F459781

General Info

Members Datasets Scaffolds Average Seq Length
529 270 521 220

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100488907|Ga0068854_1004889071
Length 226
Sequence MAQIAEDLFLLLLDNASAQPGLDRARRERVLSGAVLMDLAYACRIRPAMAGESVEPGRLVALAVPGPMDPVVAPAFELLQRRPLRPATAVKRLSKHTEEKLANYLEYTGQIRRVRLNSKLLSHPYAWPLTNRERVGHARSALLAALFDGRPPAPPTAAIISLLHAVDGLGALLSLNDRGWRWVHARAGEIASGSWVDDYPTALPEVNLAITASAVREALVVCPVIE

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
167 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
180 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
181 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0
Isolates 1.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.48
Nodule 0.19
Rhizoplane 13.61
Rhizosphere 66.35
Stem 0
Stem Tuber 0
Unclassified 7.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1008668 3300001977 Bacteria 1532
2 JGI24743J22301_10001109 3300001991 Bacteria 3599
3 JGI24744J21845_10016468 3300002077 Bacteria 1471
4 JGI24751J29686_10006698 3300002459 Bacteria 2348
5 Ga0055540_1000043 3300003792 Bacteria 155228
6 Ga0055540_1000702 3300003792 Bacteria 23030
7 Ga0055540_1000980 3300003792 Bacteria 18425
8 Ga0055540_1009458 3300003792 Bacteria 3362
9 Ga0070676_10024123 3300005328 Bacteria 3423
10 Ga0070683_100055090 3300005329 Bacteria 3689
11 Ga0070690_100029432 3300005330 Bacteria 3407
12 Ga0070677_10027081 3300005333 Bacteria 2155
13 Ga0068869_100107462 3300005334 Bacteria 2118
14 Ga0068869_100500864 3300005334 Bacteria 1014
15 Ga0068868_100001734 3300005338 Bacteria 14943
16 Ga0068868_100025807 3300005338 Bacteria 4473
17 Ga0070689_100209842 3300005340 Bacteria 1593
18 Ga0070668_100016270 3300005347 Bacteria 5563
19 Ga0070668_100035317 3300005347 Bacteria 3812
20 Ga0070669_100001560 3300005353 Bacteria 16596
21 Ga0070669_100207630 3300005353 Bacteria 1544
22 Ga0070669_100713424 3300005353 Bacteria 848
23 Ga0070671_100002251 3300005355 Bacteria 14896
24 Ga0070671_100092563 3300005355 Bacteria 2533
25 Ga0070671_100470927 3300005355 Bacteria 1079
26 Ga0070674_100001623 3300005356 Bacteria 12087
27 Ga0070674_100292270 3300005356 Bacteria 1296
28 Ga0070673_100109160 3300005364 Bacteria 2292
29 Ga0070667_100000190 3300005367 Bacteria 73682
30 Ga0070667_100000658 3300005367 Bacteria 33550
31 Ga0070667_100014989 3300005367 Bacteria 6404
32 Ga0070667_100047859 3300005367 Bacteria 3599
33 Ga0070667_100071672 3300005367 Bacteria 2951
34 Ga0070667_100923008 3300005367 Bacteria 813
35 Ga0070709_10011186 3300005434 Bacteria 4992
36 Ga0070713_100275235 3300005436 Bacteria 1543
37 Ga0070710_10012792 3300005437 Bacteria 4179
38 Ga0070701_10001036 3300005438 Bacteria 10124
39 Ga0070711_100005803 3300005439 Bacteria 7412
40 Ga0070711_100018139 3300005439 Bacteria 4489
41 Ga0070711_100755347 3300005439 Bacteria 822
42 Ga0070700_100057808 3300005441 Bacteria 2434
43 Ga0070700_100192507 3300005441 Bacteria 1427
44 Ga0070694_100029737 3300005444 Bacteria 3568
45 Ga0070663_100027368 3300005455 Bacteria 3871
46 Ga0070663_100084669 3300005455 Bacteria 2338
47 Ga0070663_100443222 3300005455 Bacteria 1069
48 Ga0070678_100000951 3300005456 Bacteria 14917
49 Ga0070678_100239638 3300005456 Bacteria 1516
50 Ga0070662_100015863 3300005457 Bacteria 5053
51 Ga0068867_100001628 3300005459 Bacteria 15617
52 Ga0070684_100123126 3300005535 Bacteria 2334
53 Ga0070697_100642687 3300005536 Bacteria 934
54 Ga0068853_100103388 3300005539 Bacteria 2521
55 Ga0070672_100049966 3300005543 Bacteria 3256
56 Ga0070686_100358953 3300005544 Bacteria 1097
57 Ga0070695_100222383 3300005545 Bacteria 1361
58 Ga0070696_100075314 3300005546 Bacteria 2381
59 Ga0070693_100003536 3300005547 Bacteria 7287
60 Ga0070665_100003854 3300005548 Bacteria 15870
61 Ga0070665_100014251 3300005548 Bacteria 7984
62 Ga0070665_100073934 3300005548 Bacteria 3414
63 Ga0070665_100075325 3300005548 Bacteria 3382
64 Ga0070665_100291312 3300005548 Bacteria 1635
65 Ga0070704_100000104 3300005549 Bacteria 29724
66 Ga0068854_100000198 3300005578 Bacteria 40596
67 Ga0068854_100488907 3300005578 Bacteria 1034
68 Ga0070702_100012280 3300005615 Bacteria 4286
69 Ga0070702_100363600 3300005615 Bacteria 1023
70 Ga0068852_100222165 3300005616 Bacteria 1797
71 Ga0068852_100304780 3300005616 Bacteria 1543
72 Ga0068859_100003525 3300005617 Bacteria 15932
73 Ga0068859_100007646 3300005617 Bacteria 10982
74 Ga0068859_100135370 3300005617 Bacteria 2536
75 Ga0068859_100715821 3300005617 Bacteria 1091
76 Ga0068864_100363782 3300005618 Bacteria 1368
77 Ga0068864_100820276 3300005618 Bacteria 915
78 Ga0068866_10222711 3300005718 Bacteria 1139
79 Ga0068861_100035517 3300005719 Bacteria 3693
80 Ga0068861_100068354 3300005719 Bacteria 2745
81 Ga0068861_100080696 3300005719 Bacteria 2545
82 Ga0068861_100086280 3300005719 Bacteria 2467
83 Ga0068863_100000260 3300005841 Bacteria 55182
84 Ga0068863_100005671 3300005841 Bacteria 12263
85 Ga0068863_100822522 3300005841 Bacteria 927
86 Ga0068858_100017445 3300005842 Bacteria 6734
87 Ga0068858_100105923 3300005842 Bacteria 2624
88 Ga0068860_100000099 3300005843 Bacteria 145436
89 Ga0068860_100104257 3300005843 Bacteria 2707
90 Ga0068860_100126558 3300005843 Bacteria 2449
91 Ga0068862_100000086 3300005844 Bacteria 110489
92 Ga0068862_100015564 3300005844 Bacteria 6317
93 Ga0068862_100381718 3300005844 Bacteria 1314
94 Ga0081455_10019845 3300005937 Bacteria 6348
95 Ga0075365_10040337 3300006038 Bacteria 3044
96 Ga0075365_10043712 3300006038 Bacteria 2933
97 Ga0075365_10110800 3300006038 Bacteria 1886
98 Ga0075368_10088826 3300006042 Bacteria 1263
99 Ga0075363_100005604 3300006048 Bacteria 5609
100 Ga0075363_100011207 3300006048 Bacteria 4287
101 Ga0075363_100011781 3300006048 Bacteria 4196
102 Ga0075363_100018588 3300006048 Bacteria 3466
103 Ga0075363_100027946 3300006048 Bacteria 2897
104 Ga0075363_100111288 3300006048 Bacteria 1522
105 Ga0075364_10001316 3300006051 Bacteria 13362
106 Ga0075364_10005926 3300006051 Bacteria 7144
107 Ga0075364_10019759 3300006051 Bacteria 4231
108 Ga0075364_10028678 3300006051 Bacteria 3565
109 Ga0075364_10212769 3300006051 Bacteria 1311
110 Ga0070715_10128011 3300006163 Bacteria 1219
111 Ga0070716_100010650 3300006173 Bacteria 4615
112 Ga0070716_100141516 3300006173 Bacteria 1535
113 Ga0075362_10111175 3300006177 Bacteria 1290
114 Ga0075367_10024689 3300006178 Bacteria 3391
115 Ga0075367_10031003 3300006178 Bacteria 3069
116 Ga0075369_10006736 3300006186 Bacteria 4357
117 Ga0075369_10013662 3300006186 Bacteria 3229
118 Ga0075369_10155246 3300006186 Bacteria 1047
119 Ga0097621_100571153 3300006237 Bacteria 1031
120 Ga0097621_100890293 3300006237 Bacteria 829
121 Ga0075370_10012251 3300006353 Bacteria 4526
122 Ga0075370_10014423 3300006353 Bacteria 4215
123 Ga0075370_10094810 3300006353 Bacteria 1723
124 Ga0075428_100004646 3300006844 Bacteria 15196
125 Ga0075430_100305521 3300006846 Bacteria 1316
126 Ga0075431_100067323 3300006847 Bacteria 3697
127 Ga0068865_100026719 3300006881 Bacteria 3807
128 Ga0068865_100268582 3300006881 Bacteria 1353
129 Ga0097620_100003525 3300006931 Bacteria 15932
130 Ga0097620_100007646 3300006931 Bacteria 10982
131 Ga0097620_100135363 3300006931 Bacteria 2536
132 Ga0097620_100715736 3300006931 Bacteria 1091
133 Ga0099795_10013890 3300007788 Bacteria 2483
134 Ga0105250_10009943 3300009092 Bacteria 3990
135 Ga0111539_10643054 3300009094 Bacteria 1235
136 Ga0105245_10013909 3300009098 Bacteria 7008
137 Ga0105245_10039068 3300009098 Bacteria 4224
138 Ga0105245_10092421 3300009098 Bacteria 2786
139 Ga0105245_10909133 3300009098 Bacteria 922
140 Ga0105247_10000051 3300009101 Bacteria 145981
141 Ga0105247_10002033 3300009101 Bacteria 14016
142 Ga0105247_10239659 3300009101 Bacteria 1235
143 Ga0114129_10038950 3300009147 Bacteria 6700
144 Ga0105243_10004906 3300009148 Bacteria 10489
145 Ga0105243_10031725 3300009148 Bacteria 4076
146 Ga0105241_10237635 3300009174 Bacteria 1539
147 Ga0105242_10004844 3300009176 Bacteria 10423
148 Ga0105242_10081882 3300009176 Bacteria 2700
149 Ga0105248_10000281 3300009177 Bacteria 60208
150 Ga0105248_10012267 3300009177 Bacteria 9450
151 Ga0105248_10064198 3300009177 Bacteria 4122
152 Ga0105237_10006641 3300009545 Bacteria 12785
153 Ga0105237_10042955 3300009545 Bacteria 4556
154 Ga0105237_10626982 3300009545 Bacteria 1082
155 Ga0105238_10071986 3300009551 Bacteria 3454
156 Ga0105238_10548710 3300009551 Bacteria 1160
157 Ga0105249_10000020 3300009553 Bacteria 260634
158 Ga0105249_10003714 3300009553 Bacteria 13165
159 Ga0105249_10110702 3300009553 Bacteria 2595
160 Ga0105239_10012351 3300010375 Bacteria 9512
161 Ga0105239_10042126 3300010375 Bacteria 5003
162 Ga0105239_10079607 3300010375 Bacteria 3605
163 Ga0105246_10601833 3300011119 Bacteria 950
164 Ga0157374_10035687 3300013296 Bacteria 4550
165 Ga0157374_10702745 3300013296 Bacteria 1024
166 Ga0157378_10004748 3300013297 Bacteria 11910
167 Ga0157378_10149774 3300013297 Bacteria 2173
168 Ga0163162_10009938 3300013306 Bacteria 9256
169 Ga0163162_10611665 3300013306 Bacteria 1215
170 Ga0157372_10005118 3300013307 Bacteria 13933
171 Ga0157372_10378192 3300013307 Bacteria 1650
172 Ga0157375_10008395 3300013308 Bacteria 9046
173 Ga0157375_10378368 3300013308 Bacteria 1582
174 Ga0157375_10494603 3300013308 Bacteria 1387
175 Ga0157375_10801365 3300013308 Bacteria 1091
176 Ga0163163_10009624 3300014325 Bacteria 8641
177 Ga0163163_10014582 3300014325 Bacteria 7230
178 Ga0157380_10006508 3300014326 Bacteria 8236
179 Ga0182008_10184155 3300014497 Bacteria 1058
180 Ga0157377_10055109 3300014745 Bacteria 2253
181 Ga0157377_10376452 3300014745 Bacteria 960
182 Ga0157379_10008800 3300014968 Bacteria 8805
183 Ga0157379_10181415 3300014968 Bacteria 1902
184 Ga0163161_10003327 3300017792 Bacteria 11267
185 Ga0163161_10048455 3300017792 Bacteria 3068
186 Ga0163161_10207593 3300017792 Bacteria 1512
187 Ga0213876_10034214 3300021384 Bacteria 2680
188 Ga0213875_10033385 3300021388 Bacteria 2430
189 Ga0209673_1005791 3300025273 Bacteria 6142
190 Ga0209051_1000108 3300025303 Bacteria 155280
191 Ga0209051_1000337 3300025303 Bacteria 70482
192 Ga0209051_1001005 3300025303 Bacteria 27084
193 Ga0207696_1018610 3300025711 Bacteria 2277
194 Ga0207692_10105812 3300025898 Bacteria 1552
195 Ga0207642_10000267 3300025899 Bacteria 15671
196 Ga0207642_10149034 3300025899 Bacteria 1243
197 Ga0207710_10000010 3300025900 Bacteria 482087
198 Ga0207710_10032856 3300025900 Bacteria 2274
199 Ga0207688_10008080 3300025901 Bacteria 5723
200 Ga0207688_10019117 3300025901 Bacteria 3730
201 Ga0207647_10028903 3300025904 Bacteria 3595
202 Ga0207685_10077724 3300025905 Bacteria 1364
203 Ga0207699_10137763 3300025906 Bacteria 1600
204 Ga0207645_10073119 3300025907 Bacteria 2195
205 Ga0207671_10087402 3300025914 Bacteria 2344
206 Ga0207671_10156722 3300025914 Bacteria 1762
207 Ga0207693_10000430 3300025915 Bacteria 38189
208 Ga0207693_10006063 3300025915 Bacteria 10010
209 Ga0207663_10006540 3300025916 Bacteria 5976
210 Ga0207657_10025944 3300025919 Bacteria 5395
211 Ga0207657_10326445 3300025919 Bacteria 1213
212 Ga0207652_10342346 3300025921 Bacteria 1350
213 Ga0207681_10002745 3300025923 Bacteria 11145
214 Ga0207681_10490089 3300025923 Bacteria 1005
215 Ga0207694_10291796 3300025924 Bacteria 1341
216 Ga0207694_10490804 3300025924 Bacteria 1028
217 Ga0207687_10001991 3300025927 Bacteria 14042
218 Ga0207687_10289358 3300025927 Bacteria 1316
219 Ga0207700_10283271 3300025928 Bacteria 1426
220 Ga0207664_10164583 3300025929 Bacteria 1894
221 Ga0207644_10005098 3300025931 Bacteria 8579
222 Ga0207644_10129202 3300025931 Bacteria 1932
223 Ga0207690_10007060 3300025932 Bacteria 6667
224 Ga0207706_10215748 3300025933 Bacteria 1681
225 Ga0207670_10013622 3300025936 Bacteria 4801
226 Ga0207669_10003498 3300025937 Bacteria 6794
227 Ga0207669_10277900 3300025937 Bacteria 1261
228 Ga0207704_10000321 3300025938 Bacteria 22424
229 Ga0207704_10072162 3300025938 Bacteria 2193
230 Ga0207665_10015862 3300025939 Bacteria 4944
231 Ga0207665_10018381 3300025939 Bacteria 4593
232 Ga0207691_10069377 3300025940 Bacteria 3184
233 Ga0207711_10000364 3300025941 Bacteria 48006
234 Ga0207711_10143131 3300025941 Bacteria 2152
235 Ga0207689_10023094 3300025942 Bacteria 5223
236 Ga0207689_10047080 3300025942 Bacteria 3562
237 Ga0207661_10040444 3300025944 Bacteria 3665
238 Ga0207667_10197156 3300025949 Bacteria 2066
239 Ga0207667_10276943 3300025949 Bacteria 1715
240 Ga0207651_10126327 3300025960 Bacteria 1949
241 Ga0207712_10000010 3300025961 Bacteria 455972
242 Ga0207712_10029548 3300025961 Bacteria 3678
243 Ga0207668_10001252 3300025972 Bacteria 15141
244 Ga0207668_10017900 3300025972 Bacteria 4449
245 Ga0207668_10559622 3300025972 Bacteria 992
246 Ga0207640_10024703 3300025981 Bacteria 3629
247 Ga0207658_10001232 3300025986 Bacteria 20240
248 Ga0207658_10009397 3300025986 Bacteria 6632
249 Ga0207658_10086462 3300025986 Bacteria 2418
250 Ga0207658_10242190 3300025986 Bacteria 1528
251 Ga0207658_10538919 3300025986 Bacteria 1043
252 Ga0207658_10791979 3300025986 Bacteria 860
253 Ga0207703_10003382 3300026035 Bacteria 13397
254 Ga0207703_10405499 3300026035 Bacteria 1266
255 Ga0207639_10005886 3300026041 Bacteria 8308
256 Ga0207678_10010154 3300026067 Bacteria 8263
257 Ga0207678_10010796 3300026067 Bacteria 8024
258 Ga0207678_10018387 3300026067 Bacteria 6137
259 Ga0207678_10233960 3300026067 Bacteria 1573
260 Ga0207708_10006037 3300026075 Bacteria 8978
261 Ga0207641_10000445 3300026088 Bacteria 47406
262 Ga0207641_10008412 3300026088 Bacteria 8527
263 Ga0207641_10075567 3300026088 Bacteria 2909
264 Ga0207641_10320828 3300026088 Bacteria 1469
265 Ga0207648_10001738 3300026089 Bacteria 23842
266 Ga0207648_10008737 3300026089 Bacteria 9763
267 Ga0207676_10260385 3300026095 Bacteria 1566
268 Ga0207676_10895178 3300026095 Bacteria 870
269 Ga0207675_100060197 3300026118 Bacteria 3545
270 Ga0207675_100065641 3300026118 Bacteria 3392
271 Ga0207675_100109085 3300026118 Bacteria 2611
272 Ga0207675_100111671 3300026118 Bacteria 2579
273 Ga0207683_10014544 3300026121 Bacteria 6704
274 Ga0207683_10039841 3300026121 Bacteria 4099
275 Ga0207683_10276020 3300026121 Bacteria 1536
276 Ga0207683_10476896 3300026121 Bacteria 1151
277 Ga0207698_10179214 3300026142 Bacteria 1875
278 Ga0209813_10007615 3300027866 Bacteria 2703
279 Ga0268266_10002054 3300028379 Bacteria 22324
280 Ga0268266_10049634 3300028379 Bacteria 3599
281 Ga0268266_10081470 3300028379 Bacteria 2822
282 Ga0268266_10526272 3300028379 Bacteria 1131
283 Ga0268265_10000014 3300028380 Bacteria 330186
284 Ga0268264_10000137 3300028381 Bacteria 176081
285 Ga0268264_10001869 3300028381 Bacteria 19143
286 Ga0265327_10000662 3300031251 Bacteria 55374
287 Ga0307405_10569862 3300031731 Bacteria 919
288 Ga0307413_10058299 3300031824 Bacteria 2366
289 Ga0307413_10309337 3300031824 Bacteria 1202
290 Ga0307410_10582332 3300031852 Bacteria 931
291 Ga0307406_10457194 3300031901 Bacteria 1026
292 Ga0307412_10022222 3300031911 Bacteria 3886
293 Ga0307409_100241070 3300031995 Bacteria 1646
294 Ga0307409_100643467 3300031995 Bacteria 1053
295 Ga0307416_100071205 3300032002 Bacteria 2887
296 Ga0307411_10192228 3300032005 Bacteria 1559
297 Ga0307415_100010496 3300032126 Bacteria 5250
298 Ga0373958_0062105 3300034819 Bacteria 812
299 Ga0373959_0074166 3300034820 Bacteria 774
300 Ga0373941_0029703 3300035115 Bacteria 1615
301 Ga0373960_0016773 3300035121 Bacteria 1889
302 Ga0373931_0033597 3300035691 Bacteria 2659
303 Ga0373931_0269128 3300035691 Bacteria 1042
304 Ga0373933_0394717 3300035724 Bacteria 902
305 Ga0373947_0353499 3300035725 Bacteria 986
306 Ga0373925_0547925 3300037068 Bacteria 951
307 Ga0436364_0204668 3300037853 Bacteria 11549
308 Ga0436361_1210779 3300039447 Bacteria 1525
309 Ga0436363_0375672 3300039450 Bacteria 2485
310 Ga0436363_1689608 3300039450 Bacteria 1091
311 Ga0439466_0003909 3300041411 Bacteria 5746
312 Ga0439466_0008306 3300041411 Bacteria 3913
313 Ga0439466_0042416 3300041411 Bacteria 1515
314 Ga0439465_0007839 3300041413 Bacteria 3383
315 Ga0451795_1658859 3300041456 Bacteria 2345
316 Ga0451806_337869 3300041462 Bacteria 905
317 Ga0451855_0621036 3300041511 Bacteria 748
318 Ga0439431_0000466 3300041997 Bacteria 8585
319 Ga0439442_020862 3300042002 Bacteria 1358
320 Ga0439445_0000791 3300042004 Bacteria 6652
321 Ga0439445_0044251 3300042004 Bacteria 1189
322 Ga0439445_0044749 3300042004 Bacteria 1183
323 Ga0439448_0112850 3300042005 Bacteria 929
324 Ga0439434_0001376 3300042435 Bacteria 7021
325 Ga0439434_0015932 3300042435 Bacteria 2242
326 Ga0439435_0131608 3300042436 Bacteria 791
327 Ga0439459_0008449 3300042438 Bacteria 1760
328 Ga0466969_0030153 3300044656 Bacteria 2765
329 Ga0466972_0028426 3300044658 Bacteria 2758
330 Ga0466965_0008459 3300044683 Bacteria 4762
331 Ga0466965_0040561 3300044683 Bacteria 2292
332 Ga0466965_0087672 3300044683 Bacteria 1580
333 Ga0466965_0408994 3300044683 Bacteria 751
334 Ga0466966_0255878 3300044684 Bacteria 1054
335 Ga0466961_0055574 3300044693 Bacteria 2523
336 Ga0466964_0044986 3300044706 Bacteria 1795
337 Ga0466964_0233728 3300044706 Bacteria 898
338 Ga0466971_0003465 3300044719 Bacteria 6737
339 Ga0466968_0001090 3300044735 Bacteria 9612
340 Ga0466970_0007705 3300044765 Bacteria 5403
341 Ga0466970_0040912 3300044765 Bacteria 2462
342 Ga0466957_0008089 3300044842 Bacteria 5966
343 Ga0466957_0025888 3300044842 Bacteria 3478
344 Ga0466957_0721122 3300044842 Bacteria 705
345 Ga0466960_0365485 3300044901 Bacteria 825
346 Ga0466959_0016742 3300045049 Bacteria 5364
347 Ga0466959_0037597 3300045049 Bacteria 3577
348 Ga0466967_0029824 3300045976 Bacteria 4571
349 Ga0466967_0053339 3300045976 Bacteria 3553
350 Ga0466967_0060162 3300045976 Bacteria 3365
351 Ga0466967_0074824 3300045976 Bacteria 3043
352 Ga0466967_0079011 3300045976 Bacteria 2965
353 Ga0466967_0194987 3300045976 Bacteria 1916
354 Ga0466967_0297948 3300045976 Bacteria 1551
355 Ga0466967_0806831 3300045976 Bacteria 932
356 Ga0495603_0093918 3300046455 Bacteria 1753
357 Ga0495629_0017856 3300046459 Bacteria 5085
358 Ga0495638_0005104 3300046460 Bacteria 9831
359 Ga0495641_0082069 3300046461 Bacteria 1444
360 Ga0495648_0141956 3300046524 Bacteria 1263
361 Ga0495665_0077349 3300046531 Bacteria 1751
362 Ga0495640_0113949 3300046533 Bacteria 1763
363 Ga0495640_0368917 3300046533 Bacteria 884
364 Ga0495625_0159156 3300046660 Bacteria 1514
365 Ga0495581_0006457 3300047315 Bacteria 6805
366 Ga0495672_0058182 3300047320 Bacteria 2242
367 Ga0495686_0002464 3300047472 Bacteria 17454
368 Ga0495593_0013334 3300047673 Bacteria 4691
369 Ga0495626_0030223 3300048091 Bacteria 2614
370 Ga0496100_0000110 3300048903 Bacteria 47145
371 Ga0496100_0002409 3300048903 Bacteria 9476
372 Ga0496100_0007114 3300048903 Bacteria 6145
373 Ga0496100_0437743 3300048903 Bacteria 1001
374 Ga0496101_0000054 3300048904 Bacteria 137699
375 Ga0496101_0000073 3300048904 Bacteria 113870
376 Ga0496101_0000790 3300048904 Bacteria 18712
377 Ga0496101_0015768 3300048904 Bacteria 5099
378 Ga0496101_0055903 3300048904 Bacteria 2852
379 Ga0496102_0000006 3300048905 Bacteria 471494
380 Ga0496102_0000118 3300048905 Bacteria 113499
381 Ga0496102_0002514 3300048905 Bacteria 15646
382 Ga0496102_0011206 3300048905 Bacteria 7723
383 Ga0496102_0095785 3300048905 Bacteria 2751
384 Ga0496102_0101095 3300048905 Bacteria 2678
385 Ga0496102_0166971 3300048905 Bacteria 2071
386 Ga0496102_0195758 3300048905 Bacteria 1905
387 Ga0496102_0499884 3300048905 Bacteria 1138
388 Ga0496103_0000006 3300048906 Bacteria 470539
389 Ga0496103_0000227 3300048906 Bacteria 54745
390 Ga0496103_0001393 3300048906 Bacteria 16261
391 Ga0496103_0006809 3300048906 Bacteria 6821
392 Ga0496103_0058746 3300048906 Bacteria 2389
393 Ga0496103_0091577 3300048906 Bacteria 1919
394 Ga0496104_0029417 3300048907 Bacteria 5096
395 Ga0496104_0038232 3300048907 Bacteria 4490
396 Ga0496104_0162493 3300048907 Bacteria 2142
397 Ga0496104_0213096 3300048907 Bacteria 1843
398 Ga0496105_0031658 3300048908 Bacteria 4336
399 Ga0496105_0047644 3300048908 Bacteria 3537
400 Ga0496105_0309205 3300048908 Bacteria 1269
401 Ga0496106_0008927 3300048909 Bacteria 7410
402 Ga0496106_0015842 3300048909 Bacteria 5575
403 Ga0496106_0029821 3300048909 Bacteria 4066
404 Ga0496106_0035196 3300048909 Bacteria 3744
405 Ga0496106_0041068 3300048909 Bacteria 3466
406 Ga0496106_0646855 3300048909 Bacteria 845
407 Ga0496107_0000261 3300048910 Bacteria 28034
408 Ga0496107_0004000 3300048910 Bacteria 9926
409 Ga0496107_0024289 3300048910 Bacteria 4288
410 Ga0496107_0085013 3300048910 Bacteria 2309
411 Ga0496108_0004834 3300048911 Bacteria 10872
412 Ga0496108_0006027 3300048911 Bacteria 9811
413 Ga0496108_0022834 3300048911 Bacteria 5148
414 Ga0496108_0270674 3300048911 Bacteria 1478
415 Ga0496109_0000152 3300048912 Bacteria 68036
416 Ga0496109_0001995 3300048912 Bacteria 16923
417 Ga0496109_0014634 3300048912 Bacteria 6826
418 Ga0496110_0000446 3300048913 Bacteria 28095
419 Ga0496110_0049486 3300048913 Bacteria 3687
420 Ga0496110_0059784 3300048913 Bacteria 3360
421 Ga0496110_0105364 3300048913 Bacteria 2530
422 Ga0496110_0345563 3300048913 Bacteria 1355
423 Ga0496111_0018923 3300048914 Bacteria 4775
424 Ga0496111_0384428 3300048914 Bacteria 1038
425 Ga0496112_0013692 3300048915 Bacteria 7497
426 Ga0496112_0040665 3300048915 Bacteria 4546
427 Ga0496112_0075199 3300048915 Bacteria 3341
428 Ga0496112_0179114 3300048915 Bacteria 2083
429 Ga0496113_0012706 3300048916 Bacteria 5668
430 Ga0496113_0209060 3300048916 Bacteria 1553
431 Ga0496114_0000047 3300048917 Bacteria 119106
432 Ga0496114_0000920 3300048917 Bacteria 22028
433 Ga0496114_0001652 3300048917 Bacteria 16924
434 Ga0496114_0318741 3300048917 Bacteria 1373
435 Ga0496114_0640023 3300048917 Bacteria 936
436 Ga0496115_0012234 3300048918 Bacteria 6453
437 Ga0496115_0017964 3300048918 Bacteria 5418
438 Ga0496115_0020390 3300048918 Bacteria 5114
439 Ga0496115_0389089 3300048918 Bacteria 1133
440 Ga0496116_0000025 3300048919 Bacteria 470539
441 Ga0496116_0000968 3300048919 Bacteria 35439
442 Ga0496116_0003154 3300048919 Bacteria 16511
443 Ga0496117_0000006 3300048920 Bacteria 758420
444 Ga0496117_0001082 3300048920 Bacteria 41248
445 Ga0496117_0025351 3300048920 Bacteria 4665
446 Ga0496118_0000004 3300048921 Bacteria 758420
447 Ga0496118_0001424 3300048921 Bacteria 36051
448 Ga0496118_0007848 3300048921 Bacteria 11190
449 Ga0496118_0192602 3300048921 Bacteria 1218
450 Ga0496118_0389995 3300048921 Bacteria 727
451 Ga0496119_0000041 3300048922 Bacteria 203687
452 Ga0496119_0001956 3300048922 Bacteria 23443
453 Ga0496119_0013686 3300048922 Bacteria 6435
454 Ga0496120_0000027 3300048923 Bacteria 231507
455 Ga0496120_0018829 3300048923 Bacteria 4436
456 Ga0496121_0000004 3300048924 Bacteria 1139011
457 Ga0496121_0000171 3300048924 Bacteria 144073
458 Ga0496122_0000313 3300048925 Bacteria 107106
459 Ga0496123_0012714 3300048926 Bacteria 7142
460 Ga0496124_0000117 3300048927 Bacteria 164439
461 Ga0496124_0078547 3300048927 Bacteria 2719
462 Ga0496125_0000003 3300048928 Bacteria 1189767
463 Ga0496126_0000001 3300048929 Bacteria 1139011
464 Ga0496126_0004545 3300048929 Bacteria 16497
465 Ga0496126_0005051 3300048929 Bacteria 15319
466 Ga0496126_0068271 3300048929 Bacteria 3175
467 Ga0501032_0000802 3300049569 Bacteria 25536
468 Ga0501034_0018563 3300049571 Bacteria 7129
469 Ga0501036_0114823 3300049572 Bacteria 2275
470 Ga0501037_0004004 3300049573 Bacteria 10681
471 Ga0501038_0002117 3300049574 Bacteria 18420
472 Ga0501039_0002618 3300049575 Bacteria 13433
473 Ga0501043_0002150 3300049579 Bacteria 16803
474 Ga0501070_0003703 3300049586 Bacteria 13207
475 Ga0501070_0038311 3300049586 Bacteria 4000
476 Ga0501073_0090176 3300049589 Bacteria 2131
477 Ga0501080_0232394 3300049742 Bacteria 1685
478 Ga0501080_0821289 3300049742 Bacteria 814
479 Ga0501044_0025823 3300049823 Bacteria 6227
480 Ga0501044_0037093 3300049823 Bacteria 5097
481 nmdc:mga03683_84897_c1 3300050489 Bacteria 1372
482 nmdc:mga03n38_20343_c1 3300050490 Bacteria 2654
483 nmdc:mga03n38_229271_c1 3300050490 Bacteria 973
484 nmdc:mga03n38_301215_c1 3300050490 Bacteria 861
485 nmdc:mga03n38_44155_c1 3300050490 Bacteria 1956
486 nmdc:mga03n38_6741_c1 3300050490 Bacteria 4015
487 nmdc:mga03n38_8096_c1 3300050490 Bacteria 3753
488 nmdc:mga03n38_8584_c1 3300050490 Bacteria 3674
489 nmdc:mga00v17_11911_c2 3300050491 Bacteria 4450
490 nmdc:mga00v17_34112_c1 3300050491 Bacteria 3020
491 nmdc:mga00v17_41508_c1 3300050491 Bacteria 2764
492 nmdc:mga00v17_47663_c1 3300050491 Bacteria 2596
493 nmdc:mga00v17_954_c1 3300050491 Bacteria 15500
494 nmdc:mga0yw44_11339_c1 3300050492 Bacteria 4595
495 nmdc:mga0yw44_9480_c2 3300050492 Bacteria 4525
496 nmdc:mga06z11_13199_c1 3300050494 Bacteria 3618
497 nmdc:mga06z11_6731_c1 3300050494 Bacteria 4696
498 nmdc:mga04h51_8549_c1 3300050495 Bacteria 2741
499 nmdc:mga07m45_213722_c1 3300050496 Bacteria 1122
500 nmdc:mga07m45_3066_c1 3300050496 Bacteria 5870
501 nmdc:mga07m45_71818_c1 3300050496 Bacteria 1500
502 nmdc:mga05p37_11243_c1 3300050507 Bacteria 10646
503 nmdc:mga0qj67_13317_c1 3300050509 Bacteria 6207
504 nmdc:mga0qj67_249215_c1 3300050509 Bacteria 1441
505 nmdc:mga0qj67_653072_c1 3300050509 Bacteria 839
506 nmdc:mga06r32_48221_c1 3300050510 Bacteria 4071
507 nmdc:mga0sz30_119319_c1 3300050516 Bacteria 1159
508 nmdc:mga0sz30_1564_c1 3300050516 Bacteria 8160
509 nmdc:mga0sz30_2532_c1 3300050516 Bacteria 6515
510 nmdc:mga0sz30_49661_c1 3300050516 Bacteria 1778
511 nmdc:mga0sz30_96022_c1 3300050516 Bacteria 1292
512 Ga0495619_0235701 3300053085 Bacteria 1268
513 Ga0500556_0001549 3300053104 Bacteria 9366
514 Ga0500556_0041723 3300053104 Bacteria 1619
515 Ga0500562_006808 3300053108 Bacteria 2883
516 Ga0500568_0034795 3300053139 Bacteria 2059
517 Ga0500577_0115249 3300053142 Bacteria 1113
518 Ga0500616_0031099 3300053153 Bacteria 2926
519 Ga0500616_0037529 3300053153 Bacteria 2622
520 Ga0466962_0034749 3300061719 Bacteria 2413
521 Ga0466962_0207148 3300061719 Bacteria 959

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042438 Ga0439459_0008449 Ga0439459_0008449_182_736 184
2 3300041462 Ga0451806_337869 Ga0451806_337869_33_590 185
3 3300048921 Ga0496118_0389995 Ga0496118_0389995_117_680 186
4 3300041511 Ga0451855_0621036 Ga0451855_0621036_39_620 190
5 3300044842 Ga0466957_0721122 Ga0466957_0721122_81_659 191
6 3300017792 Ga0163161_10003327 Ga0163161_100033276 203
7 3300044683 Ga0466965_0008459 Ga0466965_0008459_449_1099 204
8 3300044735 Ga0466968_0001090 Ga0466968_0001090_8846_9496 204
9 3300044842 Ga0466957_0008089 Ga0466957_0008089_3272_3922 204
10 3300044901 Ga0466960_0365485 Ga0466960_0365485_84_734 204
11 3300045976 Ga0466967_0060162 Ga0466967_0060162_1030_1680 204
12 3300045976 Ga0466967_0297948 Ga0466967_0297948_588_1220 210
13 3300005367 Ga0070667_100923008 Ga0070667_1009230081 211
14 3300005535 Ga0070684_100123126 Ga0070684_1001231262 211
15 3300045049 Ga0466959_0016742 Ga0466959_0016742_1780_2430 215
16 3300044683 Ga0466965_0087672 Ga0466965_0087672_162_815 216
17 iso_pu_bacteria 2643221687 2644490840 216
18 iso_pu_bacteria 2643221715 2644634239 216
19 iso_pu_bacteria 2738541264 2738668449 216
20 iso_pu_bacteria 2738541356 2739147519 216
21 iso_pu_bacteria 2842134933 2842139371 216
22 iso_pu_bacteria 2902810491 2902810603 216
23 iso_pu_bacteria 2902837492 2902844006 216
24 iso_pu_bacteria 2939582691 2939584534 216
25 3300049823 Ga0501044_0037093 Ga0501044_0037093_800_1456 217
26 3300039447 Ga0436361_1210779 Ga0436361_1210779_468_1124 218
27 3300001977 JGI24746J21847_1008668 JGI24746J21847_10086682 220
28 3300001991 JGI24743J22301_10001109 JGI24743J22301_100011092 220
29 3300002077 JGI24744J21845_10016468 JGI24744J21845_100164681 220
30 3300002459 JGI24751J29686_10006698 JGI24751J29686_100066982 220
31 3300003792 Ga0055540_1000043 Ga0055540_1000043108 220
32 3300003792 Ga0055540_1000702 Ga0055540_100070224 220
33 3300003792 Ga0055540_1000980 Ga0055540_10009804 220
34 3300003792 Ga0055540_1009458 Ga0055540_10094584 220
35 3300005328 Ga0070676_10024123 Ga0070676_100241233 220
36 3300005329 Ga0070683_100055090 Ga0070683_1000550903 220
37 3300005330 Ga0070690_100029432 Ga0070690_1000294323 220
38 3300005333 Ga0070677_10027081 Ga0070677_100270813 220
39 3300005334 Ga0068869_100107462 Ga0068869_1001074623 220
40 3300005334 Ga0068869_100500864 Ga0068869_1005008641 220
41 3300005338 Ga0068868_100001734 Ga0068868_1000017348 220
42 3300005338 Ga0068868_100025807 Ga0068868_1000258074 220
43 3300005340 Ga0070689_100209842 Ga0070689_1002098421 220
44 3300005347 Ga0070668_100016270 Ga0070668_1000162705 220
45 3300005347 Ga0070668_100035317 Ga0070668_1000353174 220
46 3300005353 Ga0070669_100001560 Ga0070669_10000156012 220
47 3300005353 Ga0070669_100207630 Ga0070669_1002076302 220
48 3300005353 Ga0070669_100713424 Ga0070669_1007134241 220
49 3300005355 Ga0070671_100002251 Ga0070671_1000022517 220
50 3300005355 Ga0070671_100092563 Ga0070671_1000925632 220
51 3300005355 Ga0070671_100470927 Ga0070671_1004709272 220
52 3300005356 Ga0070674_100001623 Ga0070674_1000016238 220
53 3300005356 Ga0070674_100292270 Ga0070674_1002922702 220
54 3300005364 Ga0070673_100109160 Ga0070673_1001091602 220
55 3300005367 Ga0070667_100000190 Ga0070667_10000019051 220
56 3300005367 Ga0070667_100000658 Ga0070667_10000065821 220
57 3300005367 Ga0070667_100014989 Ga0070667_1000149892 220
58 3300005367 Ga0070667_100047859 Ga0070667_1000478592 220
59 3300005367 Ga0070667_100071672 Ga0070667_1000716723 220
60 3300005434 Ga0070709_10011186 Ga0070709_100111861 220
61 3300005436 Ga0070713_100275235 Ga0070713_1002752352 220
62 3300005437 Ga0070710_10012792 Ga0070710_100127923 220
63 3300005438 Ga0070701_10001036 Ga0070701_1000103610 220
64 3300005439 Ga0070711_100005803 Ga0070711_1000058034 220
65 3300005439 Ga0070711_100018139 Ga0070711_1000181392 220
66 3300005439 Ga0070711_100755347 Ga0070711_1007553471 220
67 3300005441 Ga0070700_100057808 Ga0070700_1000578084 220
68 3300005441 Ga0070700_100192507 Ga0070700_1001925072 220
69 3300005444 Ga0070694_100029737 Ga0070694_1000297372 220
70 3300005455 Ga0070663_100027368 Ga0070663_1000273683 220
71 3300005455 Ga0070663_100084669 Ga0070663_1000846692 220
72 3300005455 Ga0070663_100443222 Ga0070663_1004432222 220
73 3300005456 Ga0070678_100000951 Ga0070678_10000095113 220
74 3300005456 Ga0070678_100239638 Ga0070678_1002396381 220
75 3300005457 Ga0070662_100015863 Ga0070662_1000158633 220
76 3300005459 Ga0068867_100001628 Ga0068867_1000016287 220
77 3300005536 Ga0070697_100642687 Ga0070697_1006426872 220
78 3300005539 Ga0068853_100103388 Ga0068853_1001033883 220
79 3300005543 Ga0070672_100049966 Ga0070672_1000499664 220
80 3300005544 Ga0070686_100358953 Ga0070686_1003589532 220
81 3300005545 Ga0070695_100222383 Ga0070695_1002223832 220
82 3300005546 Ga0070696_100075314 Ga0070696_1000753143 220
83 3300005547 Ga0070693_100003536 Ga0070693_1000035368 220
84 3300005548 Ga0070665_100003854 Ga0070665_10000385416 220
85 3300005548 Ga0070665_100014251 Ga0070665_1000142513 220
86 3300005548 Ga0070665_100073934 Ga0070665_1000739343 220
87 3300005548 Ga0070665_100075325 Ga0070665_1000753254 220
88 3300005548 Ga0070665_100291312 Ga0070665_1002913122 220
89 3300005549 Ga0070704_100000104 Ga0070704_1000001045 220
90 3300005578 Ga0068854_100000198 Ga0068854_10000019813 220
91 3300005578 Ga0068854_100488907 Ga0068854_1004889071 220
92 3300005615 Ga0070702_100012280 Ga0070702_1000122802 220
93 3300005615 Ga0070702_100363600 Ga0070702_1003636002 220
94 3300005616 Ga0068852_100222165 Ga0068852_1002221652 220
95 3300005616 Ga0068852_100304780 Ga0068852_1003047802 220
96 3300005617 Ga0068859_100003525 Ga0068859_10000352514 220
97 3300005617 Ga0068859_100007646 Ga0068859_1000076468 220
98 3300005617 Ga0068859_100135370 Ga0068859_1001353703 220
99 3300005617 Ga0068859_100715821 Ga0068859_1007158212 220
100 3300005618 Ga0068864_100363782 Ga0068864_1003637822 220
101 3300005618 Ga0068864_100820276 Ga0068864_1008202762 220
102 3300005718 Ga0068866_10222711 Ga0068866_102227111 220
103 3300005719 Ga0068861_100035517 Ga0068861_1000355172 220
104 3300005719 Ga0068861_100068354 Ga0068861_1000683543 220
105 3300005719 Ga0068861_100080696 Ga0068861_1000806963 220
106 3300005719 Ga0068861_100086280 Ga0068861_1000862803 220
107 3300005841 Ga0068863_100000260 Ga0068863_1000002606 220
108 3300005841 Ga0068863_100005671 Ga0068863_1000056712 220
109 3300005841 Ga0068863_100822522 Ga0068863_1008225222 220
110 3300005842 Ga0068858_100017445 Ga0068858_1000174455 220
111 3300005842 Ga0068858_100105923 Ga0068858_1001059234 220
112 3300005843 Ga0068860_100000099 Ga0068860_10000009954 220
113 3300005843 Ga0068860_100104257 Ga0068860_1001042573 220
114 3300005843 Ga0068860_100126558 Ga0068860_1001265582 220
115 3300005844 Ga0068862_100000086 Ga0068862_10000008654 220
116 3300005844 Ga0068862_100015564 Ga0068862_1000155646 220
117 3300005844 Ga0068862_100381718 Ga0068862_1003817182 220
118 3300005937 Ga0081455_10019845 Ga0081455_100198456 220
119 3300006038 Ga0075365_10040337 Ga0075365_100403374 220
120 3300006038 Ga0075365_10043712 Ga0075365_100437122 220
121 3300006038 Ga0075365_10110800 Ga0075365_101108002 220
122 3300006042 Ga0075368_10088826 Ga0075368_100888262 220
123 3300006048 Ga0075363_100005604 Ga0075363_1000056042 220
124 3300006048 Ga0075363_100011207 Ga0075363_1000112072 220
125 3300006048 Ga0075363_100011781 Ga0075363_1000117815 220
126 3300006048 Ga0075363_100018588 Ga0075363_1000185882 220
127 3300006048 Ga0075363_100027946 Ga0075363_1000279464 220
128 3300006048 Ga0075363_100111288 Ga0075363_1001112882 220
129 3300006051 Ga0075364_10001316 Ga0075364_100013164 220
130 3300006051 Ga0075364_10005926 Ga0075364_100059264 220
131 3300006051 Ga0075364_10019759 Ga0075364_100197594 220
132 3300006051 Ga0075364_10028678 Ga0075364_100286783 220
133 3300006051 Ga0075364_10212769 Ga0075364_102127692 220
134 3300006163 Ga0070715_10128011 Ga0070715_101280112 220
135 3300006173 Ga0070716_100010650 Ga0070716_1000106504 220
136 3300006173 Ga0070716_100141516 Ga0070716_1001415162 220
137 3300006177 Ga0075362_10111175 Ga0075362_101111752 220
138 3300006178 Ga0075367_10024689 Ga0075367_100246892 220
139 3300006178 Ga0075367_10031003 Ga0075367_100310034 220
140 3300006186 Ga0075369_10006736 Ga0075369_100067363 220
141 3300006186 Ga0075369_10013662 Ga0075369_100136622 220
142 3300006186 Ga0075369_10155246 Ga0075369_101552462 220
143 3300006237 Ga0097621_100571153 Ga0097621_1005711532 220
144 3300006237 Ga0097621_100890293 Ga0097621_1008902931 220
145 3300006353 Ga0075370_10012251 Ga0075370_100122514 220
146 3300006353 Ga0075370_10014423 Ga0075370_100144232 220
147 3300006353 Ga0075370_10094810 Ga0075370_100948103 220
148 3300006844 Ga0075428_100004646 Ga0075428_10000464613 220
149 3300006846 Ga0075430_100305521 Ga0075430_1003055212 220
150 3300006847 Ga0075431_100067323 Ga0075431_1000673232 220
151 3300006881 Ga0068865_100026719 Ga0068865_1000267196 220
152 3300006881 Ga0068865_100268582 Ga0068865_1002685822 220
153 3300006931 Ga0097620_100003525 Ga0097620_1000035256 220
154 3300006931 Ga0097620_100007646 Ga0097620_1000076466 220
155 3300006931 Ga0097620_100135363 Ga0097620_1001353632 220
156 3300006931 Ga0097620_100715736 Ga0097620_1007157362 220
157 3300007788 Ga0099795_10013890 Ga0099795_100138902 220
158 3300009092 Ga0105250_10009943 Ga0105250_100099433 220
159 3300009094 Ga0111539_10643054 Ga0111539_106430542 220
160 3300009098 Ga0105245_10013909 Ga0105245_100139093 220
161 3300009098 Ga0105245_10039068 Ga0105245_100390684 220
162 3300009098 Ga0105245_10092421 Ga0105245_100924213 220
163 3300009098 Ga0105245_10909133 Ga0105245_109091332 220
164 3300009101 Ga0105247_10000051 Ga0105247_1000005152 220
165 3300009101 Ga0105247_10002033 Ga0105247_100020338 220
166 3300009101 Ga0105247_10239659 Ga0105247_102396591 220
167 3300009147 Ga0114129_10038950 Ga0114129_100389507 220
168 3300009148 Ga0105243_10004906 Ga0105243_1000490610 220
169 3300009148 Ga0105243_10031725 Ga0105243_100317252 220
170 3300009174 Ga0105241_10237635 Ga0105241_102376351 220
171 3300009176 Ga0105242_10004844 Ga0105242_100048449 220
172 3300009176 Ga0105242_10081882 Ga0105242_100818823 220
173 3300009177 Ga0105248_10000281 Ga0105248_1000028125 220
174 3300009177 Ga0105248_10012267 Ga0105248_100122679 220
175 3300009177 Ga0105248_10064198 Ga0105248_100641984 220
176 3300009545 Ga0105237_10006641 Ga0105237_1000664110 220
177 3300009545 Ga0105237_10042955 Ga0105237_100429556 220
178 3300009545 Ga0105237_10626982 Ga0105237_106269822 220
179 3300009551 Ga0105238_10071986 Ga0105238_100719863 220
180 3300009551 Ga0105238_10548710 Ga0105238_105487102 220
181 3300009553 Ga0105249_10000020 Ga0105249_1000002085 220
182 3300009553 Ga0105249_10003714 Ga0105249_1000371410 220
183 3300009553 Ga0105249_10110702 Ga0105249_101107022 220
184 3300010375 Ga0105239_10012351 Ga0105239_100123519 220
185 3300010375 Ga0105239_10042126 Ga0105239_100421265 220
186 3300010375 Ga0105239_10079607 Ga0105239_100796073 220
187 3300011119 Ga0105246_10601833 Ga0105246_106018331 220
188 3300013296 Ga0157374_10035687 Ga0157374_100356875 220
189 3300013296 Ga0157374_10702745 Ga0157374_107027452 220
190 3300013297 Ga0157378_10004748 Ga0157378_100047488 220
191 3300013297 Ga0157378_10149774 Ga0157378_101497742 220
192 3300013306 Ga0163162_10009938 Ga0163162_100099386 220
193 3300013306 Ga0163162_10611665 Ga0163162_106116652 220
194 3300013307 Ga0157372_10005118 Ga0157372_100051189 220
195 3300013307 Ga0157372_10378192 Ga0157372_103781923 220
196 3300013308 Ga0157375_10008395 Ga0157375_100083955 220
197 3300013308 Ga0157375_10378368 Ga0157375_103783682 220
198 3300013308 Ga0157375_10494603 Ga0157375_104946032 220
199 3300013308 Ga0157375_10801365 Ga0157375_108013652 220
200 3300014325 Ga0163163_10009624 Ga0163163_100096246 220
201 3300014325 Ga0163163_10014582 Ga0163163_100145828 220
202 3300014326 Ga0157380_10006508 Ga0157380_1000650811 220
203 3300014497 Ga0182008_10184155 Ga0182008_101841552 220
204 3300014745 Ga0157377_10055109 Ga0157377_100551093 220
205 3300014745 Ga0157377_10376452 Ga0157377_103764522 220
206 3300014968 Ga0157379_10008800 Ga0157379_100088006 220
207 3300014968 Ga0157379_10181415 Ga0157379_101814152 220
208 3300017792 Ga0163161_10048455 Ga0163161_100484554 220
209 3300017792 Ga0163161_10207593 Ga0163161_102075932 220
210 3300021384 Ga0213876_10034214 Ga0213876_100342142 220
211 3300021388 Ga0213875_10033385 Ga0213875_100333854 220
212 3300025273 Ga0209673_1005791 Ga0209673_10057913 220
213 3300025303 Ga0209051_1000108 Ga0209051_100010853 220
214 3300025303 Ga0209051_1000337 Ga0209051_100033756 220
215 3300025303 Ga0209051_1001005 Ga0209051_100100512 220
216 3300025711 Ga0207696_1018610 Ga0207696_10186102 220
217 3300025898 Ga0207692_10105812 Ga0207692_101058122 220
218 3300025899 Ga0207642_10000267 Ga0207642_100002679 220
219 3300025899 Ga0207642_10149034 Ga0207642_101490342 220
220 3300025900 Ga0207710_10000010 Ga0207710_10000010215 220
221 3300025900 Ga0207710_10032856 Ga0207710_100328563 220
222 3300025901 Ga0207688_10008080 Ga0207688_100080805 220
223 3300025901 Ga0207688_10019117 Ga0207688_100191173 220
224 3300025904 Ga0207647_10028903 Ga0207647_100289034 220
225 3300025905 Ga0207685_10077724 Ga0207685_100777242 220
226 3300025906 Ga0207699_10137763 Ga0207699_101377631 220
227 3300025907 Ga0207645_10073119 Ga0207645_100731192 220
228 3300025914 Ga0207671_10087402 Ga0207671_100874023 220
229 3300025914 Ga0207671_10156722 Ga0207671_101567222 220
230 3300025915 Ga0207693_10000430 Ga0207693_1000043040 220
231 3300025915 Ga0207693_10006063 Ga0207693_100060633 220
232 3300025916 Ga0207663_10006540 Ga0207663_100065402 220
233 3300025919 Ga0207657_10025944 Ga0207657_100259444 220
234 3300025919 Ga0207657_10326445 Ga0207657_103264451 220
235 3300025921 Ga0207652_10342346 Ga0207652_103423462 220
236 3300025923 Ga0207681_10002745 Ga0207681_100027453 220
237 3300025923 Ga0207681_10490089 Ga0207681_104900891 220
238 3300025924 Ga0207694_10291796 Ga0207694_102917962 220
239 3300025924 Ga0207694_10490804 Ga0207694_104908042 220
240 3300025927 Ga0207687_10001991 Ga0207687_100019915 220
241 3300025927 Ga0207687_10289358 Ga0207687_102893582 220
242 3300025928 Ga0207700_10283271 Ga0207700_102832712 220
243 3300025929 Ga0207664_10164583 Ga0207664_101645832 220
244 3300025931 Ga0207644_10005098 Ga0207644_100050984 220
245 3300025931 Ga0207644_10129202 Ga0207644_101292022 220
246 3300025932 Ga0207690_10007060 Ga0207690_100070602 220
247 3300025933 Ga0207706_10215748 Ga0207706_102157481 220
248 3300025936 Ga0207670_10013622 Ga0207670_100136221 220
249 3300025937 Ga0207669_10003498 Ga0207669_100034989 220
250 3300025937 Ga0207669_10277900 Ga0207669_102779002 220
251 3300025938 Ga0207704_10000321 Ga0207704_1000032112 220
252 3300025938 Ga0207704_10072162 Ga0207704_100721622 220
253 3300025939 Ga0207665_10015862 Ga0207665_100158622 220
254 3300025939 Ga0207665_10018381 Ga0207665_100183811 220
255 3300025940 Ga0207691_10069377 Ga0207691_100693773 220
256 3300025941 Ga0207711_10000364 Ga0207711_1000036425 220
257 3300025941 Ga0207711_10143131 Ga0207711_101431314 220
258 3300025942 Ga0207689_10023094 Ga0207689_100230943 220
259 3300025942 Ga0207689_10047080 Ga0207689_100470803 220
260 3300025944 Ga0207661_10040444 Ga0207661_100404443 220
261 3300025949 Ga0207667_10197156 Ga0207667_101971562 220
262 3300025949 Ga0207667_10276943 Ga0207667_102769432 220
263 3300025960 Ga0207651_10126327 Ga0207651_101263272 220
264 3300025961 Ga0207712_10000010 Ga0207712_10000010179 220
265 3300025961 Ga0207712_10029548 Ga0207712_100295482 220
266 3300025972 Ga0207668_10001252 Ga0207668_1000125210 220
267 3300025972 Ga0207668_10017900 Ga0207668_100179003 220
268 3300025972 Ga0207668_10559622 Ga0207668_105596221 220
269 3300025981 Ga0207640_10024703 Ga0207640_100247032 220
270 3300025986 Ga0207658_10001232 Ga0207658_1000123210 220
271 3300025986 Ga0207658_10009397 Ga0207658_100093978 220
272 3300025986 Ga0207658_10086462 Ga0207658_100864622 220
273 3300025986 Ga0207658_10242190 Ga0207658_102421902 220
274 3300025986 Ga0207658_10538919 Ga0207658_105389192 220
275 3300025986 Ga0207658_10791979 Ga0207658_107919792 220
276 3300026035 Ga0207703_10003382 Ga0207703_100033823 220
277 3300026035 Ga0207703_10405499 Ga0207703_104054992 220
278 3300026041 Ga0207639_10005886 Ga0207639_100058864 220
279 3300026067 Ga0207678_10010154 Ga0207678_100101543 220
280 3300026067 Ga0207678_10010796 Ga0207678_100107963 220
281 3300026067 Ga0207678_10018387 Ga0207678_100183872 220
282 3300026067 Ga0207678_10233960 Ga0207678_102339602 220
283 3300026075 Ga0207708_10006037 Ga0207708_100060378 220
284 3300026088 Ga0207641_10000445 Ga0207641_100004455 220
285 3300026088 Ga0207641_10008412 Ga0207641_100084128 220
286 3300026088 Ga0207641_10075567 Ga0207641_100755672 220
287 3300026088 Ga0207641_10320828 Ga0207641_103208282 220
288 3300026089 Ga0207648_10001738 Ga0207648_1000173817 220
289 3300026089 Ga0207648_10008737 Ga0207648_100087376 220
290 3300026095 Ga0207676_10260385 Ga0207676_102603852 220
291 3300026095 Ga0207676_10895178 Ga0207676_108951781 220
292 3300026118 Ga0207675_100060197 Ga0207675_1000601973 220
293 3300026118 Ga0207675_100065641 Ga0207675_1000656413 220
294 3300026118 Ga0207675_100109085 Ga0207675_1001090852 220
295 3300026118 Ga0207675_100111671 Ga0207675_1001116712 220
296 3300026121 Ga0207683_10014544 Ga0207683_100145443 220
297 3300026121 Ga0207683_10039841 Ga0207683_100398413 220
298 3300026121 Ga0207683_10276020 Ga0207683_102760203 220
299 3300026121 Ga0207683_10476896 Ga0207683_104768962 220
300 3300026142 Ga0207698_10179214 Ga0207698_101792142 220
301 3300027866 Ga0209813_10007615 Ga0209813_100076152 220
302 3300028379 Ga0268266_10002054 Ga0268266_100020549 220
303 3300028379 Ga0268266_10049634 Ga0268266_100496344 220
304 3300028379 Ga0268266_10081470 Ga0268266_100814702 220
305 3300028379 Ga0268266_10526272 Ga0268266_105262722 220
306 3300028380 Ga0268265_10000014 Ga0268265_10000014263 220
307 3300028381 Ga0268264_10000137 Ga0268264_10000137111 220
308 3300028381 Ga0268264_10001869 Ga0268264_100018692 220
309 3300031251 Ga0265327_10000662 Ga0265327_100006625 220
310 3300031731 Ga0307405_10569862 Ga0307405_105698622 220
311 3300031824 Ga0307413_10058299 Ga0307413_100582992 220
312 3300031824 Ga0307413_10309337 Ga0307413_103093372 220
313 3300031852 Ga0307410_10582332 Ga0307410_105823322 220
314 3300031901 Ga0307406_10457194 Ga0307406_104571941 220
315 3300031911 Ga0307412_10022222 Ga0307412_100222225 220
316 3300031995 Ga0307409_100241070 Ga0307409_1002410701 220
317 3300031995 Ga0307409_100643467 Ga0307409_1006434672 220
318 3300032002 Ga0307416_100071205 Ga0307416_1000712053 220
319 3300032005 Ga0307411_10192228 Ga0307411_101922282 220
320 3300032126 Ga0307415_100010496 Ga0307415_1000104965 220
321 3300034819 Ga0373958_0062105 Ga0373958_0062105_56_721 220
322 3300034820 Ga0373959_0074166 Ga0373959_0074166_18_680 220
323 3300035115 Ga0373941_0029703 Ga0373941_0029703_362_1024 220
324 3300035121 Ga0373960_0016773 Ga0373960_0016773_1007_1672 220
325 3300035691 Ga0373931_0033597 Ga0373931_0033597_726_1391 220
326 3300035691 Ga0373931_0269128 Ga0373931_0269128_193_861 220
327 3300035724 Ga0373933_0394717 Ga0373933_0394717_141_803 220
328 3300035725 Ga0373947_0353499 Ga0373947_0353499_67_729 220
329 3300037068 Ga0373925_0547925 Ga0373925_0547925_193_855 220
330 3300037853 Ga0436364_0204668 Ga0436364_0204668_8409_9071 220
331 3300039450 Ga0436363_0375672 Ga0436363_0375672_767_1429 220
332 3300039450 Ga0436363_1689608 Ga0436363_1689608_159_839 220
333 3300041411 Ga0439466_0003909 Ga0439466_0003909_4745_5410 220
334 3300041411 Ga0439466_0008306 Ga0439466_0008306_1022_1687 220
335 3300041411 Ga0439466_0042416 Ga0439466_0042416_227_889 220
336 3300041413 Ga0439465_0007839 Ga0439465_0007839_1801_2466 220
337 3300041456 Ga0451795_1658859 Ga0451795_1658859_1622_2284 220
338 3300041997 Ga0439431_0000466 Ga0439431_0000466_4798_5463 220
339 3300042002 Ga0439442_020862 Ga0439442_020862_167_832 220
340 3300042004 Ga0439445_0000791 Ga0439445_0000791_5009_5674 220
341 3300042004 Ga0439445_0044251 Ga0439445_0044251_198_863 220
342 3300042004 Ga0439445_0044749 Ga0439445_0044749_352_1014 220
343 3300042005 Ga0439448_0112850 Ga0439448_0112850_230_892 220
344 3300042435 Ga0439434_0001376 Ga0439434_0001376_5778_6443 220
345 3300042435 Ga0439434_0015932 Ga0439434_0015932_844_1509 220
346 3300042436 Ga0439435_0131608 Ga0439435_0131608_45_707 220
347 3300044656 Ga0466969_0030153 Ga0466969_0030153_500_1162 220
348 3300044658 Ga0466972_0028426 Ga0466972_0028426_2039_2704 220
349 3300044683 Ga0466965_0040561 Ga0466965_0040561_932_1594 220
350 3300044683 Ga0466965_0408994 Ga0466965_0408994_68_733 220
351 3300044684 Ga0466966_0255878 Ga0466966_0255878_312_974 220
352 3300044693 Ga0466961_0055574 Ga0466961_0055574_170_832 220
353 3300044706 Ga0466964_0044986 Ga0466964_0044986_1032_1694 220
354 3300044706 Ga0466964_0233728 Ga0466964_0233728_189_854 220
355 3300044719 Ga0466971_0003465 Ga0466971_0003465_3627_4289 220
356 3300044765 Ga0466970_0007705 Ga0466970_0007705_597_1271 220
357 3300044765 Ga0466970_0040912 Ga0466970_0040912_188_853 220
358 3300044842 Ga0466957_0025888 Ga0466957_0025888_184_846 220
359 3300045049 Ga0466959_0037597 Ga0466959_0037597_314_976 220
360 3300045976 Ga0466967_0029824 Ga0466967_0029824_1392_2054 220
361 3300045976 Ga0466967_0053339 Ga0466967_0053339_2507_3178 220
362 3300045976 Ga0466967_0074824 Ga0466967_0074824_1588_2250 220
363 3300045976 Ga0466967_0079011 Ga0466967_0079011_533_1195 220
364 3300045976 Ga0466967_0194987 Ga0466967_0194987_364_1026 220
365 3300045976 Ga0466967_0806831 Ga0466967_0806831_32_694 220
366 3300046455 Ga0495603_0093918 Ga0495603_0093918_655_1317 220
367 3300046459 Ga0495629_0017856 Ga0495629_0017856_2900_3562 220
368 3300046460 Ga0495638_0005104 Ga0495638_0005104_8826_9488 220
369 3300046461 Ga0495641_0082069 Ga0495641_0082069_548_1210 220
370 3300046524 Ga0495648_0141956 Ga0495648_0141956_482_1144 220
371 3300046531 Ga0495665_0077349 Ga0495665_0077349_196_858 220
372 3300046533 Ga0495640_0113949 Ga0495640_0113949_633_1295 220
373 3300046533 Ga0495640_0368917 Ga0495640_0368917_199_870 220
374 3300046660 Ga0495625_0159156 Ga0495625_0159156_784_1446 220
375 3300047315 Ga0495581_0006457 Ga0495581_0006457_5477_6139 220
376 3300047320 Ga0495672_0058182 Ga0495672_0058182_660_1322 220
377 3300047472 Ga0495686_0002464 Ga0495686_0002464_11284_11946 220
378 3300047673 Ga0495593_0013334 Ga0495593_0013334_2710_3372 220
379 3300048091 Ga0495626_0030223 Ga0495626_0030223_1159_1821 220
380 3300048903 Ga0496100_0000110 Ga0496100_0000110_22369_23034 220
381 3300048903 Ga0496100_0002409 Ga0496100_0002409_2742_3404 220
382 3300048903 Ga0496100_0007114 Ga0496100_0007114_4633_5295 220
383 3300048903 Ga0496100_0437743 Ga0496100_0437743_65_730 220
384 3300048904 Ga0496101_0000054 Ga0496101_0000054_54681_55346 220
385 3300048904 Ga0496101_0000073 Ga0496101_0000073_85200_85862 220
386 3300048904 Ga0496101_0000790 Ga0496101_0000790_2147_2809 220
387 3300048904 Ga0496101_0015768 Ga0496101_0015768_1981_2646 220
388 3300048904 Ga0496101_0055903 Ga0496101_0055903_1773_2435 220
389 3300048905 Ga0496102_0000006 Ga0496102_0000006_164643_165305 220
390 3300048905 Ga0496102_0000118 Ga0496102_0000118_61589_62251 220
391 3300048905 Ga0496102_0002514 Ga0496102_0002514_12303_12968 220
392 3300048905 Ga0496102_0011206 Ga0496102_0011206_6022_6687 220
393 3300048905 Ga0496102_0095785 Ga0496102_0095785_1968_2630 220
394 3300048905 Ga0496102_0101095 Ga0496102_0101095_1933_2598 220
395 3300048905 Ga0496102_0166971 Ga0496102_0166971_543_1205 220
396 3300048905 Ga0496102_0195758 Ga0496102_0195758_1095_1760 220
397 3300048905 Ga0496102_0499884 Ga0496102_0499884_365_1027 220
398 3300048906 Ga0496103_0000006 Ga0496103_0000006_164441_165103 220
399 3300048906 Ga0496103_0000227 Ga0496103_0000227_4435_5097 220
400 3300048906 Ga0496103_0001393 Ga0496103_0001393_9687_10352 220
401 3300048906 Ga0496103_0006809 Ga0496103_0006809_4257_4922 220
402 3300048906 Ga0496103_0058746 Ga0496103_0058746_1675_2337 220
403 3300048906 Ga0496103_0091577 Ga0496103_0091577_518_1183 220
404 3300048907 Ga0496104_0029417 Ga0496104_0029417_4108_4773 220
405 3300048907 Ga0496104_0038232 Ga0496104_0038232_3035_3697 220
406 3300048907 Ga0496104_0162493 Ga0496104_0162493_577_1239 220
407 3300048907 Ga0496104_0213096 Ga0496104_0213096_214_876 220
408 3300048908 Ga0496105_0031658 Ga0496105_0031658_1005_1667 220
409 3300048908 Ga0496105_0047644 Ga0496105_0047644_194_859 220
410 3300048908 Ga0496105_0309205 Ga0496105_0309205_310_972 220
411 3300048909 Ga0496106_0008927 Ga0496106_0008927_5457_6122 220
412 3300048909 Ga0496106_0015842 Ga0496106_0015842_1647_2309 220
413 3300048909 Ga0496106_0029821 Ga0496106_0029821_362_1024 220
414 3300048909 Ga0496106_0035196 Ga0496106_0035196_100_762 220
415 3300048909 Ga0496106_0041068 Ga0496106_0041068_2200_2862 220
416 3300048909 Ga0496106_0646855 Ga0496106_0646855_90_752 220
417 3300048910 Ga0496107_0000261 Ga0496107_0000261_26447_27112 220
418 3300048910 Ga0496107_0004000 Ga0496107_0004000_28_693 220
419 3300048910 Ga0496107_0024289 Ga0496107_0024289_464_1126 220
420 3300048910 Ga0496107_0085013 Ga0496107_0085013_1569_2231 220
421 3300048911 Ga0496108_0004834 Ga0496108_0004834_3765_4427 220
422 3300048911 Ga0496108_0006027 Ga0496108_0006027_1923_2588 220
423 3300048911 Ga0496108_0022834 Ga0496108_0022834_4449_5114 220
424 3300048911 Ga0496108_0270674 Ga0496108_0270674_542_1204 220
425 3300048912 Ga0496109_0000152 Ga0496109_0000152_43297_43962 220
426 3300048912 Ga0496109_0001995 Ga0496109_0001995_9011_9673 220
427 3300048912 Ga0496109_0014634 Ga0496109_0014634_4020_4682 220
428 3300048913 Ga0496110_0000446 Ga0496110_0000446_23943_24608 220
429 3300048913 Ga0496110_0049486 Ga0496110_0049486_478_1140 220
430 3300048913 Ga0496110_0059784 Ga0496110_0059784_1383_2048 220
431 3300048913 Ga0496110_0105364 Ga0496110_0105364_1173_1835 220
432 3300048913 Ga0496110_0345563 Ga0496110_0345563_131_796 220
433 3300048914 Ga0496111_0018923 Ga0496111_0018923_4083_4748 220
434 3300048914 Ga0496111_0384428 Ga0496111_0384428_36_698 220
435 3300048915 Ga0496112_0013692 Ga0496112_0013692_5248_5910 220
436 3300048915 Ga0496112_0040665 Ga0496112_0040665_371_1036 220
437 3300048915 Ga0496112_0075199 Ga0496112_0075199_1752_2417 220
438 3300048915 Ga0496112_0179114 Ga0496112_0179114_954_1616 220
439 3300048916 Ga0496113_0012706 Ga0496113_0012706_319_984 220
440 3300048916 Ga0496113_0209060 Ga0496113_0209060_491_1153 220
441 3300048917 Ga0496114_0000047 Ga0496114_0000047_62713_63378 220
442 3300048917 Ga0496114_0000920 Ga0496114_0000920_708_1373 220
443 3300048917 Ga0496114_0001652 Ga0496114_0001652_1717_2379 220
444 3300048917 Ga0496114_0318741 Ga0496114_0318741_112_774 220
445 3300048917 Ga0496114_0640023 Ga0496114_0640023_214_876 220
446 3300048918 Ga0496115_0012234 Ga0496115_0012234_5314_5979 220
447 3300048918 Ga0496115_0017964 Ga0496115_0017964_4117_4782 220
448 3300048918 Ga0496115_0020390 Ga0496115_0020390_4124_4786 220
449 3300048918 Ga0496115_0389089 Ga0496115_0389089_97_759 220
450 3300048919 Ga0496116_0000025 Ga0496116_0000025_305437_306099 220
451 3300048919 Ga0496116_0000968 Ga0496116_0000968_6887_7552 220
452 3300048919 Ga0496116_0003154 Ga0496116_0003154_13411_14073 220
453 3300048920 Ga0496117_0000006 Ga0496117_0000006_305437_306099 220
454 3300048920 Ga0496117_0001082 Ga0496117_0001082_33895_34557 220
455 3300048920 Ga0496117_0025351 Ga0496117_0025351_2477_3142 220
456 3300048921 Ga0496118_0000004 Ga0496118_0000004_305437_306099 220
457 3300048921 Ga0496118_0001424 Ga0496118_0001424_22722_23384 220
458 3300048921 Ga0496118_0007848 Ga0496118_0007848_8626_9291 220
459 3300048921 Ga0496118_0192602 Ga0496118_0192602_225_890 220
460 3300048922 Ga0496119_0000041 Ga0496119_0000041_164524_165186 220
461 3300048922 Ga0496119_0001956 Ga0496119_0001956_3532_4197 220
462 3300048922 Ga0496119_0013686 Ga0496119_0013686_2278_2940 220
463 3300048923 Ga0496120_0000027 Ga0496120_0000027_35819_36481 220
464 3300048923 Ga0496120_0018829 Ga0496120_0018829_1269_1931 220
465 3300048924 Ga0496121_0000004 Ga0496121_0000004_108725_109390 220
466 3300048924 Ga0496121_0000171 Ga0496121_0000171_138392_139054 220
467 3300048925 Ga0496122_0000313 Ga0496122_0000313_105042_105707 220
468 3300048926 Ga0496123_0012714 Ga0496123_0012714_5912_6577 220
469 3300048927 Ga0496124_0000117 Ga0496124_0000117_108725_109390 220
470 3300048927 Ga0496124_0078547 Ga0496124_0078547_571_1233 220
471 3300048928 Ga0496125_0000003 Ga0496125_0000003_1080378_1081043 220
472 3300048929 Ga0496126_0000001 Ga0496126_0000001_108725_109390 220
473 3300048929 Ga0496126_0004545 Ga0496126_0004545_2216_2878 220
474 3300048929 Ga0496126_0005051 Ga0496126_0005051_437_1099 220
475 3300048929 Ga0496126_0068271 Ga0496126_0068271_2288_2950 220
476 3300049569 Ga0501032_0000802 Ga0501032_0000802_20294_20959 220
477 3300049571 Ga0501034_0018563 Ga0501034_0018563_2663_3328 220
478 3300049572 Ga0501036_0114823 Ga0501036_0114823_632_1297 220
479 3300049573 Ga0501037_0004004 Ga0501037_0004004_897_1562 220
480 3300049574 Ga0501038_0002117 Ga0501038_0002117_9120_9785 220
481 3300049575 Ga0501039_0002618 Ga0501039_0002618_9302_9967 220
482 3300049579 Ga0501043_0002150 Ga0501043_0002150_11434_12099 220
483 3300049586 Ga0501070_0003703 Ga0501070_0003703_11631_12296 220
484 3300049586 Ga0501070_0038311 Ga0501070_0038311_2581_3243 220
485 3300049589 Ga0501073_0090176 Ga0501073_0090176_174_839 220
486 3300049742 Ga0501080_0232394 Ga0501080_0232394_253_915 220
487 3300049742 Ga0501080_0821289 Ga0501080_0821289_65_727 220
488 3300049823 Ga0501044_0025823 Ga0501044_0025823_1884_2549 220
489 3300050489 nmdc:mga03683_84897_c1 nmdc:mga03683_84897_c1_692_1357 220
490 3300050490 nmdc:mga03n38_20343_c1 nmdc:mga03n38_20343_c1_171_833 220
491 3300050490 nmdc:mga03n38_229271_c1 nmdc:mga03n38_229271_c1_29_691 220
492 3300050490 nmdc:mga03n38_301215_c1 nmdc:mga03n38_301215_c1_81_743 220
493 3300050490 nmdc:mga03n38_44155_c1 nmdc:mga03n38_44155_c1_1100_1762 220
494 3300050490 nmdc:mga03n38_6741_c1 nmdc:mga03n38_6741_c1_1259_1921 220
495 3300050490 nmdc:mga03n38_8096_c1 nmdc:mga03n38_8096_c1_2658_3320 220
496 3300050490 nmdc:mga03n38_8584_c1 nmdc:mga03n38_8584_c1_2934_3599 220
497 3300050491 nmdc:mga00v17_11911_c2 nmdc:mga00v17_11911_c2_1463_2125 220
498 3300050491 nmdc:mga00v17_34112_c1 nmdc:mga00v17_34112_c1_680_1342 220
499 3300050491 nmdc:mga00v17_41508_c1 nmdc:mga00v17_41508_c1_2092_2754 220
500 3300050491 nmdc:mga00v17_47663_c1 nmdc:mga00v17_47663_c1_1083_1748 220
501 3300050491 nmdc:mga00v17_954_c1 nmdc:mga00v17_954_c1_2933_3595 220
502 3300050492 nmdc:mga0yw44_11339_c1 nmdc:mga0yw44_11339_c1_2415_3077 220
503 3300050492 nmdc:mga0yw44_9480_c2 nmdc:mga0yw44_9480_c2_1387_2049 220
504 3300050494 nmdc:mga06z11_13199_c1 nmdc:mga06z11_13199_c1_2070_2732 220
505 3300050494 nmdc:mga06z11_6731_c1 nmdc:mga06z11_6731_c1_3787_4449 220
506 3300050495 nmdc:mga04h51_8549_c1 nmdc:mga04h51_8549_c1_182_844 220
507 3300050496 nmdc:mga07m45_213722_c1 nmdc:mga07m45_213722_c1_206_871 220
508 3300050496 nmdc:mga07m45_3066_c1 nmdc:mga07m45_3066_c1_2204_2866 220
509 3300050496 nmdc:mga07m45_71818_c1 nmdc:mga07m45_71818_c1_415_1077 220
510 3300050507 nmdc:mga05p37_11243_c1 nmdc:mga05p37_11243_c1_4541_5203 220
511 3300050509 nmdc:mga0qj67_13317_c1 nmdc:mga0qj67_13317_c1_1715_2377 220
512 3300050509 nmdc:mga0qj67_249215_c1 nmdc:mga0qj67_249215_c1_331_993 220
513 3300050509 nmdc:mga0qj67_653072_c1 nmdc:mga0qj67_653072_c1_160_822 220
514 3300050510 nmdc:mga06r32_48221_c1 nmdc:mga06r32_48221_c1_1601_2263 220
515 3300050516 nmdc:mga0sz30_119319_c1 nmdc:mga0sz30_119319_c1_165_827 220
516 3300050516 nmdc:mga0sz30_1564_c1 nmdc:mga0sz30_1564_c1_6651_7316 220
517 3300050516 nmdc:mga0sz30_2532_c1 nmdc:mga0sz30_2532_c1_2719_3381 220
518 3300050516 nmdc:mga0sz30_49661_c1 nmdc:mga0sz30_49661_c1_891_1553 220
519 3300050516 nmdc:mga0sz30_96022_c1 nmdc:mga0sz30_96022_c1_105_767 220
520 3300053085 Ga0495619_0235701 Ga0495619_0235701_305_967 220
521 3300053104 Ga0500556_0001549 Ga0500556_0001549_4201_4863 220
522 3300053104 Ga0500556_0041723 Ga0500556_0041723_656_1318 220
523 3300053108 Ga0500562_006808 Ga0500562_006808_188_850 220
524 3300053139 Ga0500568_0034795 Ga0500568_0034795_1232_1894 220
525 3300053142 Ga0500577_0115249 Ga0500577_0115249_407_1069 220
526 3300053153 Ga0500616_0031099 Ga0500616_0031099_1685_2347 220
527 3300053153 Ga0500616_0037529 Ga0500616_0037529_1859_2521 220
528 3300061719 Ga0466962_0034749 Ga0466962_0034749_460_1122 220
529 3300061719 Ga0466962_0207148 Ga0466962_0207148_275_937 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05719

GPP34

Golgi phosphoprotein 3 (GPP34)

4

206

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zih-assembly1.cif.gz_C crystal structure of yeast vps74 0.7463 3 219
2zih-assembly1.cif.gz_C crystal structure of yeast vps74 0.7348 3 219
3kn1-assembly1.cif.gz_A crystal structure of golgi phosphoprotein 3 n-term truncation variant 0.708 3 220
3kn1-assembly1.cif.gz_A crystal structure of golgi phosphoprotein 3 n-term truncation variant 0.6996 3 220
4tu3-assembly1.cif.gz_A crystal structure of yeast sac1/vps74 complex 0.6941 3 218
ID Description Score Start End Superfamily
af_E7FGM1_47_294_1.10.3630.10 Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like 0.74 3 219 1.10.3630.10
af_E7FGM1_47_294_1.10.3630.10 Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like 0.7285 3 219 1.10.3630.10
4tu3A00 Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like 0.6941 3 218 1.10.3630.10
3kn1A00 Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like 0.6888 5 220 1.10.3630.10
4tu3A00 Mainly Alpha;Orthogonal Bundle;yeast vps74-n-term truncation variant fold;yeast vps74-n-term truncation variant domain like 0.6801 3 218 1.10.3630.10
ID Description Score Start End GO Terms
AF-A0A1A0WR48-F1-model_v4 deleted 0.9891 1 219
AF-A0A1T3WNY8-F1-model_v4 GPP34 family phosphoprotein 0.9833 36 219 GO:0005737
GO:0012505
GO:0016020
GO:0043231
GO:0070273
AF-A0A1A0WR48-F1-model_v4 deleted 0.9802 1 219
AF-A0A2S8BQ81-F1-model_v4 Uncharacterized protein 0.9613 143 218
AF-A0A1T3WNY8-F1-model_v4 GPP34 family phosphoprotein 0.9576 36 219 GO:0005737
GO:0012505
GO:0016020
GO:0043231
GO:0070273

Feature Viewer

pLDDT pTM Quality
93.55 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map