metagRoot

F459769

General Info

Members	Datasets	Scaffolds	Average Seq Length
529	252	529	332

Family's Representative Sequence

Representative Sequence	3300005356\|Ga0070674_100013738\|Ga0070674_1000137382
Length	374
Sequence	VWPRQRAHYQLNASVESLRRMKTAKIRMATSAAVVPLNGFDQPMLGAEFLLSMVESRWFSRNGNGSNMDSGLKAQQELEQIERQIAHLESAVGPNRVDGLRREVSSHLSAWGKTELARHPQRPYMLDYVDRIFTDWSEVHGDRGFADDPAIVCGIARFHGQEVVIVGQQKARDTKQKVYRNFGMPNPEGYRKALRVMKFAEKFSRPIFTFVDTPGAYPGLGAEERGQAEAIARNLREMARLRVPIVSTITGEGGSGGALAIAVADRVLMLENSVYSVISPEGCASIMWRDATKKDIAAQAMKITAPDLKGMGLVDGIVPEPAGGAHTNHEEAAALLDAVLTKELATLTAVPVSELIASRYNKFRNMAQFYVAEG

Samples

	Sample ID	Description	Type	Environment
1	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
2	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
3	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
4	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
12	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
13	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
14	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
15	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
16	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
17	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
18	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
19	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
20	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
21	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
26	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
27	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
28	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
29	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
30	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
31	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
32	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
33	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
49	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
50	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
51	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
52	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
53	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
54	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
55	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
56	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
57	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
58	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
59	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
60	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
61	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
62	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
63	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
64	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
65	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
68	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
69	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
70	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
73	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
74	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
76	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
78	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
79	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
81	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
82	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
83	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
84	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
85	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
86	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
87	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
88	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
89	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
90	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
91	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
92	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
93	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
94	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
95	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
96	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
97	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
98	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
99	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
100	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
101	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
102	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
103	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
104	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
105	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
106	3300022734	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3	Metagenome	Rhizosphere
107	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
108	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
109	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
163	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
167	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
168	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
169	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
170	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
171	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
172	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
173	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
174	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
175	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
176	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
177	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
178	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
179	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
180	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
181	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
182	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
183	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
184	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
185	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
186	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
187	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
188	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
189	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
190	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
191	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
192	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
193	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
194	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
195	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
196	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
197	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
198	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
199	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
200	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
201	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
202	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
203	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
204	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
205	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
206	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
207	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
208	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
209	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
210	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
211	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
212	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
213	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
214	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
215	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
216	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
217	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
218	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
219	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
220	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
221	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
222	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
223	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
224	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
225	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
226	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
227	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
228	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
230	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
231	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
232	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
234	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
236	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
237	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
239	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
240	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
241	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
243	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
244	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
245	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
246	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
247	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
248	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
249	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
250	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
251	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
252	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.19
Nodule	0
Rhizoplane	6.24
Rhizosphere	93.19
Stem	0
Stem Tuber	0
Unclassified	0.38

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJNas_1000739	3300000546	Bacteria	5456
2	JGI24752J21851_1000397	3300001976	Bacteria	5973
3	JGI24034J26672_10000722	3300002239	Bacteria	4254
4	JGI24751J29686_10001409	3300002459	Bacteria	5039
5	Ga0070658_10377172	3300005327	Bacteria	1216
6	Ga0070676_10002161	3300005328	Bacteria	10022
7	Ga0070683_100001090	3300005329	Bacteria	20440
8	Ga0070690_100150096	3300005330	Bacteria	1589
9	Ga0070670_100013509	3300005331	Bacteria	6996
10	Ga0068869_100026694	3300005334	Bacteria	4021
11	Ga0070666_10013981	3300005335	Bacteria	5102
12	Ga0070680_100241087	3300005336	Bacteria	1528
13	Ga0070682_100012565	3300005337	Bacteria	4857
14	Ga0068868_100002408	3300005338	Bacteria	12945
15	Ga0068868_100014287	3300005338	Bacteria	5849
16	Ga0070660_100004484	3300005339	Bacteria	9648
17	Ga0070660_100170665	3300005339	Bacteria	1757
18	Ga0070689_100068874	3300005340	Bacteria	2760
19	Ga0070689_100115668	3300005340	Bacteria	2138
20	Ga0070691_10109037	3300005341	Bacteria	1383
21	Ga0070661_100009518	3300005344	Bacteria	6732
22	Ga0070668_100002257	3300005347	Bacteria	14193
23	Ga0070669_100005768	3300005353	Bacteria	8924
24	Ga0070674_100013738	3300005356	Bacteria	5012
25	Ga0070673_100026874	3300005364	Bacteria	4257
26	Ga0070673_100040920	3300005364	Bacteria	3559
27	Ga0070688_100000762	3300005365	Bacteria	15903
28	Ga0070659_100011876	3300005366	Bacteria	6447
29	Ga0070667_100419937	3300005367	Bacteria	1219
30	Ga0070709_10014604	3300005434	Bacteria	4445
31	Ga0070709_10124211	3300005434	Bacteria	1754
32	Ga0070709_10168954	3300005434	Bacteria	1527
33	Ga0070714_100002783	3300005435	Bacteria	12896
34	Ga0070714_100116904	3300005435	Bacteria	2368
35	Ga0070714_100150228	3300005435	Bacteria	2098
36	Ga0070713_100000037	3300005436	Bacteria	85487
37	Ga0070713_100000200	3300005436	Bacteria	40030
38	Ga0070713_100012592	3300005436	Bacteria	6212
39	Ga0070713_100014354	3300005436	Bacteria	5880
40	Ga0070713_100014429	3300005436	Bacteria	5869
41	Ga0070713_100088237	3300005436	Bacteria	2661
42	Ga0070713_100227316	3300005436	Bacteria	1695
43	Ga0070710_10009439	3300005437	Bacteria	4772
44	Ga0070710_10027504	3300005437	Bacteria	3034
45	Ga0070710_10102915	3300005437	Bacteria	1704
46	Ga0070710_10103278	3300005437	Unclassified	1701
47	Ga0070710_10150903	3300005437	Bacteria	1433
48	Ga0070701_10046496	3300005438	Bacteria	2231
49	Ga0070711_100000165	3300005439	Bacteria	35832
50	Ga0070711_100002411	3300005439	Bacteria	10663
51	Ga0070711_100010689	3300005439	Bacteria	5687
52	Ga0070711_100029249	3300005439	Bacteria	3634
53	Ga0070711_100099611	3300005439	Bacteria	2112
54	Ga0070711_100132792	3300005439	Bacteria	1856
55	Ga0070708_100004590	3300005445	Bacteria	10872
56	Ga0070708_100005233	3300005445	Bacteria	10272
57	Ga0070708_100006276	3300005445	Bacteria	9456
58	Ga0070708_100038693	3300005445	Bacteria	4169
59	Ga0070708_100039373	3300005445	Bacteria	4135
60	Ga0070678_100105353	3300005456	Bacteria	2195
61	Ga0070681_10000321	3300005458	Bacteria	39038
62	Ga0070681_10008952	3300005458	Bacteria	9844
63	Ga0070681_10187211	3300005458	Bacteria	1990
64	Ga0068867_100017346	3300005459	Bacteria	5114
65	Ga0070685_10008359	3300005466	Bacteria	5313
66	Ga0070685_10022478	3300005466	Bacteria	3439
67	Ga0070706_100000677	3300005467	Bacteria	38554
68	Ga0070706_100007573	3300005467	Bacteria	10167
69	Ga0070706_100011789	3300005467	Bacteria	8114
70	Ga0070707_100004527	3300005468	Bacteria	13017
71	Ga0070707_100005909	3300005468	Bacteria	11423
72	Ga0070707_100085382	3300005468	Bacteria	3051
73	Ga0070707_100158213	3300005468	Bacteria	2207
74	Ga0070698_100000505	3300005471	Bacteria	41461
75	Ga0070698_100011968	3300005471	Bacteria	9205
76	Ga0070698_100085094	3300005471	Bacteria	3150
77	Ga0070698_100264887	3300005471	Bacteria	1650
78	Ga0070699_100000976	3300005518	Bacteria	26672
79	Ga0070699_100007792	3300005518	Bacteria	9308
80	Ga0070699_100095051	3300005518	Bacteria	2609
81	Ga0070679_100101676	3300005530	Bacteria	2861
82	Ga0070684_100007273	3300005535	Bacteria	8606
83	Ga0070697_100000024	3300005536	Bacteria	129765
84	Ga0070697_100000087	3300005536	Bacteria	76603
85	Ga0070697_100000337	3300005536	Bacteria	36991
86	Ga0070697_100006642	3300005536	Bacteria	8969
87	Ga0070697_100019401	3300005536	Bacteria	5371
88	Ga0070697_100079385	3300005536	Bacteria	2702
89	Ga0070697_100119712	3300005536	Bacteria	2202
90	Ga0068853_100105553	3300005539	Bacteria	2496
91	Ga0070672_100025030	3300005543	Bacteria	4421
92	Ga0068855_100000952	3300005563	Bacteria	36034
93	Ga0068855_100133445	3300005563	Bacteria	2834
94	Ga0070664_100000278	3300005564	Bacteria	36897
95	Ga0070664_100023307	3300005564	Bacteria	5112
96	Ga0068857_100000303	3300005577	Bacteria	34068
97	Ga0068857_100004147	3300005577	Bacteria	12215
98	Ga0068857_100011811	3300005577	Bacteria	7596
99	Ga0068854_100013686	3300005578	Bacteria	5330
100	Ga0068856_100000243	3300005614	Bacteria	59277
101	Ga0068856_100000621	3300005614	Bacteria	38735
102	Ga0068856_100034994	3300005614	Bacteria	4921
103	Ga0068856_100042515	3300005614	Bacteria	4470
104	Ga0068856_100224354	3300005614	Bacteria	1894
105	Ga0068856_100233967	3300005614	Bacteria	1853
106	Ga0068856_100526495	3300005614	Bacteria	1203
107	Ga0070702_100051227	3300005615	Bacteria	2362
108	Ga0068852_100008746	3300005616	Bacteria	7487
109	Ga0068852_100171697	3300005616	Bacteria	2033
110	Ga0068859_100002710	3300005617	Bacteria	17971
111	Ga0068859_100004225	3300005617	Bacteria	14657
112	Ga0068864_100005328	3300005618	Bacteria	10537
113	Ga0068864_100006886	3300005618	Bacteria	9316
114	Ga0068866_10002747	3300005718	Bacteria	7255
115	Ga0068866_10071676	3300005718	Bacteria	1833
116	Ga0068851_10001168	3300005834	Bacteria	11388
117	Ga0068870_10001568	3300005840	Bacteria	9294
118	Ga0068863_100029872	3300005841	Bacteria	5205
119	Ga0068863_100323491	3300005841	Bacteria	1498
120	Ga0068858_100000367	3300005842	Bacteria	47575
121	Ga0068858_100025960	3300005842	Bacteria	5448
122	Ga0068858_100045591	3300005842	Bacteria	4064
123	Ga0068860_100076961	3300005843	Bacteria	3173
124	Ga0068860_100294184	3300005843	Bacteria	1589
125	Ga0068862_100017803	3300005844	Bacteria	5915
126	Ga0070717_10003574	3300006028	Bacteria	11149
127	Ga0070717_10007542	3300006028	Bacteria	8084
128	Ga0070717_10010895	3300006028	Bacteria	6882
129	Ga0070717_10035102	3300006028	Bacteria	4057
130	Ga0070717_10049009	3300006028	Bacteria	3467
131	Ga0070717_10128068	3300006028	Bacteria	2181
132	Ga0070717_10198158	3300006028	Bacteria	1758
133	Ga0070716_100002303	3300006173	Bacteria	8795
134	Ga0070716_100023733	3300006173	Bacteria	3257
135	Ga0070716_100050334	3300006173	Bacteria	2364
136	Ga0070716_100055667	3300006173	Bacteria	2265
137	Ga0070716_100057143	3300006173	Bacteria	2241
138	Ga0070716_100140313	3300006173	Bacteria	1540
139	Ga0070712_100000010	3300006175	Bacteria	143560
140	Ga0070712_100000648	3300006175	Bacteria	20453
141	Ga0070712_100036259	3300006175	Bacteria	3354
142	Ga0070712_100052716	3300006175	Bacteria	2838
143	Ga0070712_100086468	3300006175	Bacteria	2285
144	Ga0075367_10051005	3300006178	Bacteria	2445
145	Ga0097621_100000360	3300006237	Bacteria	31513
146	Ga0097621_100000989	3300006237	Bacteria	19973
147	Ga0097621_100039885	3300006237	Bacteria	3773
148	Ga0097621_100061702	3300006237	Bacteria	3075
149	Ga0068871_100000237	3300006358	Bacteria	39037
150	Ga0068871_100002642	3300006358	Bacteria	12241
151	Ga0068871_100048759	3300006358	Bacteria	3420
152	Ga0068871_100325547	3300006358	Bacteria	1354
153	Ga0068871_100357781	3300006358	Bacteria	1292
154	Ga0075430_100003877	3300006846	Bacteria	12598
155	Ga0075430_100054945	3300006846	Bacteria	3350
156	Ga0075431_100000572	3300006847	Bacteria	31106
157	Ga0075433_10033326	3300006852	Bacteria	4415
158	Ga0075434_100000342	3300006871	Bacteria	33644
159	Ga0075434_100016652	3300006871	Bacteria	7070
160	Ga0075434_100258291	3300006871	Bacteria	1761
161	Ga0075434_100299628	3300006871	Bacteria	1628
162	Ga0075429_100055102	3300006880	Bacteria	3460
163	Ga0075436_100004275	3300006914	Bacteria	9808
164	Ga0075436_100016320	3300006914	Bacteria	5084
165	Ga0075436_100017413	3300006914	Bacteria	4919
166	Ga0075436_100064927	3300006914	Bacteria	2523
167	Ga0097620_100002710	3300006931	Bacteria	17971
168	Ga0097620_100004225	3300006931	Bacteria	14657
169	Ga0105240_10011777	3300009093	Bacteria	12150
170	Ga0105240_10012134	3300009093	Bacteria	11929
171	Ga0105240_10045155	3300009093	Bacteria	5592
172	Ga0105240_10052344	3300009093	Bacteria	5134
173	Ga0111539_10000609	3300009094	Bacteria	46333
174	Ga0105245_10000739	3300009098	Bacteria	29497
175	Ga0105245_10002350	3300009098	Bacteria	17109
176	Ga0105245_10030828	3300009098	Bacteria	4743
177	Ga0105245_10099282	3300009098	Bacteria	2691
178	Ga0105245_10175659	3300009098	Bacteria	2043
179	Ga0105247_10001813	3300009101	Bacteria	14985
180	Ga0114129_10211926	3300009147	Bacteria	2618
181	Ga0105243_10083937	3300009148	Bacteria	2607
182	Ga0105241_10006996	3300009174	Bacteria	8299
183	Ga0105241_10056233	3300009174	Bacteria	3017
184	Ga0105241_10079226	3300009174	Bacteria	2568
185	Ga0105241_10085386	3300009174	Bacteria	2480
186	Ga0105241_10095423	3300009174	Bacteria	2354
187	Ga0105242_10189533	3300009176	Bacteria	1820
188	Ga0105248_10064223	3300009177	Bacteria	4121
189	Ga0105248_10078352	3300009177	Bacteria	3715
190	Ga0105237_10123771	3300009545	Bacteria	2580
191	Ga0105237_10213227	3300009545	Bacteria	1930
192	Ga0105237_10304711	3300009545	Bacteria	1596
193	Ga0105238_10009253	3300009551	Bacteria	9861
194	Ga0105238_10061615	3300009551	Bacteria	3754
195	Ga0105238_10073337	3300009551	Bacteria	3418
196	Ga0105238_10080700	3300009551	Bacteria	3242
197	Ga0105249_10044596	3300009553	Bacteria	4031
198	Ga0105239_10053247	3300010375	Bacteria	4439
199	Ga0105239_10096172	3300010375	Bacteria	3272
200	Ga0105239_10122035	3300010375	Bacteria	2895
201	Ga0105246_10023376	3300011119	Bacteria	3999
202	Ga0157373_10001057	3300013100	Bacteria	21194
203	Ga0157373_10002227	3300013100	Bacteria	14677
204	Ga0157373_10024214	3300013100	Bacteria	4399
205	Ga0157373_10227289	3300013100	Bacteria	1317
206	Ga0157373_10256539	3300013100	Bacteria	1237
207	Ga0157371_10002229	3300013102	Bacteria	18748
208	Ga0157371_10141825	3300013102	Bacteria	1711
209	Ga0157370_10064919	3300013104	Bacteria	3454
210	Ga0157369_10000034	3300013105	Bacteria	200710
211	Ga0157369_10005080	3300013105	Bacteria	15401
212	Ga0157369_10019212	3300013105	Bacteria	7646
213	Ga0157369_10035465	3300013105	Bacteria	5469
214	Ga0157369_10040207	3300013105	Bacteria	5106
215	Ga0157369_10133210	3300013105	Bacteria	2633
216	Ga0157374_10001921	3300013296	Bacteria	17418
217	Ga0157374_10002233	3300013296	Bacteria	16314
218	Ga0157374_10019450	3300013296	Bacteria	6010
219	Ga0157374_10111036	3300013296	Bacteria	2637
220	Ga0157374_10111683	3300013296	Bacteria	2629
221	Ga0157378_10000227	3300013297	Bacteria	54885
222	Ga0157378_10000938	3300013297	Bacteria	26780
223	Ga0157378_10052011	3300013297	Bacteria	3645
224	Ga0157378_10138169	3300013297	Bacteria	2261
225	Ga0163162_10002202	3300013306	Bacteria	18303
226	Ga0163162_10044022	3300013306	Bacteria	4470
227	Ga0163162_10044235	3300013306	Bacteria	4459
228	Ga0157372_10000701	3300013307	Bacteria	36835
229	Ga0157372_10003879	3300013307	Bacteria	16063
230	Ga0157372_10004654	3300013307	Bacteria	14585
231	Ga0157372_10006555	3300013307	Bacteria	12386
232	Ga0157372_10094478	3300013307	Bacteria	3405
233	Ga0157372_10096985	3300013307	Bacteria	3361
234	Ga0157372_10197118	3300013307	Bacteria	2333
235	Ga0157375_10276558	3300013308	Bacteria	1841
236	Ga0163163_10009941	3300014325	Bacteria	8530
237	Ga0163163_10022140	3300014325	Bacteria	6012
238	Ga0163163_10033443	3300014325	Bacteria	4974
239	Ga0163163_10055384	3300014325	Bacteria	3919
240	Ga0182008_10011803	3300014497	Bacteria	4633
241	Ga0182008_10057710	3300014497	Bacteria	1917
242	Ga0157377_10000505	3300014745	Bacteria	16606
243	Ga0157379_10001808	3300014968	Bacteria	17654
244	Ga0157379_10011350	3300014968	Bacteria	7769
245	Ga0157379_10031509	3300014968	Bacteria	4724
246	Ga0157379_10191740	3300014968	Bacteria	1847
247	Ga0157376_10034446	3300014969	Bacteria	4089
248	Ga0157376_10074448	3300014969	Bacteria	2895
249	Ga0157376_10079305	3300014969	Bacteria	2814
250	Ga0182006_1020058	3300015261	Bacteria	2805
251	Ga0182007_10006474	3300015262	Bacteria	5023
252	Ga0182007_10008219	3300015262	Bacteria	4300
253	Ga0163161_10001248	3300017792	Bacteria	19018
254	Ga0224571_100091	3300022734	Bacteria	3473
255	Ga0224572_1004305	3300024225	Bacteria	2465
256	Ga0228598_1000604	3300024227	Bacteria	7539
257	Ga0228598_1002797	3300024227	Bacteria	3782
258	Ga0207697_10004785	3300025315	Bacteria	6404
259	Ga0207656_10070480	3300025321	Bacteria	1552
260	Ga0207692_10013899	3300025898	Bacteria	3505
261	Ga0207692_10074763	3300025898	Unclassified	1796
262	Ga0207692_10099226	3300025898	Bacteria	1595
263	Ga0207688_10001143	3300025901	Bacteria	13682
264	Ga0207647_10000966	3300025904	Bacteria	22301
265	Ga0207647_10016873	3300025904	Bacteria	4974
266	Ga0207685_10005935	3300025905	Bacteria	3276
267	Ga0207699_10000400	3300025906	Bacteria	22428
268	Ga0207645_10000073	3300025907	Bacteria	71786
269	Ga0207643_10009036	3300025908	Bacteria	5352
270	Ga0207705_10033635	3300025909	Bacteria	3663
271	Ga0207705_10233950	3300025909	Bacteria	1398
272	Ga0207684_10001148	3300025910	Bacteria	29555
273	Ga0207684_10001187	3300025910	Bacteria	29147
274	Ga0207684_10003549	3300025910	Bacteria	15195
275	Ga0207684_10050705	3300025910	Bacteria	3521
276	Ga0207654_10127098	3300025911	Bacteria	1609
277	Ga0207707_10008900	3300025912	Bacteria	8716
278	Ga0207707_10034570	3300025912	Bacteria	4422
279	Ga0207695_10039550	3300025913	Bacteria	5068
280	Ga0207695_10048779	3300025913	Bacteria	4470
281	Ga0207695_10072457	3300025913	Bacteria	3515
282	Ga0207671_10089390	3300025914	Bacteria	2318
283	Ga0207693_10000004	3300025915	Bacteria	193261
284	Ga0207693_10000051	3300025915	Bacteria	99220
285	Ga0207693_10002761	3300025915	Bacteria	15195
286	Ga0207693_10006484	3300025915	Bacteria	9693
287	Ga0207693_10030353	3300025915	Bacteria	4269
288	Ga0207693_10036813	3300025915	Bacteria	3858
289	Ga0207663_10000233	3300025916	Bacteria	24661
290	Ga0207663_10000386	3300025916	Bacteria	19255
291	Ga0207663_10007012	3300025916	Bacteria	5814
292	Ga0207663_10039689	3300025916	Bacteria	2855
293	Ga0207663_10234140	3300025916	Bacteria	1343
294	Ga0207662_10043675	3300025918	Bacteria	2644
295	Ga0207657_10000379	3300025919	Bacteria	47118
296	Ga0207657_10166265	3300025919	Bacteria	1789
297	Ga0207649_10002058	3300025920	Bacteria	11439
298	Ga0207646_10000855	3300025922	Bacteria	39420
299	Ga0207646_10020569	3300025922	Bacteria	6114
300	Ga0207646_10035677	3300025922	Bacteria	4491
301	Ga0207646_10038511	3300025922	Bacteria	4306
302	Ga0207694_10000250	3300025924	Bacteria	51411
303	Ga0207650_10000045	3300025925	Bacteria	181507
304	Ga0207659_10014302	3300025926	Bacteria	5113
305	Ga0207687_10020310	3300025927	Bacteria	4406
306	Ga0207687_10235984	3300025927	Bacteria	1447
307	Ga0207700_10000100	3300025928	Bacteria	52891
308	Ga0207700_10000468	3300025928	Bacteria	23660
309	Ga0207700_10007085	3300025928	Bacteria	6825
310	Ga0207700_10008864	3300025928	Bacteria	6255
311	Ga0207700_10037929	3300025928	Bacteria	3494
312	Ga0207700_10122385	3300025928	Bacteria	2112
313	Ga0207700_10338543	3300025928	Unclassified	1307
314	Ga0207664_10030466	3300025929	Bacteria	4119
315	Ga0207664_10046019	3300025929	Bacteria	3424
316	Ga0207664_10075806	3300025929	Bacteria	2720
317	Ga0207644_10007964	3300025931	Bacteria	6929
318	Ga0207706_10000213	3300025933	Bacteria	63821
319	Ga0207706_10056898	3300025933	Bacteria	3446
320	Ga0207686_10014235	3300025934	Bacteria	4424
321	Ga0207670_10002999	3300025936	Bacteria	8912
322	Ga0207669_10135639	3300025937	Bacteria	1699
323	Ga0207665_10003445	3300025939	Bacteria	10581
324	Ga0207665_10004141	3300025939	Bacteria	9659
325	Ga0207665_10011218	3300025939	Bacteria	5881
326	Ga0207665_10021576	3300025939	Bacteria	4236
327	Ga0207665_10035055	3300025939	Bacteria	3329
328	Ga0207665_10097431	3300025939	Bacteria	2047
329	Ga0207691_10000556	3300025940	Bacteria	37289
330	Ga0207689_10000780	3300025942	Bacteria	30597
331	Ga0207661_10004371	3300025944	Bacteria	9904
332	Ga0207679_10000525	3300025945	Bacteria	25943
333	Ga0207667_10000999	3300025949	Bacteria	36082
334	Ga0207667_10052723	3300025949	Bacteria	4282
335	Ga0207667_10131128	3300025949	Bacteria	2582
336	Ga0207651_10047310	3300025960	Bacteria	2899
337	Ga0207712_10005706	3300025961	Bacteria	7844
338	Ga0207640_10065238	3300025981	Bacteria	2429
339	Ga0207640_10259125	3300025981	Bacteria	1354
340	Ga0207658_10010574	3300025986	Bacteria	6270
341	Ga0207677_10003487	3300026023	Bacteria	8334
342	Ga0207677_10005866	3300026023	Bacteria	6681
343	Ga0207677_10025233	3300026023	Bacteria	3705
344	Ga0207703_10022241	3300026035	Bacteria	4971
345	Ga0207703_10035709	3300026035	Bacteria	3951
346	Ga0207703_10125788	3300026035	Bacteria	2207
347	Ga0207639_10023789	3300026041	Bacteria	4426
348	Ga0207678_10000026	3300026067	Bacteria	116850
349	Ga0207702_10000564	3300026078	Bacteria	41234
350	Ga0207702_10033831	3300026078	Bacteria	4272
351	Ga0207702_10063380	3300026078	Bacteria	3161
352	Ga0207641_10000075	3300026088	Bacteria	145149
353	Ga0207641_10208728	3300026088	Bacteria	1805
354	Ga0207648_10000679	3300026089	Bacteria	38160
355	Ga0207648_10026489	3300026089	Bacteria	5151
356	Ga0207676_10000212	3300026095	Bacteria	50034
357	Ga0207676_10008541	3300026095	Bacteria	7280
358	Ga0207676_10023469	3300026095	Bacteria	4551
359	Ga0207676_10054848	3300026095	Bacteria	3125
360	Ga0207674_10000444	3300026116	Bacteria	53769
361	Ga0207674_10000559	3300026116	Bacteria	48687
362	Ga0207674_10006386	3300026116	Bacteria	13876
363	Ga0207675_100003469	3300026118	Bacteria	15409
364	Ga0207675_100196617	3300026118	Bacteria	1935
365	Ga0207683_10000438	3300026121	Bacteria	38515
366	Ga0207683_10107612	3300026121	Bacteria	2494
367	Ga0207428_10001351	3300027907	Bacteria	26152
368	Ga0268266_10001444	3300028379	Bacteria	28286
369	Ga0268265_10024102	3300028380	Bacteria	4299
370	Ga0268265_10098622	3300028380	Bacteria	2354
371	Ga0268264_10020241	3300028381	Bacteria	5437
372	Ga0268264_10026411	3300028381	Bacteria	4744
373	Ga0265338_10011968	3300028800	Bacteria	9939
374	Ga0265338_10012685	3300028800	Bacteria	9590
375	Ga0265338_10051219	3300028800	Bacteria	3720
376	Ga0265330_10004187	3300031235	Bacteria	7358
377	Ga0265325_10001678	3300031241	Bacteria	15369
378	Ga0265325_10013998	3300031241	Bacteria	4549
379	Ga0265329_10032850	3300031242	Bacteria	1680
380	Ga0265339_10014492	3300031249	Bacteria	4749
381	Ga0265339_10025552	3300031249	Bacteria	3389
382	Ga0265339_10039900	3300031249	Bacteria	2611
383	Ga0265316_10026224	3300031344	Bacteria	4853
384	Ga0265316_10068028	3300031344	Bacteria	2753
385	Ga0265314_10038866	3300031711	Bacteria	3434
386	Ga0307413_10065206	3300031824	Bacteria	2267
387	Ga0307410_10000439	3300031852	Bacteria	16668
388	Ga0307409_100005218	3300031995	Bacteria	7441
389	Ga0307411_10042448	3300032005	Bacteria	2902
390	Ga0307415_100005230	3300032126	Bacteria	6864
391	Ga0373926_0003371	3300035083	Bacteria	5144
392	Ga0373944_0042623	3300035089	Bacteria	1408
393	Ga0373923_0025096	3300035111	Bacteria	2359
394	Ga0373936_0044440	3300035113	Bacteria	1787
395	Ga0373935_0037910	3300035692	Bacteria	3017
396	Ga0373935_0094602	3300035692	Bacteria	1961
397	Ga0373927_0028988	3300035695	Bacteria	3609
398	Ga0373927_0075200	3300035695	Bacteria	2187
399	Ga0373927_0216587	3300035695	Bacteria	1258
400	Ga0373933_0067360	3300035724	Bacteria	2172
401	Ga0373947_0016173	3300035725	Bacteria	4288
402	Ga0373947_0126687	3300035725	Bacteria	1627
403	Ga0373937_0013792	3300036401	Bacteria	7121
404	Ga0373937_0361324	3300036401	Bacteria	1376
405	Ga0373925_0000886	3300037068	Bacteria	27341
406	Ga0373925_0016290	3300037068	Bacteria	5382
407	Ga0373925_0062088	3300037068	Bacteria	2809
408	Ga0395900_0206387	3300037418	Bacteria	1986
409	Ga0395905_0013001	3300037471	Bacteria	8001
410	Ga0395905_0034022	3300037471	Bacteria	4786
411	Ga0395905_0065731	3300037471	Bacteria	3396
412	Ga0395905_0153080	3300037471	Bacteria	2169
413	Ga0395905_0438606	3300037471	Bacteria	1203
414	Ga0395901_0459611	3300038443	Bacteria	1301
415	Ga0436365_0839633	3300039437	Bacteria	1054
416	Ga0436363_0914206	3300039450	Bacteria	1714
417	Ga0436362_0232201	3300039453	Bacteria	1184
418	Ga0451577_0045584	3300042876	Bacteria	3925
419	Ga0453683_0001010	3300044673	Bacteria	26410
420	Ga0453684_0000153	3300044712	Bacteria	305116
421	Ga0453684_0240289	3300044712	Bacteria	2085
422	Ga0453684_0320640	3300044712	Bacteria	1755
423	Ga0451576_0000881	3300045051	Bacteria	57127
424	Ga0451576_0038187	3300045051	Bacteria	5082
425	Ga0451576_0116773	3300045051	Bacteria	2778
426	Ga0451576_0287007	3300045051	Bacteria	1720
427	Ga0466958_0036566	3300045836	Bacteria	2940
428	Ga0466967_0185930	3300045976	Bacteria	1962
429	Ga0466967_0196917	3300045976	Bacteria	1906
430	Ga0495603_0014690	3300046455	Bacteria	4734
431	Ga0495580_0000055	3300046472	Bacteria	65061
432	Ga0495580_0000743	3300046472	Bacteria	27919
433	Ga0495580_0001479	3300046472	Bacteria	20611
434	Ga0495580_0012233	3300046472	Bacteria	6592
435	Ga0495580_0021556	3300046472	Bacteria	4751
436	Ga0495580_0022577	3300046472	Bacteria	4630
437	Ga0495580_0044678	3300046472	Bacteria	3150
438	Ga0495580_0136328	3300046472	Bacteria	1702
439	Ga0495582_0000342	3300046473	Bacteria	25603
440	Ga0495582_0003638	3300046473	Bacteria	8679
441	Ga0495582_0042511	3300046473	Bacteria	2503
442	Ga0495639_0144248	3300046475	Bacteria	1146
443	Ga0495594_0013218	3300046499	Bacteria	4307
444	Ga0495594_0069284	3300046499	Bacteria	1960
445	Ga0495608_0153446	3300046511	Bacteria	1467
446	Ga0495652_0184454	3300046529	Bacteria	1598
447	Ga0495587_0101433	3300046536	Bacteria	1658
448	Ga0495647_0078755	3300046681	Bacteria	1333
449	Ga0495658_0005753	3300046683	Bacteria	6091
450	Ga0495658_0060757	3300046683	Bacteria	2168
451	Ga0495669_0030847	3300046684	Bacteria	2353
452	Ga0495669_0049478	3300046684	Bacteria	1882
453	Ga0495674_0011317	3300047319	Bacteria	8422
454	Ga0495676_0083678	3300047321	Bacteria	2410
455	Ga0495675_0065516	3300047444	Bacteria	2297
456	Ga0495675_0085663	3300047444	Bacteria	1981
457	Ga0495675_0127641	3300047444	Bacteria	1582
458	Ga0495593_0107406	3300047673	Bacteria	1427
459	Ga0496101_0027015	3300048904	Bacteria	3993
460	Ga0496101_0092458	3300048904	Bacteria	2252
461	Ga0496101_0291400	3300048904	Bacteria	1277
462	Ga0496102_0005085	3300048905	Bacteria	11139
463	Ga0496103_0035265	3300048906	Bacteria	3062
464	Ga0496104_0013296	3300048907	Bacteria	7421
465	Ga0496104_0027678	3300048907	Bacteria	5249
466	Ga0496104_0028729	3300048907	Bacteria	5155
467	Ga0496104_0044630	3300048907	Bacteria	4165
468	Ga0496104_0251800	3300048907	Bacteria	1679
469	Ga0496104_0330785	3300048907	Bacteria	1437
470	Ga0496104_0345216	3300048907	Bacteria	1401
471	Ga0496107_0013984	3300048910	Bacteria	5616
472	Ga0496108_0000304	3300048911	Bacteria	42250
473	Ga0496108_0117727	3300048911	Bacteria	2276
474	Ga0496109_0000164	3300048912	Bacteria	65491
475	Ga0496110_0002655	3300048913	Bacteria	13491
476	Ga0496110_0063302	3300048913	Bacteria	3268
477	Ga0496110_0208576	3300048913	Bacteria	1776
478	Ga0496111_0001777	3300048914	Bacteria	12643
479	Ga0496112_0000078	3300048915	Bacteria	64712
480	Ga0496112_0002749	3300048915	Bacteria	14257
481	Ga0496112_0020691	3300048915	Bacteria	6241
482	Ga0496112_0025372	3300048915	Bacteria	5691
483	Ga0496112_0031823	3300048915	Bacteria	5119
484	Ga0496112_0097286	3300048915	Bacteria	2914
485	Ga0496112_0290788	3300048915	Bacteria	1580
486	Ga0496113_0009021	3300048916	Bacteria	6531
487	Ga0496113_0131370	3300048916	Bacteria	1965
488	Ga0496113_0269357	3300048916	Bacteria	1361
489	Ga0496114_0073051	3300048917	Bacteria	2886
490	Ga0496115_0001265	3300048918	Bacteria	18112
491	Ga0496115_0221808	3300048918	Bacteria	1560
492	Ga0501038_0156939	3300049574	Bacteria	1852
493	Ga0501040_0018227	3300049576	Bacteria	4661
494	Ga0501041_0009202	3300049577	Bacteria	5818
495	Ga0501041_0210850	3300049577	Bacteria	1218
496	Ga0501042_0207604	3300049578	Bacteria	1412
497	Ga0501048_0013670	3300049582	Bacteria	6023
498	Ga0501072_0115874	3300049588	Bacteria	2134
499	Ga0501073_0132156	3300049589	Bacteria	1730
500	Ga0501075_0021271	3300049591	Bacteria	4728
501	Ga0501075_0154577	3300049591	Bacteria	1749
502	Ga0501076_0009304	3300049592	Bacteria	7251
503	Ga0501076_0098382	3300049592	Bacteria	2357
504	Ga0501076_0295135	3300049592	Bacteria	1328
505	Ga0501077_0236790	3300049593	Bacteria	1160
506	Ga0501079_0044275	3300049741	Bacteria	3435
507	Ga0501079_0165040	3300049741	Bacteria	1727
508	Ga0501081_0017830	3300049743	Bacteria	4707
509	Ga0501081_0268533	3300049743	Bacteria	1247
510	Ga0501083_0120727	3300049744	Bacteria	1719
511	Ga0501045_0025357	3300049824	Bacteria	4262
512	nmdc:mga09592_210174_c1	3300050508	Bacteria	1686
513	nmdc:mga0qj67_23886_c1	3300050509	Bacteria	4708
514	nmdc:mga06r32_33535_c1	3300050510	Bacteria	4835
515	nmdc:mga08y16_96500_c1	3300050511	Bacteria	3079
516	nmdc:mga0n895_12047_c1	3300050512	Bacteria	7741
517	nmdc:mga0n895_302559_c1	3300050512	Bacteria	1621
518	nmdc:mga0n895_326861_c1	3300050512	Bacteria	1554
519	nmdc:mga0rr50_5573_c1	3300050513	Bacteria	7530
520	nmdc:mga08x19_11565_c1	3300050514	Bacteria	5312
521	nmdc:mga08x19_64614_c1	3300050514	Bacteria	2376
522	nmdc:mga08x19_8005_c1	3300050514	Bacteria	6281
523	nmdc:mga08x19_89252_c1	3300050514	Bacteria	2033
524	nmdc:mga0a205_42413_c1	3300050515	Bacteria	4385
525	Ga0495601_0035050	3300053077	Bacteria	3132
526	Ga0501084_0019350	3300054114	Bacteria	5673
527	Ga0501084_0031016	3300054114	Bacteria	4471
528	Ga0501084_0039432	3300054114	Bacteria	3951
529	Ga0530510_0069999	3300061734	Bacteria	2546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005435	Ga0070714_100116904	Ga0070714_1001169042	272
2	3300009093	Ga0105240_10012134	Ga0105240_100121343	274
3	3300009177	Ga0105248_10078352	Ga0105248_100783522	274
4	3300009545	Ga0105237_10123771	Ga0105237_101237711	274
5	3300009551	Ga0105238_10080700	Ga0105238_100807002	274
6	3300013100	Ga0157373_10024214	Ga0157373_100242142	274
7	3300013105	Ga0157369_10040207	Ga0157369_100402074	274
8	3300013296	Ga0157374_10019450	Ga0157374_100194504	274
9	3300013307	Ga0157372_10094478	Ga0157372_100944782	274
10	3300014325	Ga0163163_10033443	Ga0163163_100334432	274
11	3300014497	Ga0182008_10057710	Ga0182008_100577101	274
12	3300015261	Ga0182006_1020058	Ga0182006_10200582	274
13	3300015262	Ga0182007_10008219	Ga0182007_100082192	274
14	3300048904	Ga0496101_0291400	Ga0496101_0291400_129_1193	274
15	3300048907	Ga0496104_0027678	Ga0496104_0027678_2405_3469	274
16	3300048913	Ga0496110_0063302	Ga0496110_0063302_784_1848	274
17	3300005435	Ga0070714_100002783	Ga0070714_1000027833	276
18	3300005436	Ga0070713_100012592	Ga0070713_1000125923	276
19	3300006028	Ga0070717_10198158	Ga0070717_101981582	276
20	3300013105	Ga0157369_10005080	Ga0157369_100050802	276
21	3300025929	Ga0207664_10030466	Ga0207664_100304663	276
22	3300045976	Ga0466967_0196917	Ga0466967_0196917_401_1441	276
23	3300036401	Ga0373937_0013792	Ga0373937_0013792_129_1169	278
24	3300013100	Ga0157373_10256539	Ga0157373_102565391	279
25	3300005331	Ga0070670_100013509	Ga0070670_1000135092	280
26	3300005338	Ga0068868_100002408	Ga0068868_1000024082	280
27	3300005364	Ga0070673_100040920	Ga0070673_1000409201	280
28	3300005458	Ga0070681_10008952	Ga0070681_100089524	280
29	3300005459	Ga0068867_100017346	Ga0068867_1000173462	280
30	3300005530	Ga0070679_100101676	Ga0070679_1001016762	280
31	3300005564	Ga0070664_100000278	Ga0070664_1000002787	280
32	3300005577	Ga0068857_100011811	Ga0068857_1000118114	280
33	3300005578	Ga0068854_100013686	Ga0068854_1000136865	280
34	3300005614	Ga0068856_100000243	Ga0068856_1000002433	280
35	3300005617	Ga0068859_100004225	Ga0068859_1000042257	280
36	3300005618	Ga0068864_100006886	Ga0068864_1000068867	280
37	3300005842	Ga0068858_100045591	Ga0068858_1000455912	280
38	3300005843	Ga0068860_100076961	Ga0068860_1000769613	280
39	3300006931	Ga0097620_100004225	Ga0097620_1000042257	280
40	3300009093	Ga0105240_10052344	Ga0105240_100523443	280
41	3300009098	Ga0105245_10030828	Ga0105245_100308284	280
42	3300009148	Ga0105243_10083937	Ga0105243_100839372	280
43	3300009174	Ga0105241_10085386	Ga0105241_100853862	280
44	3300011119	Ga0105246_10023376	Ga0105246_100233762	280
45	3300013102	Ga0157371_10141825	Ga0157371_101418252	280
46	3300013105	Ga0157369_10133210	Ga0157369_101332102	280
47	3300013296	Ga0157374_10001921	Ga0157374_1000192115	280
48	3300013297	Ga0157378_10000227	Ga0157378_1000022749	280
49	3300013307	Ga0157372_10000701	Ga0157372_1000070115	280
50	3300025904	Ga0207647_10016873	Ga0207647_100168732	280
51	3300025912	Ga0207707_10008900	Ga0207707_100089003	280
52	3300025913	Ga0207695_10039550	Ga0207695_100395503	280
53	3300025927	Ga0207687_10235984	Ga0207687_102359841	280
54	3300025933	Ga0207706_10056898	Ga0207706_100568982	280
55	3300025949	Ga0207667_10131128	Ga0207667_101311282	280
56	3300025981	Ga0207640_10259125	Ga0207640_102591251	280
57	3300026023	Ga0207677_10003487	Ga0207677_100034872	280
58	3300026035	Ga0207703_10035709	Ga0207703_100357092	280
59	3300026089	Ga0207648_10026489	Ga0207648_100264892	280
60	3300026095	Ga0207676_10008541	Ga0207676_100085412	280
61	3300026116	Ga0207674_10000444	Ga0207674_1000044442	280
62	3300028381	Ga0268264_10026411	Ga0268264_100264112	280
63	3300035695	Ga0373927_0216587	Ga0373927_0216587_119_1156	280
64	3300036401	Ga0373937_0361324	Ga0373937_0361324_53_1093	280
65	3300037068	Ga0373925_0016290	Ga0373925_0016290_3362_4399	280
66	3300048915	Ga0496112_0097286	Ga0496112_0097286_1863_2903	280
67	3300049744	Ga0501083_0120727	Ga0501083_0120727_590_1630	280
68	3300005439	Ga0070711_100010689	Ga0070711_1000106892	281
69	3300005445	Ga0070708_100004590	Ga0070708_1000045901	281
70	3300005614	Ga0068856_100042515	Ga0068856_1000425152	281
71	3300006028	Ga0070717_10035102	Ga0070717_100351022	281
72	3300009174	Ga0105241_10095423	Ga0105241_100954232	281
73	3300009545	Ga0105237_10213227	Ga0105237_102132272	281
74	3300009545	Ga0105237_10304711	Ga0105237_103047111	281
75	3300009551	Ga0105238_10061615	Ga0105238_100616152	281
76	3300013104	Ga0157370_10064919	Ga0157370_100649192	281
77	3300025913	Ga0207695_10072457	Ga0207695_100724571	281
78	3300025914	Ga0207671_10089390	Ga0207671_100893901	281
79	3300025916	Ga0207663_10007012	Ga0207663_100070122	281
80	3300026078	Ga0207702_10033831	Ga0207702_100338313	281
81	3300005436	Ga0070713_100088237	Ga0070713_1000882372	282
82	3300006028	Ga0070717_10003574	Ga0070717_100035742	282
83	3300006028	Ga0070717_10049009	Ga0070717_100490092	282
84	3300006175	Ga0070712_100052716	Ga0070712_1000527162	282
85	3300006914	Ga0075436_100016320	Ga0075436_1000163203	282
86	3300025915	Ga0207693_10006484	Ga0207693_100064844	282
87	3300025916	Ga0207663_10234140	Ga0207663_102341401	282
88	3300025928	Ga0207700_10037929	Ga0207700_100379292	282
89	3300025929	Ga0207664_10046019	Ga0207664_100460192	282
90	3300025929	Ga0207664_10075806	Ga0207664_100758062	282
91	3300050514	nmdc:mga08x19_64614_c1	nmdc:mga08x19_64614_c1_1243_2346	282
92	3300005341	Ga0070691_10109037	Ga0070691_101090371	283
93	3300005436	Ga0070713_100014354	Ga0070713_1000143543	283
94	3300005458	Ga0070681_10000321	Ga0070681_1000032112	283
95	3300005539	Ga0068853_100105553	Ga0068853_1001055532	283
96	3300005563	Ga0068855_100000952	Ga0068855_10000095224	283
97	3300005614	Ga0068856_100000621	Ga0068856_10000062123	283
98	3300005616	Ga0068852_100171697	Ga0068852_1001716972	283
99	3300006237	Ga0097621_100000360	Ga0097621_10000036022	283
100	3300006358	Ga0068871_100000237	Ga0068871_10000023712	283
101	3300006852	Ga0075433_10033326	Ga0075433_100333262	283
102	3300006871	Ga0075434_100000342	Ga0075434_10000034234	283
103	3300009093	Ga0105240_10011777	Ga0105240_100117777	283
104	3300009551	Ga0105238_10009253	Ga0105238_100092536	283
105	3300010375	Ga0105239_10053247	Ga0105239_100532473	283
106	3300013100	Ga0157373_10227289	Ga0157373_102272892	283
107	3300013105	Ga0157369_10000034	Ga0157369_10000034178	283
108	3300013296	Ga0157374_10002233	Ga0157374_100022333	283
109	3300013297	Ga0157378_10052011	Ga0157378_100520112	283
110	3300013307	Ga0157372_10004654	Ga0157372_100046548	283
111	3300025912	Ga0207707_10034570	Ga0207707_100345702	283
112	3300025913	Ga0207695_10048779	Ga0207695_100487792	283
113	3300025924	Ga0207694_10000250	Ga0207694_1000025020	283
114	3300025928	Ga0207700_10008864	Ga0207700_100088643	283
115	3300025949	Ga0207667_10000999	Ga0207667_1000099910	283
116	3300026035	Ga0207703_10125788	Ga0207703_101257882	283
117	3300026041	Ga0207639_10023789	Ga0207639_100237892	283
118	3300026078	Ga0207702_10000564	Ga0207702_1000056413	283
119	3300026116	Ga0207674_10006386	Ga0207674_100063866	283
120	3300031824	Ga0307413_10065206	Ga0307413_100652062	283
121	3300031852	Ga0307410_10000439	Ga0307410_100004397	283
122	3300031995	Ga0307409_100005218	Ga0307409_1000052185	283
123	3300032005	Ga0307411_10042448	Ga0307411_100424482	283
124	3300032126	Ga0307415_100005230	Ga0307415_1000052302	283
125	3300042876	Ga0451577_0045584	Ga0451577_0045584_2268_3374	283
126	3300045051	Ga0451576_0287007	Ga0451576_0287007_172_1278	283
127	3300046511	Ga0495608_0153446	Ga0495608_0153446_96_1136	283
128	3300046536	Ga0495587_0101433	Ga0495587_0101433_380_1420	283
129	3300047444	Ga0495675_0085663	Ga0495675_0085663_644_1684	283
130	3300048907	Ga0496104_0044630	Ga0496104_0044630_1162_2202	283
131	3300048913	Ga0496110_0208576	Ga0496110_0208576_600_1640	283
132	3300048915	Ga0496112_0002749	Ga0496112_0002749_9970_11010	283
133	3300048916	Ga0496113_0269357	Ga0496113_0269357_78_1118	283
134	3300050512	nmdc:mga0n895_12047_c1	nmdc:mga0n895_12047_c1_1394_2425	283
135	3300050515	nmdc:mga0a205_42413_c1	nmdc:mga0a205_42413_c1_1454_2485	283
136	3300005437	Ga0070710_10102915	Ga0070710_101029152	284
137	3300005439	Ga0070711_100132792	Ga0070711_1001327922	284
138	3300005614	Ga0068856_100526495	Ga0068856_1005264951	284
139	3300006173	Ga0070716_100023733	Ga0070716_1000237332	284
140	3300006175	Ga0070712_100036259	Ga0070712_1000362593	284
141	3300006914	Ga0075436_100064927	Ga0075436_1000649272	284
142	3300025915	Ga0207693_10036813	Ga0207693_100368133	284
143	3300025939	Ga0207665_10003445	Ga0207665_100034455	284
144	3300035083	Ga0373926_0003371	Ga0373926_0003371_1990_3030	284
145	3300035089	Ga0373944_0042623	Ga0373944_0042623_50_1090	284
146	3300035113	Ga0373936_0044440	Ga0373936_0044440_123_1163	284
147	3300035692	Ga0373935_0094602	Ga0373935_0094602_221_1261	284
148	3300035725	Ga0373947_0016173	Ga0373947_0016173_2683_3723	284
149	3300037068	Ga0373925_0000886	Ga0373925_0000886_26251_27291	284
150	3300046472	Ga0495580_0000743	Ga0495580_0000743_85_1125	284
151	3300046473	Ga0495582_0000342	Ga0495582_0000342_17789_18829	284
152	3300046475	Ga0495639_0144248	Ga0495639_0144248_38_1078	284
153	3300047673	Ga0495593_0107406	Ga0495593_0107406_24_1064	284
154	3300050513	nmdc:mga0rr50_5573_c1	nmdc:mga0rr50_5573_c1_292_1332	284
155	3300046684	Ga0495669_0030847	Ga0495669_0030847_1077_2120	285
156	3300006846	Ga0075430_100003877	Ga0075430_1000038777	287
157	3300006846	Ga0075430_100054945	Ga0075430_1000549453	287
158	3300006847	Ga0075431_100000572	Ga0075431_10000057234	287
159	3300006880	Ga0075429_100055102	Ga0075429_1000551022	287
160	3300050508	nmdc:mga09592_210174_c1	nmdc:mga09592_210174_c1_695_1615	287
161	3300050509	nmdc:mga0qj67_23886_c1	nmdc:mga0qj67_23886_c1_2081_3001	287
162	3300050510	nmdc:mga06r32_33535_c1	nmdc:mga06r32_33535_c1_2233_3153	287
163	3300005458	Ga0070681_10187211	Ga0070681_101872112	289
164	3300009174	Ga0105241_10006996	Ga0105241_100069968	289
165	3300013100	Ga0157373_10001057	Ga0157373_1000105717	289
166	3300013105	Ga0157369_10035465	Ga0157369_100354652	289
167	3300013296	Ga0157374_10111683	Ga0157374_101116833	289
168	3300013307	Ga0157372_10096985	Ga0157372_100969852	289
169	3300048907	Ga0496104_0251800	Ga0496104_0251800_15_1055	289
170	3300048915	Ga0496112_0020691	Ga0496112_0020691_26_1066	289
171	3300046472	Ga0495580_0022577	Ga0495580_0022577_1524_2564	290
172	3300039437	Ga0436365_0839633	Ga0436365_0839633_16_1002	293
173	3300006358	Ga0068871_100048759	Ga0068871_1000487592	294
174	3300014969	Ga0157376_10034446	Ga0157376_100344462	294
175	3300028800	Ga0265338_10012685	Ga0265338_100126857	295
176	3300031241	Ga0265325_10001678	Ga0265325_100016787	295
177	3300031344	Ga0265316_10068028	Ga0265316_100680282	295
178	3300006871	Ga0075434_100299628	Ga0075434_1002996282	296
179	3300049574	Ga0501038_0156939	Ga0501038_0156939_241_1176	296
180	3300049576	Ga0501040_0018227	Ga0501040_0018227_2610_3545	296
181	3300049577	Ga0501041_0009202	Ga0501041_0009202_3088_4023	296
182	3300049578	Ga0501042_0207604	Ga0501042_0207604_405_1340	296
183	3300049582	Ga0501048_0013670	Ga0501048_0013670_2109_3044	296
184	3300049588	Ga0501072_0115874	Ga0501072_0115874_80_1015	296
185	3300049591	Ga0501075_0021271	Ga0501075_0021271_1776_2711	296
186	3300049592	Ga0501076_0009304	Ga0501076_0009304_2573_3508	296
187	3300049741	Ga0501079_0044275	Ga0501079_0044275_776_1711	296
188	3300049743	Ga0501081_0268533	Ga0501081_0268533_81_1016	296
189	3300049824	Ga0501045_0025357	Ga0501045_0025357_3087_4022	296
190	3300054114	Ga0501084_0031016	Ga0501084_0031016_964_1899	296
191	3300006028	Ga0070717_10010895	Ga0070717_100108952	297
192	3300013307	Ga0157372_10197118	Ga0157372_101971181	297
193	3300025922	Ga0207646_10020569	Ga0207646_100205693	297
194	3300005435	Ga0070714_100150228	Ga0070714_1001502282	298
195	3300005436	Ga0070713_100227316	Ga0070713_1002273161	298
196	3300005445	Ga0070708_100039373	Ga0070708_1000393732	298
197	3300005468	Ga0070707_100085382	Ga0070707_1000853822	298
198	3300005614	Ga0068856_100224354	Ga0068856_1002243543	298
199	3300013307	Ga0157372_10006555	Ga0157372_100065558	298
200	3300026078	Ga0207702_10063380	Ga0207702_100633803	298
201	3300049577	Ga0501041_0210850	Ga0501041_0210850_55_1047	299
202	3300049591	Ga0501075_0154577	Ga0501075_0154577_683_1675	299
203	3300049592	Ga0501076_0098382	Ga0501076_0098382_851_1843	299
204	3300054114	Ga0501084_0019350	Ga0501084_0019350_3743_4735	299
205	3300005340	Ga0070689_100115668	Ga0070689_1001156682	302
206	3300005466	Ga0070685_10022478	Ga0070685_100224782	302
207	3300005617	Ga0068859_100002710	Ga0068859_1000027109	302
208	3300005618	Ga0068864_100005328	Ga0068864_1000053285	302
209	3300005842	Ga0068858_100000367	Ga0068858_10000036738	302
210	3300006871	Ga0075434_100258291	Ga0075434_1002582912	302
211	3300006931	Ga0097620_100002710	Ga0097620_1000027109	302
212	3300009094	Ga0111539_10000609	Ga0111539_1000060922	302
213	3300009177	Ga0105248_10064223	Ga0105248_100642232	302
214	3300013306	Ga0163162_10044022	Ga0163162_100440223	302
215	3300014325	Ga0163163_10009941	Ga0163163_100099413	302
216	3300014968	Ga0157379_10001808	Ga0157379_100018085	302
217	3300025918	Ga0207662_10043675	Ga0207662_100436753	302
218	3300026035	Ga0207703_10022241	Ga0207703_100222412	302
219	3300026095	Ga0207676_10023469	Ga0207676_100234692	302
220	3300026118	Ga0207675_100196617	Ga0207675_1001966171	302
221	3300027907	Ga0207428_10001351	Ga0207428_1000135111	302
222	3300046499	Ga0495594_0069284	Ga0495594_0069284_312_1298	302
223	3300048907	Ga0496104_0330785	Ga0496104_0330785_269_1375	302
224	3300050511	nmdc:mga08y16_96500_c1	nmdc:mga08y16_96500_c1_1977_2966	302
225	3300050512	nmdc:mga0n895_302559_c1	nmdc:mga0n895_302559_c1_167_1156	302
226	3300025898	Ga0207692_10074763	Ga0207692_100747632	305
227	3300001976	JGI24752J21851_1000397	JGI24752J21851_10003972	306
228	3300002239	JGI24034J26672_10000722	JGI24034J26672_100007223	306
229	3300002459	JGI24751J29686_10001409	JGI24751J29686_100014092	306
230	3300005328	Ga0070676_10002161	Ga0070676_100021614	306
231	3300005329	Ga0070683_100001090	Ga0070683_1000010903	306
232	3300005330	Ga0070690_100150096	Ga0070690_1001500962	306
233	3300005334	Ga0068869_100026694	Ga0068869_1000266942	306
234	3300005337	Ga0070682_100012565	Ga0070682_1000125652	306
235	3300005338	Ga0068868_100014287	Ga0068868_1000142873	306
236	3300005339	Ga0070660_100004484	Ga0070660_1000044843	306
237	3300005340	Ga0070689_100068874	Ga0070689_1000688742	306
238	3300005344	Ga0070661_100009518	Ga0070661_1000095182	306
239	3300005347	Ga0070668_100002257	Ga0070668_1000022579	306
240	3300005353	Ga0070669_100005768	Ga0070669_1000057687	306
241	3300005356	Ga0070674_100013738	Ga0070674_1000137382	306
242	3300005364	Ga0070673_100026874	Ga0070673_1000268742	306
243	3300005365	Ga0070688_100000762	Ga0070688_1000007629	306
244	3300005366	Ga0070659_100011876	Ga0070659_1000118762	306
245	3300005438	Ga0070701_10046496	Ga0070701_100464962	306
246	3300005466	Ga0070685_10008359	Ga0070685_100083592	306
247	3300005535	Ga0070684_100007273	Ga0070684_1000072733	306
248	3300005536	Ga0070697_100006642	Ga0070697_1000066424	306
249	3300005543	Ga0070672_100025030	Ga0070672_1000250302	306
250	3300005564	Ga0070664_100023307	Ga0070664_1000233074	306
251	3300005577	Ga0068857_100000303	Ga0068857_10000030333	306
252	3300005614	Ga0068856_100034994	Ga0068856_1000349942	306
253	3300005615	Ga0070702_100051227	Ga0070702_1000512272	306
254	3300005616	Ga0068852_100008746	Ga0068852_1000087462	306
255	3300005718	Ga0068866_10002747	Ga0068866_100027472	306
256	3300005834	Ga0068851_10001168	Ga0068851_100011686	306
257	3300005840	Ga0068870_10001568	Ga0068870_100015683	306
258	3300005842	Ga0068858_100025960	Ga0068858_1000259602	306
259	3300005843	Ga0068860_100294184	Ga0068860_1002941842	306
260	3300005844	Ga0068862_100017803	Ga0068862_1000178032	306
261	3300006237	Ga0097621_100039885	Ga0097621_1000398853	306
262	3300006358	Ga0068871_100357781	Ga0068871_1003577811	306
263	3300009098	Ga0105245_10002350	Ga0105245_100023508	306
264	3300009098	Ga0105245_10175659	Ga0105245_101756592	306
265	3300009101	Ga0105247_10001813	Ga0105247_100018132	306
266	3300009174	Ga0105241_10056233	Ga0105241_100562331	306
267	3300009174	Ga0105241_10079226	Ga0105241_100792263	306
268	3300009553	Ga0105249_10044596	Ga0105249_100445962	306
269	3300010375	Ga0105239_10122035	Ga0105239_101220352	306
270	3300013100	Ga0157373_10002227	Ga0157373_1000222710	306
271	3300013102	Ga0157371_10002229	Ga0157371_1000222914	306
272	3300013105	Ga0157369_10019212	Ga0157369_100192122	306
273	3300013297	Ga0157378_10138169	Ga0157378_101381692	306
274	3300013307	Ga0157372_10003879	Ga0157372_100038792	306
275	3300013308	Ga0157375_10276558	Ga0157375_102765582	306
276	3300014325	Ga0163163_10022140	Ga0163163_100221403	306
277	3300014745	Ga0157377_10000505	Ga0157377_1000050510	306
278	3300014968	Ga0157379_10011350	Ga0157379_100113504	306
279	3300014968	Ga0157379_10031509	Ga0157379_100315092	306
280	3300014969	Ga0157376_10079305	Ga0157376_100793052	306
281	3300017792	Ga0163161_10001248	Ga0163161_100012488	306
282	3300025315	Ga0207697_10004785	Ga0207697_100047854	306
283	3300025321	Ga0207656_10070480	Ga0207656_100704802	306
284	3300025901	Ga0207688_10001143	Ga0207688_100011433	306
285	3300025904	Ga0207647_10000966	Ga0207647_1000096612	306
286	3300025907	Ga0207645_10000073	Ga0207645_1000007320	306
287	3300025908	Ga0207643_10009036	Ga0207643_100090364	306
288	3300025909	Ga0207705_10033635	Ga0207705_100336352	306
289	3300025910	Ga0207684_10001187	Ga0207684_1000118719	306
290	3300025919	Ga0207657_10000379	Ga0207657_1000037940	306
291	3300025920	Ga0207649_10002058	Ga0207649_100020582	306
292	3300025925	Ga0207650_10000045	Ga0207650_1000004553	306
293	3300025926	Ga0207659_10014302	Ga0207659_100143022	306
294	3300025931	Ga0207644_10007964	Ga0207644_100079642	306
295	3300025933	Ga0207706_10000213	Ga0207706_1000021347	306
296	3300025936	Ga0207670_10002999	Ga0207670_100029999	306
297	3300025937	Ga0207669_10135639	Ga0207669_101356392	306
298	3300025940	Ga0207691_10000556	Ga0207691_1000055618	306
299	3300025942	Ga0207689_10000780	Ga0207689_1000078016	306
300	3300025944	Ga0207661_10004371	Ga0207661_100043712	306
301	3300025945	Ga0207679_10000525	Ga0207679_1000052518	306
302	3300025949	Ga0207667_10052723	Ga0207667_100527232	306
303	3300025960	Ga0207651_10047310	Ga0207651_100473102	306
304	3300025961	Ga0207712_10005706	Ga0207712_100057062	306
305	3300025986	Ga0207658_10010574	Ga0207658_100105746	306
306	3300026023	Ga0207677_10005866	Ga0207677_100058662	306
307	3300026067	Ga0207678_10000026	Ga0207678_1000002695	306
308	3300026088	Ga0207641_10000075	Ga0207641_1000007553	306
309	3300026089	Ga0207648_10000679	Ga0207648_1000067916	306
310	3300026095	Ga0207676_10000212	Ga0207676_100002129	306
311	3300026116	Ga0207674_10000559	Ga0207674_100005599	306
312	3300026118	Ga0207675_100003469	Ga0207675_1000034696	306
313	3300026121	Ga0207683_10000438	Ga0207683_1000043816	306
314	3300028379	Ga0268266_10001444	Ga0268266_1000144413	306
315	3300028380	Ga0268265_10024102	Ga0268265_100241022	306
316	3300028381	Ga0268264_10020241	Ga0268264_100202414	306
317	3300048904	Ga0496101_0027015	Ga0496101_0027015_2869_3969	306
318	3300048904	Ga0496101_0092458	Ga0496101_0092458_356_1420	306
319	3300048905	Ga0496102_0005085	Ga0496102_0005085_6837_7901	306
320	3300048910	Ga0496107_0013984	Ga0496107_0013984_3767_4831	306
321	3300048911	Ga0496108_0000304	Ga0496108_0000304_36920_38020	306
322	3300048911	Ga0496108_0117727	Ga0496108_0117727_910_1974	306
323	3300048912	Ga0496109_0000164	Ga0496109_0000164_45907_47007	306
324	3300048913	Ga0496110_0002655	Ga0496110_0002655_807_1907	306
325	3300048914	Ga0496111_0001777	Ga0496111_0001777_4982_6082	306
326	3300048915	Ga0496112_0000078	Ga0496112_0000078_34841_35941	306
327	3300048916	Ga0496113_0009021	Ga0496113_0009021_2000_3100	306
328	3300005468	Ga0070707_100005909	Ga0070707_1000059098	307
329	3300005471	Ga0070698_100000505	Ga0070698_10000050524	307
330	3300025922	Ga0207646_10035677	Ga0207646_100356773	307
331	3300006028	Ga0070717_10128068	Ga0070717_101280682	309
332	3300025911	Ga0207654_10127098	Ga0207654_101270982	309
333	3300025919	Ga0207657_10166265	Ga0207657_101662652	309
334	3300035725	Ga0373947_0126687	Ga0373947_0126687_177_1220	309
335	3300037068	Ga0373925_0062088	Ga0373925_0062088_1422_2465	309
336	3300046684	Ga0495669_0049478	Ga0495669_0049478_652_1752	309
337	3300044673	Ga0453683_0001010	Ga0453683_0001010_11661_12623	310
338	3300044712	Ga0453684_0000153	Ga0453684_0000153_55041_56003	310
339	3300045051	Ga0451576_0000881	Ga0451576_0000881_50722_51684	310
340	3300047444	Ga0495675_0065516	Ga0495675_0065516_81_1154	312
341	3300047444	Ga0495675_0127641	Ga0495675_0127641_375_1448	312
342	3300009098	Ga0105245_10099282	Ga0105245_100992822	313
343	3300026088	Ga0207641_10208728	Ga0207641_102087282	313
344	3300028380	Ga0268265_10098622	Ga0268265_100986222	313
345	3300039450	Ga0436363_0914206	Ga0436363_0914206_655_1611	313
346	3300005436	Ga0070713_100014429	Ga0070713_1000144292	314
347	3300006237	Ga0097621_100061702	Ga0097621_1000617021	314
348	3300006358	Ga0068871_100325547	Ga0068871_1003255471	314
349	3300006871	Ga0075434_100016652	Ga0075434_1000166522	314
350	3300025928	Ga0207700_10007085	Ga0207700_100070854	314
351	3300035695	Ga0373927_0028988	Ga0373927_0028988_603_1646	314
352	3300046472	Ga0495580_0001479	Ga0495580_0001479_9373_10416	314
353	3300046472	Ga0495580_0021556	Ga0495580_0021556_2180_3223	314
354	3300046473	Ga0495582_0042511	Ga0495582_0042511_743_1786	314
355	3300048907	Ga0496104_0345216	Ga0496104_0345216_280_1320	314
356	3300050512	nmdc:mga0n895_326861_c1	nmdc:mga0n895_326861_c1_298_1338	314
357	3300005327	Ga0070658_10377172	Ga0070658_103771721	315
358	3300005339	Ga0070660_100170665	Ga0070660_1001706651	315
359	3300005434	Ga0070709_10124211	Ga0070709_101242112	315
360	3300005456	Ga0070678_100105353	Ga0070678_1001053532	315
361	3300005563	Ga0068855_100133445	Ga0068855_1001334452	315
362	3300005577	Ga0068857_100004147	Ga0068857_1000041474	315
363	3300005614	Ga0068856_100233967	Ga0068856_1002339672	315
364	3300005841	Ga0068863_100029872	Ga0068863_1000298722	315
365	3300013296	Ga0157374_10111036	Ga0157374_101110362	315
366	3300014325	Ga0163163_10055384	Ga0163163_100553842	315
367	3300025909	Ga0207705_10233950	Ga0207705_102339501	315
368	3300026095	Ga0207676_10054848	Ga0207676_100548482	315
369	3300026121	Ga0207683_10107612	Ga0207683_101076123	315
370	3300048915	Ga0496112_0025372	Ga0496112_0025372_2978_3937	315
371	3300048918	Ga0496115_0221808	Ga0496115_0221808_475_1434	315
372	3300049592	Ga0501076_0295135	Ga0501076_0295135_45_1007	315
373	3300049593	Ga0501077_0236790	Ga0501077_0236790_28_990	315
374	3300049741	Ga0501079_0165040	Ga0501079_0165040_710_1672	315
375	3300049743	Ga0501081_0017830	Ga0501081_0017830_1799_2761	315
376	3300061734	Ga0530510_0069999	Ga0530510_0069999_1433_2395	315
377	3300005335	Ga0070666_10013981	Ga0070666_100139813	316
378	3300005367	Ga0070667_100419937	Ga0070667_1004199372	316
379	3300005439	Ga0070711_100099611	Ga0070711_1000996112	316
380	3300005718	Ga0068866_10071676	Ga0068866_100716762	316
381	3300006178	Ga0075367_10051005	Ga0075367_100510052	316
382	3300006237	Ga0097621_100000989	Ga0097621_10000098911	316
383	3300006358	Ga0068871_100002642	Ga0068871_1000026421	316
384	3300009098	Ga0105245_10000739	Ga0105245_1000073922	316
385	3300009176	Ga0105242_10189533	Ga0105242_101895332	316
386	3300009551	Ga0105238_10073337	Ga0105238_100733371	316
387	3300010375	Ga0105239_10096172	Ga0105239_100961722	316
388	3300013297	Ga0157378_10000938	Ga0157378_1000093819	316
389	3300013306	Ga0163162_10002202	Ga0163162_1000220219	316
390	3300013306	Ga0163162_10044235	Ga0163162_100442352	316
391	3300014968	Ga0157379_10191740	Ga0157379_101917402	316
392	3300014969	Ga0157376_10074448	Ga0157376_100744482	316
393	3300025927	Ga0207687_10020310	Ga0207687_100203102	316
394	3300025934	Ga0207686_10014235	Ga0207686_100142352	316
395	3300025981	Ga0207640_10065238	Ga0207640_100652382	316
396	3300026023	Ga0207677_10025233	Ga0207677_100252332	316
397	3300035724	Ga0373933_0067360	Ga0373933_0067360_786_1874	316
398	3300044712	Ga0453684_0240289	Ga0453684_0240289_94_1050	316
399	3300045051	Ga0451576_0116773	Ga0451576_0116773_1109_2065	316
400	3300048906	Ga0496103_0035265	Ga0496103_0035265_981_2045	316
401	3300048907	Ga0496104_0013296	Ga0496104_0013296_1586_2650	316
402	3300048915	Ga0496112_0290788	Ga0496112_0290788_500_1564	316
403	3300048917	Ga0496114_0073051	Ga0496114_0073051_1119_2207	316
404	3300005434	Ga0070709_10014604	Ga0070709_100146042	317
405	3300005436	Ga0070713_100000037	Ga0070713_10000003753	317
406	3300005436	Ga0070713_100000200	Ga0070713_10000020037	317
407	3300005437	Ga0070710_10027504	Ga0070710_100275042	317
408	3300005437	Ga0070710_10150903	Ga0070710_101509032	317
409	3300005439	Ga0070711_100000165	Ga0070711_10000016513	317
410	3300005439	Ga0070711_100029249	Ga0070711_1000292491	317
411	3300005445	Ga0070708_100005233	Ga0070708_1000052336	317
412	3300005467	Ga0070706_100007573	Ga0070706_1000075732	317
413	3300005467	Ga0070706_100011789	Ga0070706_1000117893	317
414	3300005468	Ga0070707_100004527	Ga0070707_1000045273	317
415	3300005471	Ga0070698_100011968	Ga0070698_1000119685	317
416	3300005471	Ga0070698_100085094	Ga0070698_1000850942	317
417	3300005518	Ga0070699_100000976	Ga0070699_1000009764	317
418	3300005536	Ga0070697_100000024	Ga0070697_10000002483	317
419	3300005536	Ga0070697_100000337	Ga0070697_10000033728	317
420	3300005536	Ga0070697_100019401	Ga0070697_1000194013	317
421	3300006028	Ga0070717_10007542	Ga0070717_100075422	317
422	3300006173	Ga0070716_100002303	Ga0070716_1000023032	317
423	3300006173	Ga0070716_100050334	Ga0070716_1000503342	317
424	3300006173	Ga0070716_100057143	Ga0070716_1000571432	317
425	3300006173	Ga0070716_100140313	Ga0070716_1001403132	317
426	3300006175	Ga0070712_100000010	Ga0070712_10000001025	317
427	3300006175	Ga0070712_100086468	Ga0070712_1000864682	317
428	3300009147	Ga0114129_10211926	Ga0114129_102119262	317
429	3300025898	Ga0207692_10013899	Ga0207692_100138993	317
430	3300025898	Ga0207692_10099226	Ga0207692_100992262	317
431	3300025906	Ga0207699_10000400	Ga0207699_1000040014	317
432	3300025910	Ga0207684_10001148	Ga0207684_1000114819	317
433	3300025910	Ga0207684_10050705	Ga0207684_100507052	317
434	3300025915	Ga0207693_10000004	Ga0207693_1000000449	317
435	3300025915	Ga0207693_10000051	Ga0207693_1000005168	317
436	3300025915	Ga0207693_10030353	Ga0207693_100303532	317
437	3300025916	Ga0207663_10000233	Ga0207663_1000023313	317
438	3300025916	Ga0207663_10039689	Ga0207663_100396891	317
439	3300025922	Ga0207646_10000855	Ga0207646_1000085527	317
440	3300025928	Ga0207700_10000100	Ga0207700_1000010024	317
441	3300025928	Ga0207700_10000468	Ga0207700_100004685	317
442	3300025939	Ga0207665_10004141	Ga0207665_100041415	317
443	3300025939	Ga0207665_10011218	Ga0207665_100112184	317
444	3300025939	Ga0207665_10035055	Ga0207665_100350552	317
445	3300025939	Ga0207665_10097431	Ga0207665_100974312	317
446	3300028800	Ga0265338_10011968	Ga0265338_100119684	317
447	3300028800	Ga0265338_10051219	Ga0265338_100512192	317
448	3300031241	Ga0265325_10013998	Ga0265325_100139982	317
449	3300031249	Ga0265339_10039900	Ga0265339_100399001	317
450	3300035111	Ga0373923_0025096	Ga0373923_0025096_984_1940	317
451	3300035692	Ga0373935_0037910	Ga0373935_0037910_82_1038	317
452	3300035695	Ga0373927_0075200	Ga0373927_0075200_640_1596	317
453	3300044712	Ga0453684_0320640	Ga0453684_0320640_645_1631	317
454	3300045051	Ga0451576_0038187	Ga0451576_0038187_2493_3479	317
455	3300046455	Ga0495603_0014690	Ga0495603_0014690_241_1227	317
456	3300046472	Ga0495580_0000055	Ga0495580_0000055_19132_20088	317
457	3300046472	Ga0495580_0044678	Ga0495580_0044678_606_1670	317
458	3300046472	Ga0495580_0136328	Ga0495580_0136328_649_1605	317
459	3300046473	Ga0495582_0003638	Ga0495582_0003638_4992_5948	317
460	3300046499	Ga0495594_0013218	Ga0495594_0013218_2658_3644	317
461	3300046529	Ga0495652_0184454	Ga0495652_0184454_29_985	317
462	3300046681	Ga0495647_0078755	Ga0495647_0078755_285_1241	317
463	3300046683	Ga0495658_0005753	Ga0495658_0005753_2196_3152	317
464	3300046683	Ga0495658_0060757	Ga0495658_0060757_978_1964	317
465	3300047319	Ga0495674_0011317	Ga0495674_0011317_2856_3812	317
466	3300047321	Ga0495676_0083678	Ga0495676_0083678_119_1105	317
467	3300048907	Ga0496104_0028729	Ga0496104_0028729_1391_2347	317
468	3300048918	Ga0496115_0001265	Ga0496115_0001265_10361_11317	317
469	3300053077	Ga0495601_0035050	Ga0495601_0035050_1609_2565	317
470	3300000546	LJNas_1000739	LJNas_10007394	318
471	3300005336	Ga0070680_100241087	Ga0070680_1002410871	318
472	3300005434	Ga0070709_10168954	Ga0070709_101689542	318
473	3300005437	Ga0070710_10009439	Ga0070710_100094392	318
474	3300005437	Ga0070710_10103278	Ga0070710_101032781	318
475	3300005439	Ga0070711_100002411	Ga0070711_1000024118	318
476	3300005445	Ga0070708_100006276	Ga0070708_1000062762	318
477	3300005445	Ga0070708_100038693	Ga0070708_1000386931	318
478	3300005467	Ga0070706_100000677	Ga0070706_10000067710	318
479	3300005468	Ga0070707_100158213	Ga0070707_1001582132	318
480	3300005471	Ga0070698_100264887	Ga0070698_1002648871	318
481	3300005518	Ga0070699_100007792	Ga0070699_1000077929	318
482	3300005518	Ga0070699_100095051	Ga0070699_1000950511	318
483	3300005536	Ga0070697_100000087	Ga0070697_10000008729	318
484	3300005536	Ga0070697_100079385	Ga0070697_1000793852	318
485	3300005536	Ga0070697_100119712	Ga0070697_1001197122	318
486	3300005841	Ga0068863_100323491	Ga0068863_1003234912	318
487	3300006173	Ga0070716_100055667	Ga0070716_1000556672	318
488	3300006175	Ga0070712_100000648	Ga0070712_10000064819	318
489	3300006914	Ga0075436_100004275	Ga0075436_1000042757	318
490	3300006914	Ga0075436_100017413	Ga0075436_1000174134	318
491	3300009093	Ga0105240_10045155	Ga0105240_100451552	318
492	3300014497	Ga0182008_10011803	Ga0182008_100118032	318
493	3300015262	Ga0182007_10006474	Ga0182007_100064742	318
494	3300022734	Ga0224571_100091	Ga0224571_1000912	318
495	3300024225	Ga0224572_1004305	Ga0224572_10043051	318
496	3300024227	Ga0228598_1000604	Ga0228598_10006042	318
497	3300024227	Ga0228598_1002797	Ga0228598_10027973	318
498	3300025905	Ga0207685_10005935	Ga0207685_100059352	318
499	3300025910	Ga0207684_10003549	Ga0207684_1000354913	318
500	3300025915	Ga0207693_10002761	Ga0207693_100027612	318
501	3300025916	Ga0207663_10000386	Ga0207663_100003864	318
502	3300025922	Ga0207646_10038511	Ga0207646_100385113	318
503	3300025928	Ga0207700_10122385	Ga0207700_101223851	318
504	3300025928	Ga0207700_10338543	Ga0207700_103385432	318
505	3300025939	Ga0207665_10021576	Ga0207665_100215761	318
506	3300031235	Ga0265330_10004187	Ga0265330_100041872	318
507	3300031242	Ga0265329_10032850	Ga0265329_100328502	318
508	3300031249	Ga0265339_10014492	Ga0265339_100144922	318
509	3300031249	Ga0265339_10025552	Ga0265339_100255522	318
510	3300031344	Ga0265316_10026224	Ga0265316_100262244	318
511	3300031711	Ga0265314_10038866	Ga0265314_100388664	318
512	3300037418	Ga0395900_0206387	Ga0395900_0206387_805_1761	318
513	3300037471	Ga0395905_0013001	Ga0395905_0013001_1572_2528	318
514	3300037471	Ga0395905_0034022	Ga0395905_0034022_2931_3887	318
515	3300037471	Ga0395905_0065731	Ga0395905_0065731_1035_1991	318
516	3300037471	Ga0395905_0153080	Ga0395905_0153080_997_1956	318
517	3300037471	Ga0395905_0438606	Ga0395905_0438606_80_1039	318
518	3300038443	Ga0395901_0459611	Ga0395901_0459611_260_1216	318
519	3300039453	Ga0436362_0232201	Ga0436362_0232201_89_1045	318
520	3300045836	Ga0466958_0036566	Ga0466958_0036566_714_1670	318
521	3300045976	Ga0466967_0185930	Ga0466967_0185930_871_1827	318
522	3300046472	Ga0495580_0012233	Ga0495580_0012233_1739_2845	318
523	3300048915	Ga0496112_0031823	Ga0496112_0031823_3389_4441	318
524	3300048916	Ga0496113_0131370	Ga0496113_0131370_104_1156	318
525	3300049589	Ga0501073_0132156	Ga0501073_0132156_239_1270	318
526	3300050514	nmdc:mga08x19_11565_c1	nmdc:mga08x19_11565_c1_1757_2713	318
527	3300050514	nmdc:mga08x19_8005_c1	nmdc:mga08x19_8005_c1_3961_5064	318
528	3300050514	nmdc:mga08x19_89252_c1	nmdc:mga08x19_89252_c1_214_1170	318
529	3300054114	Ga0501084_0039432	Ga0501084_0039432_2579_3622	318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

67

367

0.95 PF01039

Carboxyl_trans

Carboxyl transferase domain

74

334

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5kdr-assembly1.cif.gz_A-2	the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b.	0.9287	11	315
2f9i-assembly1.cif.gz_A	crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus	0.9257	7	315
5kdr-assembly1.cif.gz_A-2	the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b.	0.9051	11	315
2f9i-assembly1.cif.gz_C	crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus	0.9018	14	315
2f9i-assembly1.cif.gz_A	crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus	0.8944	7	315

ID	Description	Score	Start	End	Superfamily
af_A0A5K1K961_17_218_1.20.1270.60	Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain	0.9597	5	48	1.20.1270.60
af_E7F084_1008_1283_2.60.210.10	Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A	0.9443	5	48	2.60.210.10
af_P9WQH9_238_492_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9255	53	311	3.90.226.10
af_Q2FXM7_1_314_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9153	7	315	3.90.226.10
af_P9WQH9_238_492_3.90.226.10	Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1	0.9082	53	311	3.90.226.10

ID	Description	Score	Start	End	GO Terms
AF-A0A8B4PGA1-F1-model_v4	deleted	0.9705	129	311
AF-A0A2N4YQW4-F1-model_v4	acetyl-CoA carboxytransferase (EC 2.1.3.15)	0.9665	161	310	GO:0003989 GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295
AF-A0A3B9P3H2-F1-model_v4	acetyl-CoA carboxytransferase (EC 2.1.3.15)	0.9651	127	311	GO:0003989 GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295
AF-A0A428MBL3-F1-model_v4	deleted	0.9645	52	309
AF-A0A3D3T1R0-F1-model_v4	acetyl-CoA carboxytransferase (EC 2.1.3.15)	0.9635	164	310	GO:0003989 GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295

Feature Viewer

pLDDT	pTM	Quality
88.67	0.81	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459769

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

67

367

0.95

PF01039

Carboxyl_trans

Carboxyl transferase domain

74

334

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map