga0070695_100222383 | Ga0070695_1002223832 | 220 |
| 82 | 3300005546 | Ga0070696_100075314 | Ga0070696_1000753143 | 220 |
| 83 | 3300005547 | Ga0070693_100003536 | Ga0070693_1000035368 | 220 |
| 84 | 3300005548 | Ga0070665_100003854 | Ga0070665_10000385416 | 220 |
| 85 | 3300005548 | Ga0070665_100014251 | Ga0070665_1000142513 | 220 |
| 86 | 3300005548 | Ga0070665_100073934 | Ga0070665_1000739343 | 220 |
| 87 | 3300005548 | Ga0070665_100075325 | Ga0070665_1000753254 | 220 |
| 88 | 3300005548 | Ga0070665_100291312 | Ga0070665_1002913122 | 220 |
| 89 | 3300005549 | Ga0070704_100000104 | Ga0070704_1000001045 | 220 |
| 90 | 3300005578 | Ga0068854_100000198 | Ga0068854_10000019813 | 220 |
| 91 | 3300005578 | Ga0068854_100488907 | Ga0068854_1004889071 | 220 |
| 92 | 3300005615 | Ga0070702_100012280 | Ga0070702_1000122802 | 220 |
| 93 | 3300005615 | Ga0070702_100363600 | Ga0070702_1003636002 | 220 |
| 94 | 3300005616 | Ga0068852_100222165 | Ga0068852_1002221652 | 220 |
| 95 | 3300005616 | Ga0068852_100304780 | Ga0068852_1003047802 | 220 |
| 96 | 3300005617 | Ga0068859_100003525 | Ga0068859_10000352514 | 220 |
| 97 | 3300005617 | Ga0068859_100007646 | Ga0068859_1000076468 | 220 |
| 98 | 3300005617 | Ga0068859_100135370 | Ga0068859_1001353703 | 220 |
| 99 | 3300005617 | Ga0068859_100715821 | Ga0068859_1007158212 | 220 |
| 100 | 3300005618 | Ga0068864_100363782 | Ga0068864_1003637822 | 220 |
| 101 | 3300005618 | Ga0068864_100820276 | Ga0068864_1008202762 | 220 |
| 102 | 3300005718 | Ga0068866_10222711 | Ga0068866_102227111 | 220 |
| 103 | 3300005719 | Ga0068861_100035517 | Ga0068861_1000355172 | 220 |
| 104 | 3300005719 | Ga0068861_100068354 | Ga0068861_1000683543 | 220 |
| 105 | 3300005719 | Ga0068861_100080696 | Ga0068861_1000806963 | 220 |
| 106 | 3300005719 | Ga0068861_100086280 | Ga0068861_1000862803 | 220 |
| 107 | 3300005841 | Ga0068863_100000260 | Ga0068863_1000002606 | 220 |
| 108 | 3300005841 | Ga0068863_100005671 | Ga0068863_1000056712 | 220 |
| 109 | 3300005841 | Ga0068863_100822522 | Ga0068863_1008225222 | 220 |
| 110 | 3300005842 | Ga0068858_100017445 | Ga0068858_1000174455 | 220 |
| 111 | 3300005842 | Ga0068858_100105923 | Ga0068858_1001059234 | 220 |
| 112 | 3300005843 | Ga0068860_100000099 | Ga0068860_10000009954 | 220 |
| 113 | 3300005843 | Ga0068860_100104257 | Ga0068860_1001042573 | 220 |
| 114 | 3300005843 | Ga0068860_100126558 | Ga0068860_1001265582 | 220 |
| 115 | 3300005844 | Ga0068862_100000086 | Ga0068862_10000008654 | 220 |
| 116 | 3300005844 | Ga0068862_100015564 | Ga0068862_1000155646 | 220 |
| 117 | 3300005844 | Ga0068862_100381718 | Ga0068862_1003817182 | 220 |
| 118 | 3300005937 | Ga0081455_10019845 | Ga0081455_100198456 | 220 |
| 119 | 3300006038 | Ga0075365_10040337 | Ga0075365_100403374 | 220 |
| 120 | 3300006038 | Ga0075365_10043712 | Ga0075365_100437122 | 220 |
| 121 | 3300006038 | Ga0075365_10110800 | Ga0075365_101108002 | 220 |
| 122 | 3300006042 | Ga0075368_10088826 | Ga0075368_100888262 | 220 |
| 123 | 3300006048 | Ga0075363_100005604 | Ga0075363_1000056042 | 220 |
| 124 | 3300006048 | Ga0075363_100011207 | Ga0075363_1000112072 | 220 |
| 125 | 3300006048 | Ga0075363_100011781 | Ga0075363_1000117815 | 220 |
| 126 | 3300006048 | Ga0075363_100018588 | Ga0075363_1000185882 | 220 |
| 127 | 3300006048 | Ga0075363_100027946 | Ga0075363_1000279464 | 220 |
| 128 | 3300006048 | Ga0075363_100111288 | Ga0075363_1001112882 | 220 |
| 129 | 3300006051 | Ga0075364_10001316 | Ga0075364_100013164 | 220 |
| 130 | 3300006051 | Ga0075364_10005926 | Ga0075364_100059264 | 220 |
| 131 | 3300006051 | Ga0075364_10019759 | Ga0075364_100197594 | 220 |
| 132 | 3300006051 | Ga0075364_10028678 | Ga0075364_100286783 | 220 |
| 133 | 3300006051 | Ga0075364_10212769 | Ga0075364_102127692 | 220 |
| 134 | 3300006163 | Ga0070715_10128011 | Ga0070715_101280112 | 220 |
| 135 | 3300006173 | Ga0070716_100010650 | Ga0070716_1000106504 | 220 |
| 136 | 3300006173 | Ga0070716_100141516 | Ga0070716_1001415162 | 220 |
| 137 | 3300006177 | Ga0075362_10111175 | Ga0075362_101111752 | 220 |
| 138 | 3300006178 | Ga0075367_10024689 | Ga0075367_100246892 | 220 |
| 139 | 3300006178 | Ga0075367_10031003 | Ga0075367_100310034 | 220 |
| 140 | 3300006186 | Ga0075369_10006736 | Ga0075369_100067363 | 220 |
| 141 | 3300006186 | Ga0075369_10013662 | Ga0075369_100136622 | 220 |
| 142 | 3300006186 | Ga0075369_10155246 | Ga0075369_101552462 | 220 |
| 143 | 3300006237 | Ga0097621_100571153 | Ga0097621_1005711532 | 220 |
| 144 | 3300006237 | Ga0097621_100890293 | Ga0097621_1008902931 | 220 |
| 145 | 3300006353 | Ga0075370_10012251 | Ga0075370_100122514 | 220 |
| 146 | 3300006353 | Ga0075370_10014423 | Ga0075370_100144232 | 220 |
| 147 | 3300006353 | Ga0075370_10094810 | Ga0075370_100948103 | 220 |
| 148 | 3300006844 | Ga0075428_100004646 | Ga0075428_10000464613 | 220 |
| 149 | 3300006846 | Ga0075430_100305521 | Ga0075430_1003055212 | 220 |
| 150 | 3300006847 | Ga0075431_100067323 | Ga0075431_1000673232 | 220 |
| 151 | 3300006881 | Ga0068865_100026719 | Ga0068865_1000267196 | 220 |
| 152 | 3300006881 | Ga0068865_100268582 | Ga0068865_1002685822 | 220 |
| 153 | 3300006931 | Ga0097620_100003525 | Ga0097620_1000035256 | 220 |
| 154 | 3300006931 | Ga0097620_100007646 | Ga0097620_1000076466 | 220 |
| 155 | 3300006931 | Ga0097620_100135363 | Ga0097620_1001353632 | 220 |
| 156 | 3300006931 | Ga0097620_100715736 | Ga0097620_1007157362 | 220 |
| 157 | 3300007788 | Ga0099795_10013890 | Ga0099795_100138902 | 220 |
| 158 | 3300009092 | Ga0105250_10009943 | Ga0105250_100099433 | 220 |
| 159 | 3300009094 | Ga0111539_10643054 | Ga0111539_106430542 | 220 |
| 160 | 3300009098 | Ga0105245_10013909 | Ga0105245_100139093 | 220 |
| 161 | 3300009098 | Ga0105245_10039068 | Ga0105245_100390684 | 220 |
| 162 | 3300009098 | Ga0105245_10092421 | Ga0105245_100924213 | 220 |
| 163 | 3300009098 | Ga0105245_10909133 | Ga0105245_109091332 | 220 |
| 164 | 3300009101 | Ga0105247_10000051 | Ga0105247_1000005152 | 220 |
| 165 | 3300009101 | Ga0105247_10002033 | Ga0105247_100020338 | 220 |
| 166 | 3300009101 | Ga0105247_10239659 | Ga0105247_102396591 | 220 |
| 167 | 3300009147 | Ga0114129_10038950 | Ga0114129_100389507 | 220 |
| 168 | 3300009148 | Ga0105243_10004906 | Ga0105243_1000490610 | 220 |
| 169 | 3300009148 | Ga0105243_10031725 | Ga0105243_100317252 | 220 |
| 170 | 3300009174 | Ga0105241_10237635 | Ga0105241_102376351 | 220 |
| 171 | 3300009176 | Ga0105242_10004844 | Ga0105242_100048449 | 220 |
| 172 | 3300009176 | Ga0105242_10081882 | Ga0105242_100818823 | 220 |
| 173 | 3300009177 | Ga0105248_10000281 | Ga0105248_1000028125 | 220 |
| 174 | 3300009177 | Ga0105248_10012267 | Ga0105248_100122679 | 220 |
| 175 | 3300009177 | Ga0105248_10064198 | Ga0105248_100641984 | 220 |
| 176 | 3300009545 | Ga0105237_10006641 | Ga0105237_1000664110 | 220 |
| 177 | 3300009545 | Ga0105237_10042955 | Ga0105237_100429556 | 220 |
| 178 | 3300009545 | Ga0105237_10626982 | Ga0105237_106269822 | 220 |
| 179 | 3300009551 | Ga0105238_10071986 | Ga0105238_100719863 | 220 |
| 180 | 3300009551 | Ga0105238_10548710 | Ga0105238_105487102 | 220 |
| 181 | 3300009553 | Ga0105249_10000020 | Ga0105249_1000002085 | 220 |
| 182 | 3300009553 | Ga0105249_10003714 | Ga0105249_1000371410 | 220 |
| 183 | 3300009553 | Ga0105249_10110702 | Ga0105249_101107022 | 220 |
| 184 | 3300010375 | Ga0105239_10012351 | Ga0105239_100123519 | 220 |
| 185 | 3300010375 | Ga0105239_10042126 | Ga0105239_100421265 | 220 |
| 186 | 3300010375 | Ga0105239_10079607 | Ga0105239_100796073 | 220 |
| 187 | 3300011119 | Ga0105246_10601833 | Ga0105246_106018331 | 220 |
| 188 | 3300013296 | Ga0157374_10035687 | Ga0157374_100356875 | 220 |
| 189 | 3300013296 | Ga0157374_10702745 | Ga0157374_107027452 | 220 |
| 190 | 3300013297 | Ga0157378_10004748 | Ga0157378_100047488 | 220 |
| 191 | 3300013297 | Ga0157378_10149774 | Ga0157378_101497742 | 220 |
| 192 | 3300013306 | Ga0163162_10009938 | Ga0163162_100099386 | 220 |
| 193 | 3300013306 | Ga0163162_10611665 | Ga0163162_106116652 | 220 |
| 194 | 3300013307 | Ga0157372_10005118 | Ga0157372_100051189 | 220 |
| 195 | 3300013307 | Ga0157372_10378192 | Ga0157372_103781923 | 220 |
| 196 | 3300013308 | Ga0157375_10008395 | Ga0157375_100083955 | 220 |
| 197 | 3300013308 | Ga0157375_10378368 | Ga0157375_103783682 | 220 |
| 198 | 3300013308 | Ga0157375_10494603 | Ga0157375_104946032 | 220 |
| 199 | 3300013308 | Ga0157375_10801365 | Ga0157375_108013652 | 220 |
| 200 | 3300014325 | Ga0163163_10009624 | Ga0163163_100096246 | 220 |
| 201 | 3300014325 | Ga0163163_10014582 | Ga0163163_100145828 | 220 |
| 202 | 3300014326 | Ga0157380_10006508 | Ga0157380_1000650811 | 220 |
| 203 | 3300014497 | Ga0182008_10184155 | Ga0182008_101841552 | 220 |
| 204 | 3300014745 | Ga0157377_10055109 | Ga0157377_100551093 | 220 |
| 205 | 3300014745 | Ga0157377_10376452 | Ga0157377_103764522 | 220 |
| 206 | 3300014968 | Ga0157379_10008800 | Ga0157379_100088006 | 220 |
| 207 | 3300014968 | Ga0157379_10181415 | Ga0157379_101814152 | 220 |
| 208 | 3300017792 | Ga0163161_10048455 | Ga0163161_100484554 | 220 |
| 209 | 3300017792 | Ga0163161_10207593 | Ga0163161_102075932 | 220 |
| 210 | 3300021384 | Ga0213876_10034214 | Ga0213876_100342142 | 220 |
| 211 | 3300021388 | Ga0213875_10033385 | Ga0213875_100333854 | 220 |
| 212 | 3300025273 | Ga0209673_1005791 | Ga0209673_10057913 | 220 |
| 213 | 3300025303 | Ga0209051_1000108 | Ga0209051_100010853 | 220 |
| 214 | 3300025303 | Ga0209051_1000337 | Ga0209051_100033756 | 220 |
| 215 | 3300025303 | Ga0209051_1001005 | Ga0209051_100100512 | 220 |
| 216 | 3300025711 | Ga0207696_1018610 | Ga0207696_10186102 | 220 |
| 217 | 3300025898 | Ga0207692_10105812 | Ga0207692_101058122 | 220 |
| 218 | 3300025899 | Ga0207642_10000267 | Ga0207642_100002679 | 220 |
| 219 | 3300025899 | Ga0207642_10149034 | Ga0207642_101490342 | 220 |
| 220 | 3300025900 | Ga0207710_10000010 | Ga0207710_10000010215 | 220 |
| 221 | 3300025900 | Ga0207710_10032856 | Ga0207710_100328563 | 220 |
| 222 | 3300025901 | Ga0207688_10008080 | Ga0207688_100080805 | 220 |
| 223 | 3300025901 | Ga0207688_10019117 | Ga0207688_100191173 | 220 |
| 224 | 3300025904 | Ga0207647_10028903 | Ga0207647_100289034 | 220 |
| 225 | 3300025905 | Ga0207685_10077724 | Ga0207685_100777242 | 220 |
| 226 | 3300025906 | Ga0207699_10137763 | Ga0207699_101377631 | 220 |
| 227 | 3300025907 | Ga0207645_10073119 | Ga0207645_100731192 | 220 |
| 228 | 3300025914 | Ga0207671_10087402 | Ga0207671_100874023 | 220 |
| 229 | 3300025914 | Ga0207671_10156722 | Ga0207671_101567222 | 220 |
| 230 | 3300025915 | Ga0207693_10000430 | Ga0207693_1000043040 | 220 |
| 231 | 3300025915 | Ga0207693_10006063 | Ga0207693_100060633 | 220 |
| 232 | 3300025916 | Ga0207663_10006540 | Ga0207663_100065402 | 220 |
| 233 | 3300025919 | Ga0207657_10025944 | Ga0207657_100259444 | 220 |
| 234 | 3300025919 | Ga0207657_10326445 | Ga0207657_103264451 | 220 |
| 235 | 3300025921 | Ga0207652_10342346 | Ga0207652_103423462 | 220 |
| 236 | 3300025923 | Ga0207681_10002745 | Ga0207681_100027453 | 220 |
| 237 | 3300025923 | Ga0207681_10490089 | Ga0207681_104900891 | 220 |
| 238 | 3300025924 | Ga0207694_10291796 | Ga0207694_102917962 | 220 |
| 239 | 3300025924 | Ga0207694_10490804 | Ga0207694_104908042 | 220 |
| 240 | 3300025927 | Ga0207687_10001991 | Ga0207687_100019915 | 220 |
| 241 | 3300025927 | Ga0207687_10289358 | Ga0207687_102893582 | 220 |
| 242 | 3300025928 | Ga0207700_10283271 | Ga0207700_102832712 | 220 |
| 243 | 3300025929 | Ga0207664_10164583 | Ga0207664_101645832 | 220 |
| 244 | 3300025931 | Ga0207644_10005098 | Ga0207644_100050984 | 220 |
| 245 | 3300025931 | Ga0207644_10129202 | Ga0207644_101292022 | 220 |
| 246 | 3300025932 | Ga0207690_10007060 | Ga0207690_100070602 | 220 |
| 247 | 3300025933 | Ga0207706_10215748 | Ga0207706_102157481 | 220 |
| 248 | 3300025936 | Ga0207670_10013622 | Ga0207670_100136221 | 220 |
| 249 | 3300025937 | Ga0207669_10003498 | Ga0207669_100034989 | 220 |
| 250 | 3300025937 | Ga0207669_10277900 | Ga0207669_102779002 | 220 |
| 251 | 3300025938 | Ga0207704_10000321 | Ga0207704_1000032112 | 220 |
| 252 | 3300025938 | Ga0207704_10072162 | Ga0207704_100721622 | 220 |
| 253 | 3300025939 | Ga0207665_10015862 | Ga0207665_100158622 | 220 |
| 254 | 3300025939 | Ga0207665_10018381 | Ga0207665_100183811 | 220 |
| 255 | 3300025940 | Ga0207691_10069377 | Ga0207691_100693773 | 220 |
| 256 | 3300025941 | Ga0207711_10000364 | Ga0207711_1000036425 | 220 |
| 257 | 3300025941 | Ga0207711_10143131 | Ga0207711_101431314 | 220 |
| 258 | 3300025942 | Ga0207689_10023094 | Ga0207689_100230943 | 220 |
| 259 | 3300025942 | Ga0207689_10047080 | Ga0207689_100470803 | 220 |
| 260 | 3300025944 | Ga0207661_10040444 | Ga0207661_100404443 | 220 |
| 261 | 3300025949 | Ga0207667_10197156 | Ga0207667_101971562 | 220 |
| 262 | 3300025949 | Ga0207667_10276943 | Ga0207667_102769432 | 220 |
| 263 | 3300025960 | Ga0207651_10126327 | Ga0207651_101263272 | 220 |
| 264 | 3300025961 | Ga0207712_10000010 | Ga0207712_10000010179 | 220 |
| 265 | 3300025961 | Ga0207712_10029548 | Ga0207712_100295482 | 220 |
| 266 | 3300025972 | Ga0207668_10001252 | Ga0207668_1000125210 | 220 |
| 267 | 3300025972 | Ga0207668_10017900 | Ga0207668_100179003 | 220 |
| 268 | 3300025972 | Ga0207668_10559622 | Ga0207668_105596221 | 220 |
| 269 | 3300025981 | Ga0207640_10024703 | Ga0207640_100247032 | 220 |
| 270 | 3300025986 | Ga0207658_10001232 | Ga0207658_1000123210 | 220 |
| 271 | 3300025986 | Ga0207658_10009397 | Ga0207658_100093978 | 220 |
| 272 | 3300025986 | Ga0207658_10086462 | Ga0207658_100864622 | 220 |
| 273 | 3300025986 | Ga0207658_10242190 | Ga0207658_102421902 | 220 |
| 274 | 3300025986 | Ga0207658_10538919 | Ga0207658_105389192 | 220 |
| 275 | 3300025986 | Ga0207658_10791979 | Ga0207658_107919792 | 220 |
| 276 | 3300026035 | Ga0207703_10003382 | Ga0207703_100033823 | 220 |
| 277 | 3300026035 | Ga0207703_10405499 | Ga0207703_104054992 | 220 |
| 278 | 3300026041 | Ga0207639_10005886 | Ga0207639_100058864 | 220 |
| 279 | 3300026067 | Ga0207678_10010154 | Ga0207678_100101543 | 220 |
| 280 | 3300026067 | Ga0207678_10010796 | Ga0207678_100107963 | 220 |
| 281 | 3300026067 | Ga0207678_10018387 | Ga0207678_100183872 | 220 |
| 282 | 3300026067 | Ga0207678_10233960 | Ga0207678_102339602 | 220 |
| 283 | 3300026075 | Ga0207708_10006037 | Ga0207708_100060378 | 220 |
| 284 | 3300026088 | Ga0207641_10000445 | Ga0207641_100004455 | 220 |
| 285 | 3300026088 | Ga0207641_10008412 | Ga0207641_100084128 | 220 |
| 286 | 3300026088 | Ga0207641_10075567 | Ga0207641_100755672 | 220 |
| 287 | 3300026088 | Ga0207641_10320828 | Ga0207641_103208282 | 220 |
| 288 | 3300026089 | Ga0207648_10001738 | Ga0207648_1000173817 | 220 |
| 289 | 3300026089 | Ga0207648_10008737 | Ga0207648_100087376 | 220 |
| 290 | 3300026095 | Ga0207676_10260385 | Ga0207676_102603852 | 220 |
| 291 | 3300026095 | Ga0207676_10895178 | Ga0207676_108951781 | 220 |
| 292 | 3300026118 | Ga0207675_100060197 | Ga0207675_1000601973 | 220 |
| 293 | 3300026118 | Ga0207675_100065641 | Ga0207675_1000656413 | 220 |
| 294 | 3300026118 | Ga0207675_100109085 | Ga0207675_1001090852 | 220 |
| 295 | 3300026118 | Ga0207675_100111671 | Ga0207675_1001116712 | 220 |
| 296 | 3300026121 | Ga0207683_10014544 | Ga0207683_100145443 | 220 |
| 297 | 3300026121 | Ga0207683_10039841 | Ga0207683_100398413 | 220 |
| 298 | 3300026121 | Ga0207683_10276020 | Ga0207683_102760203 | 220 |
| 299 | 3300026121 | Ga0207683_10476896 | Ga0207683_104768962 | 220 |
| 300 | 3300026142 | Ga0207698_10179214 | Ga0207698_101792142 | 220 |
| 301 | 3300027866 | Ga0209813_10007615 | Ga0209813_100076152 | 220 |
| 302 | 3300028379 | Ga0268266_10002054 | Ga0268266_100020549 | 220 |
| 303 | 3300028379 | Ga0268266_10049634 | Ga0268266_100496344 | 220 |
| 304 | 3300028379 | Ga0268266_10081470 | Ga0268266_100814702 | 220 |
| 305 | 3300028379 | Ga0268266_10526272 | Ga0268266_105262722 | 220 |
| 306 | 3300028380 | Ga0268265_10000014 | Ga0268265_10000014263 | 220 |
| 307 | 3300028381 | Ga0268264_10000137 | Ga0268264_10000137111 | 220 |
| 308 | 3300028381 | Ga0268264_10001869 | Ga0268264_100018692 | 220 |
| 309 | 3300031251 | Ga0265327_10000662 | Ga0265327_100006625 | 220 |
| 310 | 3300031731 | Ga0307405_10569862 | Ga0307405_105698622 | 220 |
| 311 | 3300031824 | Ga0307413_10058299 | Ga0307413_100582992 | 220 |
| 312 | 3300031824 | Ga0307413_10309337 | Ga0307413_103093372 | 220 |
| 313 | 3300031852 | Ga0307410_10582332 | Ga0307410_105823322 | 220 |
| 314 | 3300031901 | Ga0307406_10457194 | Ga0307406_104571941 | 220 |
| 315 | 3300031911 | Ga0307412_10022222 | Ga0307412_100222225 | 220 |
| 316 | 3300031995 | Ga0307409_100241070 | Ga0307409_1002410701 | 220 |
| 317 | 3300031995 | Ga0307409_100643467 | Ga0307409_1006434672 | 220 |
| 318 | 3300032002 | Ga0307416_100071205 | Ga0307416_1000712053 | 220 |
| 319 | 3300032005 | Ga0307411_10192228 | Ga0307411_101922282 | 220 |
| 320 | 3300032126 | Ga0307415_100010496 | Ga0307415_1000104965 | 220 |
| 321 | 3300034819 | Ga0373958_0062105 | Ga0373958_0062105_56_721 | 220 |
| 322 | 3300034820 | Ga0373959_0074166 | Ga0373959_0074166_18_680 | 220 |
| 323 | 3300035115 | Ga0373941_0029703 | Ga0373941_0029703_362_1024 | 220 |
| 324 | 3300035121 | Ga0373960_0016773 | Ga0373960_0016773_1007_1672 | 220 |
| 325 | 3300035691 | Ga0373931_0033597 | Ga0373931_0033597_726_1391 | 220 |
| 326 | 3300035691 | Ga0373931_0269128 | Ga0373931_0269128_193_861 | 220 |
| 327 | 3300035724 | Ga0373933_0394717 | Ga0373933_0394717_141_803 | 220 |
| 328 | 3300035725 | Ga0373947_0353499 | Ga0373947_0353499_67_729 | 220 |
| 329 | 3300037068 | Ga0373925_0547925 | Ga0373925_0547925_193_855 | 220 |
| 330 | 3300037853 | Ga0436364_0204668 | Ga0436364_0204668_8409_9071 | 220 |
| 331 | 3300039450 | Ga0436363_0375672 | Ga0436363_0375672_767_1429 | 220 |
| 332 | 3300039450 | Ga0436363_1689608 | Ga0436363_1689608_159_839 | 220 |
| 333 | 3300041411 | Ga0439466_0003909 | Ga0439466_0003909_4745_5410 | 220 |
| 334 | 3300041411 | Ga0439466_0008306 | Ga0439466_0008306_1022_1687 | 220 |
| 335 | 3300041411 | Ga0439466_0042416 | Ga0439466_0042416_227_889 | 220 |
| 336 | 3300041413 | Ga0439465_0007839 | Ga0439465_0007839_1801_2466 | 220 |
| 337 | 3300041456 | Ga0451795_1658859 | Ga0451795_1658859_1622_2284 | 220 |
| 338 | 3300041997 | Ga0439431_0000466 | Ga0439431_0000466_4798_5463 | 220 |
| 339 | 3300042002 | Ga0439442_020862 | Ga0439442_020862_167_832 | 220 |
| 340 | 3300042004 | Ga0439445_0000791 | Ga0439445_0000791_5009_5674 | 220 |
| 341 | 3300042004 | Ga0439445_0044251 | Ga0439445_0044251_198_863 | 220 |
| 342 | 3300042004 | Ga0439445_0044749 | Ga0439445_0044749_352_1014 | 220 |
| 343 | 3300042005 | Ga0439448_0112850 | Ga0439448_0112850_230_892 | 220 |
| 344 | 3300042435 | Ga0439434_0001376 | Ga0439434_0001376_5778_6443 | 220 |
| 345 | 3300042435 | Ga0439434_0015932 | Ga0439434_0015932_844_1509 | 220 |
| 346 | 3300042436 | Ga0439435_0131608 | Ga0439435_0131608_45_707 | 220 |
| 347 | 3300044656 | Ga0466969_0030153 | Ga0466969_0030153_500_1162 | 220 |
| 348 | 3300044658 | Ga0466972_0028426 | Ga0466972_0028426_2039_2704 | 220 |
| 349 | 3300044683 | Ga0466965_0040561 | Ga0466965_0040561_932_1594 | 220 |
| 350 | 3300044683 | Ga0466965_0408994 | Ga0466965_0408994_68_733 | 220 |
| 351 | 3300044684 | Ga0466966_0255878 | Ga0466966_0255878_312_974 | 220 |
| 352 | 3300044693 | Ga0466961_0055574 | Ga0466961_0055574_170_832 | 220 |
| 353 | 3300044706 | Ga0466964_0044986 | Ga0466964_0044986_1032_1694 | 220 |
| 354 | 3300044706 | Ga0466964_0233728 | Ga0466964_0233728_189_854 | 220 |
| 355 | 3300044719 | Ga0466971_0003465 | Ga0466971_0003465_3627_4289 | 220 |
| 356 | 3300044765 | Ga0466970_0007705 | Ga0466970_0007705_597_1271 | 220 |
| 357 | 3300044765 | Ga0466970_0040912 | Ga0466970_0040912_188_853 | 220 |
| 358 | 3300044842 | Ga0466957_0025888 | Ga0466957_0025888_184_846 | 220 |
| 359 | 3300045049 | Ga0466959_0037597 | Ga0466959_0037597_314_976 | 220 |
| 360 | 3300045976 | Ga0466967_0029824 | Ga0466967_0029824_1392_2054 | 220 |
| 361 | 3300045976 | Ga0466967_0053339 | Ga0466967_0053339_2507_3178 | 220 |
| 362 | 3300045976 | Ga0466967_0074824 | Ga0466967_0074824_1588_2250 | 220 |
| 363 | 3300045976 | Ga0466967_0079011 | Ga0466967_0079011_533_1195 | 220 |
| 364 | 3300045976 | Ga0466967_0194987 | Ga0466967_0194987_364_1026 | 220 |
| 365 | 3300045976 | Ga0466967_0806831 | Ga0466967_0806831_32_694 | 220 |
| 366 | 3300046455 | Ga0495603_0093918 | Ga0495603_0093918_655_1317 | 220 |
| 367 | 3300046459 | Ga0495629_0017856 | Ga0495629_0017856_2900_3562 | 220 |
| 368 | 3300046460 | Ga0495638_0005104 | Ga0495638_0005104_8826_9488 | 220 |
| 369 | 3300046461 | Ga0495641_0082069 | Ga0495641_0082069_548_1210 | 220 |
| 370 | 3300046524 | Ga0495648_0141956 | Ga0495648_0141956_482_1144 | 220 |
| 371 | 3300046531 | Ga0495665_0077349 | Ga0495665_0077349_196_858 | 220 |
| 372 | 3300046533 | Ga0495640_0113949 | Ga0495640_0113949_633_1295 | 220 |
| 373 | 3300046533 | Ga0495640_0368917 | Ga0495640_0368917_199_870 | 220 |
| 374 | 3300046660 | Ga0495625_0159156 | Ga0495625_0159156_784_1446 | 220 |
| 375 | 3300047315 | Ga0495581_0006457 | Ga0495581_0006457_5477_6139 | 220 |
| 376 | 3300047320 | Ga0495672_0058182 | Ga0495672_0058182_660_1322 | 220 |
| 377 | 3300047472 | Ga0495686_0002464 | Ga0495686_0002464_11284_11946 | 220 |
| 378 | 3300047673 | Ga0495593_0013334 | Ga0495593_0013334_2710_3372 | 220 |
| 379 | 3300048091 | Ga0495626_0030223 | Ga0495626_0030223_1159_1821 | 220 |
| 380 | 3300048903 | Ga0496100_0000110 | Ga0496100_0000110_22369_23034 | 220 |
| 381 | 3300048903 | Ga0496100_0002409 | Ga0496100_0002409_2742_3404 | 220 |
| 382 | 3300048903 | Ga0496100_0007114 | Ga0496100_0007114_4633_5295 | 220 |
| 383 | 3300048903 | Ga0496100_0437743 | Ga0496100_0437743_65_730 | 220 |
| 384 | 3300048904 | Ga0496101_0000054 | Ga0496101_0000054_54681_55346 | 220 |
| 385 | 3300048904 | Ga0496101_0000073 | Ga0496101_0000073_85200_85862 | 220 |
| 386 | 3300048904 | Ga0496101_0000790 | Ga0496101_0000790_2147_2809 | 220 |
| 387 | 3300048904 | Ga0496101_0015768 | Ga0496101_0015768_1981_2646 | 220 |
| 388 | 3300048904 | Ga0496101_0055903 | Ga0496101_0055903_1773_2435 | 220 |
| 389 | 3300048905 | Ga0496102_0000006 | Ga0496102_0000006_164643_165305 | 220 |
| 390 | 3300048905 | Ga0496102_0000118 | Ga0496102_0000118_61589_62251 | 220 |
| 391 | 3300048905 | Ga0496102_0002514 | Ga0496102_0002514_12303_12968 | 220 |
| 392 | 3300048905 | Ga0496102_0011206 | Ga0496102_0011206_6022_6687 | 220 |
| 393 | 3300048905 | Ga0496102_0095785 | Ga0496102_0095785_1968_2630 | 220 |
| 394 | 3300048905 | Ga0496102_0101095 | Ga0496102_0101095_1933_2598 | 220 |
| 395 | 3300048905 | Ga0496102_0166971 | Ga0496102_0166971_543_1205 | 220 |
| 396 | 3300048905 | Ga0496102_0195758 | Ga0496102_0195758_1095_1760 | 220 |
| 397 | 3300048905 | Ga0496102_0499884 | Ga0496102_0499884_365_1027 | 220 |
| 398 | 3300048906 | Ga0496103_0000006 | Ga0496103_0000006_164441_165103 | 220 |
| 399 | 3300048906 | Ga0496103_0000227 | Ga0496103_0000227_4435_5097 | 220 |
| 400 | 3300048906 | Ga0496103_0001393 | Ga0496103_0001393_9687_10352 | 220 |
| 401 | 3300048906 | Ga0496103_0006809 | Ga0496103_0006809_4257_4922 | 220 |
| 402 | 3300048906 | Ga0496103_0058746 | Ga0496103_0058746_1675_2337 | 220 |
| 403 | 3300048906 | Ga0496103_0091577 | Ga0496103_0091577_518_1183 | 220 |
| 404 | 3300048907 | Ga0496104_0029417 | Ga0496104_0029417_4108_4773 | 220 |
| 405 | 3300048907 | Ga0496104_0038232 | Ga0496104_0038232_3035_3697 | 220 |
| 406 | 3300048907 | Ga0496104_0162493 | Ga0496104_0162493_577_1239 | 220 |
| 407 | 3300048907 | Ga0496104_0213096 | Ga0496104_0213096_214_876 | 220 |
| 408 | 3300048908 | Ga0496105_0031658 | Ga0496105_0031658_1005_1667 | 220 |
| 409 | 3300048908 | Ga0496105_0047644 | Ga0496105_0047644_194_859 | 220 |
| 410 | 3300048908 | Ga0496105_0309205 | Ga0496105_0309205_310_972 | 220 |
| 411 | 3300048909 | Ga0496106_0008927 | Ga0496106_0008927_5457_6122 | 220 |
| 412 | 3300048909 | Ga0496106_0015842 | Ga0496106_0015842_1647_2309 | 220 |
| 413 | 3300048909 | Ga0496106_0029821 | Ga0496106_0029821_362_1024 | 220 |
| 414 | 3300048909 | Ga0496106_0035196 | Ga0496106_0035196_100_762 | 220 |
| 415 | 3300048909 | Ga0496106_0041068 | Ga0496106_0041068_2200_2862 | 220 |
| 416 | 3300048909 | Ga0496106_0646855 | Ga0496106_0646855_90_752 | 220 |
| 417 | 3300048910 | Ga0496107_0000261 | Ga0496107_0000261_26447_27112 | 220 |
| 418 | 3300048910 | Ga0496107_0004000 | Ga0496107_0004000_28_693 | 220 |
| 419 | 3300048910 | Ga0496107_0024289 | Ga0496107_0024289_464_1126 | 220 |
| 420 | 3300048910 | Ga0496107_0085013 | Ga0496107_0085013_1569_2231 | 220 |
| 421 | 3300048911 | Ga0496108_0004834 | Ga0496108_0004834_3765_4427 | 220 |
| 422 | 3300048911 | Ga0496108_0006027 | Ga0496108_0006027_1923_2588 | 220 |
| 423 | 3300048911 | Ga0496108_0022834 | Ga0496108_0022834_4449_5114 | 220 |
| 424 | 3300048911 | Ga0496108_0270674 | Ga0496108_0270674_542_1204 | 220 |
| 425 | 3300048912 | Ga0496109_0000152 | Ga0496109_0000152_43297_43962 | 220 |
| 426 | 3300048912 | Ga0496109_0001995 | Ga0496109_0001995_9011_9673 | 220 |
| 427 | 3300048912 | Ga0496109_0014634 | Ga0496109_0014634_4020_4682 | 220 |
| 428 | 3300048913 | Ga0496110_0000446 | Ga0496110_0000446_23943_24608 | 220 |
| 429 | 3300048913 | Ga0496110_0049486 | Ga0496110_0049486_478_1140 | 220 |
| 430 | 3300048913 | Ga0496110_0059784 | Ga0496110_0059784_1383_2048 | 220 |
| 431 | 3300048913 | Ga0496110_0105364 | Ga0496110_0105364_1173_1835 | 220 |
| 432 | 3300048913 | Ga0496110_0345563 | Ga0496110_0345563_131_796 | 220 |
| 433 | 3300048914 | Ga0496111_0018923 | Ga0496111_0018923_4083_4748 | 220 |
| 434 | 3300048914 | Ga0496111_0384428 | Ga0496111_0384428_36_698 | 220 |
| 435 | 3300048915 | Ga0496112_0013692 | Ga0496112_0013692_5248_5910 | 220 |
| 436 | 3300048915 | Ga0496112_0040665 | Ga0496112_0040665_371_1036 | 220 |
| 437 | 3300048915 | Ga0496112_0075199 | Ga0496112_0075199_1752_2417 | 220 |
| 438 | 3300048915 | Ga0496112_0179114 | Ga0496112_0179114_954_1616 | 220 |
| 439 | 3300048916 | Ga0496113_0012706 | Ga0496113_0012706_319_984 | 220 |
| 440 | 3300048916 | Ga0496113_0209060 | Ga0496113_0209060_491_1153 | 220 |
| 441 | 3300048917 | Ga0496114_0000047 | Ga0496114_0000047_62713_63378 | 220 |
| 442 | 3300048917 | Ga0496114_0000920 | Ga0496114_0000920_708_1373 | 220 |
| 443 | 3300048917 | Ga0496114_0001652 | Ga0496114_0001652_1717_2379 | 220 |
| 444 | 3300048917 | Ga0496114_0318741 | Ga0496114_0318741_112_774 | 220 |
| 445 | 3300048917 | Ga0496114_0640023 | Ga0496114_0640023_214_876 | 220 |
| 446 | 3300048918 | Ga0496115_0012234 | Ga0496115_0012234_5314_5979 | 220 |
| 447 | 3300048918 | Ga0496115_0017964 | Ga0496115_0017964_4117_4782 | 220 |
| 448 | 3300048918 | Ga0496115_0020390 | Ga0496115_0020390_4124_4786 | 220 |
| 449 | 3300048918 | Ga0496115_0389089 | Ga0496115_0389089_97_759 | 220 |
| 450 | 3300048919 | Ga0496116_0000025 | Ga0496116_0000025_305437_306099 | 220 |
| 451 | 3300048919 | Ga0496116_0000968 | Ga0496116_0000968_6887_7552 | 220 |
| 452 | 3300048919 | Ga0496116_0003154 | Ga0496116_0003154_13411_14073 | 220 |
| 453 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_305437_306099 | 220 |
| 454 | 3300048920 | Ga0496117_0001082 | Ga0496117_0001082_33895_34557 | 220 |
| 455 | 3300048920 | Ga0496117_0025351 | Ga0496117_0025351_2477_3142 | 220 |
| 456 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_305437_306099 | 220 |
| 457 | 3300048921 | Ga0496118_0001424 | Ga0496118_0001424_22722_23384 | 220 |
| 458 | 3300048921 | Ga0496118_0007848 | Ga0496118_0007848_8626_9291 | 220 |
| 459 | 3300048921 | Ga0496118_0192602 | Ga0496118_0192602_225_890 | 220 |
| 460 | 3300048922 | Ga0496119_0000041 | Ga0496119_0000041_164524_165186 | 220 |
| 461 | 3300048922 | Ga0496119_0001956 | Ga0496119_0001956_3532_4197 | 220 |
| 462 | 3300048922 | Ga0496119_0013686 | Ga0496119_0013686_2278_2940 | 220 |
| 463 | 3300048923 | Ga0496120_0000027 | Ga0496120_0000027_35819_36481 | 220 |
| 464 | 3300048923 | Ga0496120_0018829 | Ga0496120_0018829_1269_1931 | 220 |
| 465 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_108725_109390 | 220 |
| 466 | 3300048924 | Ga0496121_0000171 | Ga0496121_0000171_138392_139054 | 220 |
| 467 | 3300048925 | Ga0496122_0000313 | Ga0496122_0000313_105042_105707 | 220 |
| 468 | 3300048926 | Ga0496123_0012714 | Ga0496123_0012714_5912_6577 | 220 |
| 469 | 3300048927 | Ga0496124_0000117 | Ga0496124_0000117_108725_109390 | 220 |
| 470 | 3300048927 | Ga0496124_0078547 | Ga0496124_0078547_571_1233 | 220 |
| 471 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_1080378_1081043 | 220 |
| 472 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_108725_109390 | 220 |
| 473 | 3300048929 | Ga0496126_0004545 | Ga0496126_0004545_2216_2878 | 220 |
| 474 | 3300048929 | Ga0496126_0005051 | Ga0496126_0005051_437_1099 | 220 |
| 475 | 3300048929 | Ga0496126_0068271 | Ga0496126_0068271_2288_2950 | 220 |
| 476 | 3300049569 | Ga0501032_0000802 | Ga0501032_0000802_20294_20959 | 220 |
| 477 | 3300049571 | Ga0501034_0018563 | Ga0501034_0018563_2663_3328 | 220 |
| 478 | 3300049572 | Ga0501036_0114823 | Ga0501036_0114823_632_1297 | 220 |
| 479 | 3300049573 | Ga0501037_0004004 | Ga0501037_0004004_897_1562 | 220 |
| 480 | 3300049574 | Ga0501038_0002117 | Ga0501038_0002117_9120_9785 | 220 |
| 481 | 3300049575 | Ga0501039_0002618 | Ga0501039_0002618_9302_9967 | 220 |
| 482 | 3300049579 | Ga0501043_0002150 | Ga0501043_0002150_11434_12099 | 220 |
| 483 | 3300049586 | Ga0501070_0003703 | Ga0501070_0003703_11631_12296 | 220 |
| 484 | 3300049586 | Ga0501070_0038311 | Ga0501070_0038311_2581_3243 | 220 |
| 485 | 3300049589 | Ga0501073_0090176 | Ga0501073_0090176_174_839 | 220 |
| 486 | 3300049742 | Ga0501080_0232394 | Ga0501080_0232394_253_915 | 220 |
| 487 | 3300049742 | Ga0501080_0821289 | Ga0501080_0821289_65_727 | 220 |
| 488 | 3300049823 | Ga0501044_0025823 | Ga0501044_0025823_1884_2549 | 220 |
| 489 | 3300050489 | nmdc:mga03683_84897_c1 | nmdc:mga03683_84897_c1_692_1357 | 220 |
| 490 | 3300050490 | nmdc:mga03n38_20343_c1 | nmdc:mga03n38_20343_c1_171_833 | 220 |
| 491 | 3300050490 | nmdc:mga03n38_229271_c1 | nmdc:mga03n38_229271_c1_29_691 | 220 |
| 492 | 3300050490 | nmdc:mga03n38_301215_c1 | nmdc:mga03n38_301215_c1_81_743 | 220 |
| 493 | 3300050490 | nmdc:mga03n38_44155_c1 | nmdc:mga03n38_44155_c1_1100_1762 | 220 |
| 494 | 3300050490 | nmdc:mga03n38_6741_c1 | nmdc:mga03n38_6741_c1_1259_1921 | 220 |
| 495 | 3300050490 | nmdc:mga03n38_8096_c1 | nmdc:mga03n38_8096_c1_2658_3320 | 220 |
| 496 | 3300050490 | nmdc:mga03n38_8584_c1 | nmdc:mga03n38_8584_c1_2934_3599 | 220 |
| 497 | 3300050491 | nmdc:mga00v17_11911_c2 | nmdc:mga00v17_11911_c2_1463_2125 | 220 |
| 498 | 3300050491 | nmdc:mga00v17_34112_c1 | nmdc:mga00v17_34112_c1_680_1342 | 220 |
| 499 | 3300050491 | nmdc:mga00v17_41508_c1 | nmdc:mga00v17_41508_c1_2092_2754 | 220 |
| 500 | 3300050491 | nmdc:mga00v17_47663_c1 | nmdc:mga00v17_47663_c1_1083_1748 | 220 |
| 501 | 3300050491 | nmdc:mga00v17_954_c1 | nmdc:mga00v17_954_c1_2933_3595 | 220 |
| 502 | 3300050492 | nmdc:mga0yw44_11339_c1 | nmdc:mga0yw44_11339_c1_2415_3077 | 220 |
| 503 | 3300050492 | nmdc:mga0yw44_9480_c2 | nmdc:mga0yw44_9480_c2_1387_2049 | 220 |
| 504 | 3300050494 | nmdc:mga06z11_13199_c1 | nmdc:mga06z11_13199_c1_2070_2732 | 220 |
| 505 | 3300050494 | nmdc:mga06z11_6731_c1 | nmdc:mga06z11_6731_c1_3787_4449 | 220 |
| 506 | 3300050495 | nmdc:mga04h51_8549_c1 | nmdc:mga04h51_8549_c1_182_844 | 220 |
| 507 | 3300050496 | nmdc:mga07m45_213722_c1 | nmdc:mga07m45_213722_c1_206_871 | 220 |
| 508 | 3300050496 | nmdc:mga07m45_3066_c1 | nmdc:mga07m45_3066_c1_2204_2866 | 220 |
| 509 | 3300050496 | nmdc:mga07m45_71818_c1 | nmdc:mga07m45_71818_c1_415_1077 | 220 |
| 510 | 3300050507 | nmdc:mga05p37_11243_c1 | nmdc:mga05p37_11243_c1_4541_5203 | 220 |
| 511 | 3300050509 | nmdc:mga0qj67_13317_c1 | nmdc:mga0qj67_13317_c1_1715_2377 | 220 |
| 512 | 3300050509 | nmdc:mga0qj67_249215_c1 | nmdc:mga0qj67_249215_c1_331_993 | 220 |
| 513 | 3300050509 | nmdc:mga0qj67_653072_c1 | nmdc:mga0qj67_653072_c1_160_822 | 220 |
| 514 | 3300050510 | nmdc:mga06r32_48221_c1 | nmdc:mga06r32_48221_c1_1601_2263 | 220 |
| 515 | 3300050516 | nmdc:mga0sz30_119319_c1 | nmdc:mga0sz30_119319_c1_165_827 | 220 |
| 516 | 3300050516 | nmdc:mga0sz30_1564_c1 | nmdc:mga0sz30_1564_c1_6651_7316 | 220 |
| 517 | 3300050516 | nmdc:mga0sz30_2532_c1 | nmdc:mga0sz30_2532_c1_2719_3381 | 220 |
| 518 | 3300050516 | nmdc:mga0sz30_49661_c1 | nmdc:mga0sz30_49661_c1_891_1553 | 220 |
| 519 | 3300050516 | nmdc:mga0sz30_96022_c1 | nmdc:mga0sz30_96022_c1_105_767 | 220 |
| 520 | 3300053085 | Ga0495619_0235701 | Ga0495619_0235701_305_967 | 220 |
| 521 | 3300053104 | Ga0500556_0001549 | Ga0500556_0001549_4201_4863 | 220 |
| 522 | 3300053104 | Ga0500556_0041723 | Ga0500556_0041723_656_1318 | 220 |
| 523 | 3300053108 | Ga0500562_006808 | Ga0500562_006808_188_850 | 220 |
| 524 | 3300053139 | Ga0500568_0034795 | Ga0500568_0034795_1232_1894 | 220 |
| 525 | 3300053142 | Ga0500577_0115249 | Ga0500577_0115249_407_1069 | 220 |
| 526 | 3300053153 | Ga0500616_0031099 | Ga0500616_0031099_1685_2347 | 220 |
| 527 | 3300053153 | Ga0500616_0037529 | Ga0500616_0037529_1859_2521 | 220 |
| 528 | 3300061719 | Ga0466962_0034749 | Ga0466962_0034749_460_1122 | 220 |
| 529 | 3300061719 | Ga0466962_0207148 | Ga0466962_0207148_275_937 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zih-assembly1.cif.gz_C | crystal structure of yeast vps74 | 0.7463 | 3 | 219 |
| 2zih-assembly1.cif.gz_C | crystal structure of yeast vps74 | 0.7348 | 3 | 219 |
| 3kn1-assembly1.cif.gz_A | crystal structure of golgi phosphoprotein 3 n-term truncation variant | 0.708 | 3 | 220 |
| 3kn1-assembly1.cif.gz_A | crystal structure of golgi phosphoprotein 3 n-term truncation variant | 0.6996 | 3 | 220 |
| 4tu3-assembly1.cif.gz_A | crystal structure of yeast sac1/vps74 complex | 0.6941 | 3 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7FGM1_47_294_1.10.3630.10 | Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like | 0.74 | 3 | 219 | 1.10.3630.10 |
| af_E7FGM1_47_294_1.10.3630.10 | Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like | 0.7285 | 3 | 219 | 1.10.3630.10 |
| 4tu3A00 | Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like | 0.6941 | 3 | 218 | 1.10.3630.10 |
| 3kn1A00 | Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like | 0.6888 | 5 | 220 | 1.10.3630.10 |
| 4tu3A00 | Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like | 0.6801 | 3 | 218 | 1.10.3630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A0WR48-F1-model_v4 | deleted | 0.9891 | 1 | 219 |
|
| AF-A0A1T3WNY8-F1-model_v4 | GPP34 family phosphoprotein | 0.9833 | 36 | 219 |
GO:0005737
GO:0012505 GO:0016020 GO:0043231 GO:0070273 |
| AF-A0A1A0WR48-F1-model_v4 | deleted | 0.9802 | 1 | 219 |
|
| AF-A0A2S8BQ81-F1-model_v4 | Uncharacterized protein | 0.9613 | 143 | 218 |
|
| AF-A0A1T3WNY8-F1-model_v4 | GPP34 family phosphoprotein | 0.9576 | 36 | 219 |
GO:0005737
GO:0012505 GO:0016020 GO:0043231 GO:0070273 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar