F459761

General Info

Members Datasets Scaffolds Average Seq Length
529 212 529 266

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100013722|Ga0070680_1000137226
Length 319
Sequence VLDQRDDVGWSLGNGYGSGDNAIHPGTFCVGGADAGIGQEHTSNLTPMNHNVKLRSSMARAQLIHIEVDRRLGHEWDEWNGRPLPGGGDFSAPPGLFFRFAALTIVAATAAIALLLYLIGPRLRGLWRPLPSVQWIALATLAALSALYLGVLAVSYYSGRNLLPERLMERGLYLKLMNYTSLVARAFGKRDWVEHAAIDVYNTLALRRGRKVGKGELLVLIPRCLSKQALDGVLEIAGRYDVPVFVATRGQLARRVIRERRPRAVVAVACERDMMTGLRDVAGKLPVLGLTMQLPNGPCRDAAIDLEQMEKWVQGLVAS

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
186 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
192 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
195 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
196 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.48
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10002532 3300005328 Bacteria 9387
2 Ga0070676_10048358 3300005328 Bacteria 2487
3 Ga0070666_10035337 3300005335 Bacteria 3315
4 Ga0070680_100013722 3300005336 Bacteria 6319
5 Ga0070680_100107096 3300005336 Bacteria 2325
6 Ga0070682_100206883 3300005337 Bacteria 1388
7 Ga0070691_10195046 3300005341 Unclassified 1061
8 Ga0070692_10026896 3300005345 Bacteria 2848
9 Ga0070668_100086996 3300005347 Bacteria 2458
10 Ga0070675_100036121 3300005354 Bacteria 4019
11 Ga0070674_100036668 3300005356 Bacteria 3293
12 Ga0070674_100454150 3300005356 Unclassified 1058
13 Ga0070673_100072902 3300005364 Unclassified 2763
14 Ga0070659_100056844 3300005366 Bacteria 3085
15 Ga0070659_100070129 3300005366 Bacteria 2784
16 Ga0070703_10025939 3300005406 Unclassified 1740
17 Ga0070703_10026224 3300005406 Unclassified 1731
18 Ga0070703_10028683 3300005406 Unclassified 1665
19 Ga0070709_10003102 3300005434 Bacteria 8925
20 Ga0070709_10017764 3300005434 Bacteria 4086
21 Ga0070711_100001898 3300005439 Bacteria 11680
22 Ga0070711_100002205 3300005439 Bacteria 11056
23 Ga0070711_100053078 3300005439 Bacteria 2792
24 Ga0070705_100001793 3300005440 Bacteria 11099
25 Ga0070705_100008530 3300005440 Bacteria 5077
26 Ga0070705_100018358 3300005440 Bacteria 3666
27 Ga0070705_100020056 3300005440 Bacteria 3530
28 Ga0070705_100021224 3300005440 Bacteria 3451
29 Ga0070705_100022616 3300005440 Bacteria 3362
30 Ga0070705_100035077 3300005440 Unclassified 2810
31 Ga0070700_100089077 3300005441 Bacteria 2010
32 Ga0070694_100000422 3300005444 Bacteria 23097
33 Ga0070694_100000715 3300005444 Bacteria 18468
34 Ga0070694_100004198 3300005444 Bacteria 8657
35 Ga0070694_100039579 3300005444 Bacteria 3139
36 Ga0070694_100061439 3300005444 Bacteria 2564
37 Ga0070694_100065555 3300005444 Unclassified 2488
38 Ga0070694_100083417 3300005444 Unclassified 2227
39 Ga0070694_100115070 3300005444 Unclassified 1921
40 Ga0070694_100125323 3300005444 Bacteria 1848
41 Ga0070694_100271195 3300005444 Bacteria 1291
42 Ga0070708_100003522 3300005445 Bacteria 12259
43 Ga0070708_100005882 3300005445 Bacteria 9741
44 Ga0070708_100007309 3300005445 Bacteria 8839
45 Ga0070708_100038270 3300005445 Bacteria 4191
46 Ga0070708_100100223 3300005445 Bacteria 2651
47 Ga0070708_100103702 3300005445 Bacteria 2608
48 Ga0070708_100455111 3300005445 Unclassified 1207
49 Ga0070708_100855185 3300005445 Unclassified 854
50 Ga0070663_100320789 3300005455 Unclassified 1246
51 Ga0070678_100004832 3300005456 Bacteria 7694
52 Ga0070678_100307052 3300005456 Unclassified 1350
53 Ga0070662_100002098 3300005457 Bacteria 12226
54 Ga0070662_100322427 3300005457 Bacteria 1260
55 Ga0070662_100731273 3300005457 Unclassified 838
56 Ga0070681_10055606 3300005458 Bacteria 3940
57 Ga0070681_10241276 3300005458 Unclassified 1721
58 Ga0070681_10355875 3300005458 Bacteria 1374
59 Ga0068867_100003981 3300005459 Bacteria 10392
60 Ga0068867_100066755 3300005459 Bacteria 2680
61 Ga0070706_100016983 3300005467 Bacteria 6722
62 Ga0070706_100068695 3300005467 Bacteria 3277
63 Ga0070706_100093243 3300005467 Bacteria 2794
64 Ga0070706_100510090 3300005467 Bacteria 1119
65 Ga0070707_100001143 3300005468 Bacteria 26117
66 Ga0070707_100020889 3300005468 Bacteria 6181
67 Ga0070707_100033568 3300005468 Bacteria 4893
68 Ga0070707_100053016 3300005468 Bacteria 3888
69 Ga0070707_100057462 3300005468 Bacteria 3732
70 Ga0070707_100070461 3300005468 Bacteria 3367
71 Ga0070707_100080686 3300005468 Bacteria 3140
72 Ga0070707_100081876 3300005468 Bacteria 3117
73 Ga0070707_100247169 3300005468 Unclassified 1736
74 Ga0070707_100340598 3300005468 Bacteria 1457
75 Ga0070698_100000438 3300005471 Bacteria 44134
76 Ga0070698_100036124 3300005471 Bacteria 5107
77 Ga0070698_100052499 3300005471 Unclassified 4147
78 Ga0070698_100086726 3300005471 Bacteria 3117
79 Ga0070698_100207035 3300005471 Bacteria 1897
80 Ga0070698_100234820 3300005471 Bacteria 1767
81 Ga0070698_100236104 3300005471 Bacteria 1761
82 Ga0070699_100000017 3300005518 Bacteria 201366
83 Ga0070699_100003578 3300005518 Bacteria 13740
84 Ga0070699_100012572 3300005518 Bacteria 7301
85 Ga0070699_100023409 3300005518 Bacteria 5320
86 Ga0070699_100038971 3300005518 Bacteria 4114
87 Ga0070699_100060537 3300005518 Bacteria 3281
88 Ga0070699_100101885 3300005518 Bacteria 2517
89 Ga0070699_100112187 3300005518 Bacteria 2395
90 Ga0070699_100127965 3300005518 Bacteria 2237
91 Ga0070699_100132650 3300005518 Bacteria 2196
92 Ga0070699_100135617 3300005518 Bacteria 2171
93 Ga0070699_100452714 3300005518 Bacteria 1164
94 Ga0070679_100025810 3300005530 Bacteria 5766
95 Ga0070679_100073411 3300005530 Bacteria 3413
96 Ga0070697_100012678 3300005536 Bacteria 6604
97 Ga0070697_100016658 3300005536 Bacteria 5782
98 Ga0070697_100141260 3300005536 Bacteria 2025
99 Ga0070697_100178657 3300005536 Unclassified 1799
100 Ga0070697_100179383 3300005536 Bacteria 1795
101 Ga0070697_100184830 3300005536 Unclassified 1768
102 Ga0070697_100193605 3300005536 Bacteria 1726
103 Ga0070697_100236710 3300005536 Unclassified 1558
104 Ga0068853_100206522 3300005539 Bacteria 1789
105 Ga0070672_100157380 3300005543 Bacteria 1882
106 Ga0070695_100006811 3300005545 Bacteria 6765
107 Ga0070695_100008791 3300005545 Bacteria 6002
108 Ga0070695_100010591 3300005545 Bacteria 5511
109 Ga0070695_100017735 3300005545 Bacteria 4319
110 Ga0070695_100040744 3300005545 Bacteria 2942
111 Ga0070695_100080016 3300005545 Unclassified 2158
112 Ga0070695_100109758 3300005545 Bacteria 1870
113 Ga0070695_100247892 3300005545 Bacteria 1295
114 Ga0070696_100000782 3300005546 Bacteria 20460
115 Ga0070696_100003742 3300005546 Bacteria 10159
116 Ga0070696_100007271 3300005546 Bacteria 7391
117 Ga0070696_100012759 3300005546 Bacteria 5641
118 Ga0070696_100019489 3300005546 Bacteria 4593
119 Ga0070696_100039396 3300005546 Bacteria 3263
120 Ga0070696_100078107 3300005546 Unclassified 2340
121 Ga0070696_100156910 3300005546 Bacteria 1674
122 Ga0070693_100022046 3300005547 Bacteria 3381
123 Ga0070693_100208081 3300005547 Bacteria 1275
124 Ga0070704_100001062 3300005549 Bacteria 14224
125 Ga0070704_100002251 3300005549 Bacteria 10772
126 Ga0070704_100006257 3300005549 Bacteria 7004
127 Ga0070704_100007539 3300005549 Bacteria 6479
128 Ga0070704_100009746 3300005549 Bacteria 5823
129 Ga0070704_100013911 3300005549 Bacteria 5012
130 Ga0070704_100020882 3300005549 Bacteria 4234
131 Ga0070704_100022608 3300005549 Unclassified 4094
132 Ga0070704_100023968 3300005549 Bacteria 3997
133 Ga0070704_100118374 3300005549 Bacteria 2029
134 Ga0070664_100109473 3300005564 Bacteria 2410
135 Ga0070664_100110595 3300005564 Bacteria 2398
136 Ga0068854_100004324 3300005578 Bacteria 8950
137 Ga0070702_100004601 3300005615 Bacteria 6320
138 Ga0070702_100034936 3300005615 Bacteria 2774
139 Ga0068852_100350771 3300005616 Bacteria 1441
140 Ga0068859_100060413 3300005617 Bacteria 3819
141 Ga0068859_100368030 3300005617 Bacteria 1533
142 Ga0068859_100432207 3300005617 Bacteria 1413
143 Ga0068864_100468739 3300005618 Bacteria 1207
144 Ga0068866_10000162 3300005718 Bacteria 30927
145 Ga0068866_10095824 3300005718 Unclassified 1626
146 Ga0068861_100065029 3300005719 Bacteria 2808
147 Ga0068861_100071676 3300005719 Bacteria 2686
148 Ga0068863_100012080 3300005841 Bacteria 8342
149 Ga0068858_100043138 3300005842 Bacteria 4182
150 Ga0068860_100081414 3300005843 Bacteria 3079
151 Ga0068860_100120296 3300005843 Bacteria 2514
152 Ga0068862_100071942 3300005844 Bacteria 2986
153 Ga0068862_100663139 3300005844 Bacteria 1007
154 Ga0081455_10013309 3300005937 Bacteria 8142
155 Ga0070716_100103784 3300006173 Unclassified 1749
156 Ga0070716_100125086 3300006173 Bacteria 1616
157 Ga0070712_100042324 3300006175 Unclassified 3132
158 Ga0097621_100099666 3300006237 Bacteria 2442
159 Ga0068871_100750896 3300006358 Unclassified 897
160 Ga0075428_100003541 3300006844 Bacteria 17102
161 Ga0075428_100012452 3300006844 Bacteria 9459
162 Ga0075428_100293735 3300006844 Unclassified 1748
163 Ga0075428_100306488 3300006844 Bacteria 1707
164 Ga0075430_100023884 3300006846 Bacteria 5206
165 Ga0075430_100143369 3300006846 Bacteria 1989
166 Ga0075430_100625597 3300006846 Bacteria 888
167 Ga0075431_100004957 3300006847 Bacteria 13102
168 Ga0075431_100065160 3300006847 Bacteria 3762
169 Ga0075431_100075369 3300006847 Bacteria 3481
170 Ga0075433_10001211 3300006852 Bacteria 18816
171 Ga0075433_10006069 3300006852 Bacteria 9522
172 Ga0075433_10009500 3300006852 Bacteria 7771
173 Ga0075433_10057773 3300006852 Bacteria 3392
174 Ga0075433_10074047 3300006852 Bacteria 2996
175 Ga0075433_10095147 3300006852 Bacteria 2636
176 Ga0075433_10110164 3300006852 Unclassified 2443
177 Ga0075434_100006336 3300006871 Bacteria 10849
178 Ga0075434_100008345 3300006871 Bacteria 9627
179 Ga0075434_100015558 3300006871 Bacteria 7301
180 Ga0075434_100190664 3300006871 Bacteria 2070
181 Ga0075434_100360316 3300006871 Bacteria 1475
182 Ga0075429_100012406 3300006880 Bacteria 7392
183 Ga0075429_100023165 3300006880 Bacteria 5385
184 Ga0075429_100270642 3300006880 Unclassified 1488
185 Ga0075429_100342434 3300006880 Bacteria 1309
186 Ga0068865_100001883 3300006881 Bacteria 12336
187 Ga0068865_100075783 3300006881 Bacteria 2399
188 Ga0075436_100001523 3300006914 Bacteria 15811
189 Ga0075436_100004772 3300006914 Bacteria 9309
190 Ga0075436_100005815 3300006914 Bacteria 8467
191 Ga0075436_100064730 3300006914 Bacteria 2527
192 Ga0075436_100091805 3300006914 Bacteria 2111
193 Ga0075436_100114654 3300006914 Bacteria 1882
194 Ga0075436_100138233 3300006914 Bacteria 1711
195 Ga0075436_100172572 3300006914 Bacteria 1527
196 Ga0075436_100258132 3300006914 Unclassified 1242
197 Ga0097620_100060413 3300006931 Bacteria 3819
198 Ga0097620_100368051 3300006931 Bacteria 1533
199 Ga0097620_100432235 3300006931 Bacteria 1413
200 Ga0075435_100155941 3300007076 Unclassified 1921
201 Ga0075435_100317303 3300007076 Bacteria 1334
202 Ga0075435_100415346 3300007076 Unclassified 1158
203 Ga0099794_10000006 3300007265 Bacteria 130517
204 Ga0099794_10018376 3300007265 Unclassified 3134
205 Ga0105240_10096739 3300009093 Bacteria 3597
206 Ga0111539_10459788 3300009094 Bacteria 1482
207 Ga0111539_10573973 3300009094 Bacteria 1314
208 Ga0111539_11218153 3300009094 Bacteria 874
209 Ga0105245_10232427 3300009098 Bacteria 1784
210 Ga0114129_10000596 3300009147 Bacteria 44594
211 Ga0114129_10020622 3300009147 Bacteria 9370
212 Ga0114129_10059112 3300009147 Bacteria 5360
213 Ga0114129_10080448 3300009147 Bacteria 4529
214 Ga0114129_10288433 3300009147 Bacteria 2191
215 Ga0114129_10621233 3300009147 Unclassified 1398
216 Ga0114129_10700340 3300009147 Bacteria 1302
217 Ga0114129_10868586 3300009147 Bacteria 1145
218 Ga0105243_10006593 3300009148 Bacteria 8967
219 Ga0105241_10131060 3300009174 Bacteria 2030
220 Ga0105242_10088942 3300009176 Bacteria 2595
221 Ga0105248_10004746 3300009177 Bacteria 15049
222 Ga0105248_10153825 3300009177 Bacteria 2595
223 Ga0105248_10155375 3300009177 Unclassified 2581
224 Ga0105248_10287670 3300009177 Bacteria 1851
225 Ga0105249_10068419 3300009553 Bacteria 3275
226 Ga0105249_10080883 3300009553 Bacteria 3019
227 Ga0105239_10391139 3300010375 Bacteria 1573
228 Ga0157371_10068091 3300013102 Bacteria 2519
229 Ga0157378_10000489 3300013297 Bacteria 37509
230 Ga0163162_10099364 3300013306 Bacteria 3001
231 Ga0163162_10112124 3300013306 Bacteria 2826
232 Ga0157372_10156599 3300013307 Bacteria 2632
233 Ga0157375_10041058 3300013308 Bacteria 4465
234 Ga0157375_10098096 3300013308 Bacteria 3006
235 Ga0163163_10065097 3300014325 Bacteria 3617
236 Ga0157379_10031115 3300014968 Bacteria 4754
237 Ga0157379_10040410 3300014968 Bacteria 4163
238 Ga0157379_10194271 3300014968 Bacteria 1834
239 Ga0157376_10702457 3300014969 Bacteria 1016
240 Ga0207653_10000039 3300025885 Bacteria 98540
241 Ga0207653_10045870 3300025885 Bacteria 1444
242 Ga0207642_10016994 3300025899 Bacteria 2756
243 Ga0207699_10011498 3300025906 Unclassified 4473
244 Ga0207645_10009047 3300025907 Bacteria 6912
245 Ga0207684_10024190 3300025910 Bacteria 5180
246 Ga0207684_10024609 3300025910 Bacteria 5133
247 Ga0207684_10054876 3300025910 Unclassified 3381
248 Ga0207684_10113636 3300025910 Bacteria 2318
249 Ga0207684_10130894 3300025910 Unclassified 2153
250 Ga0207684_10143210 3300025910 Bacteria 2056
251 Ga0207707_10003433 3300025912 Bacteria 14056
252 Ga0207707_10276070 3300025912 Unclassified 1456
253 Ga0207695_10212021 3300025913 Bacteria 1847
254 Ga0207693_10216023 3300025915 Unclassified 1507
255 Ga0207663_10004104 3300025916 Bacteria 7220
256 Ga0207663_10072040 3300025916 Bacteria 2232
257 Ga0207660_10063105 3300025917 Bacteria 2670
258 Ga0207660_10131327 3300025917 Bacteria 1907
259 Ga0207660_10177086 3300025917 Bacteria 1654
260 Ga0207652_10010866 3300025921 Bacteria 7336
261 Ga0207652_10024223 3300025921 Bacteria 5034
262 Ga0207646_10003946 3300025922 Bacteria 16451
263 Ga0207646_10005811 3300025922 Bacteria 12915
264 Ga0207646_10006611 3300025922 Bacteria 11969
265 Ga0207646_10014155 3300025922 Bacteria 7585
266 Ga0207646_10015171 3300025922 Bacteria 7289
267 Ga0207646_10071120 3300025922 Bacteria 3107
268 Ga0207646_10092695 3300025922 Bacteria 2704
269 Ga0207646_10228304 3300025922 Bacteria 1682
270 Ga0207646_10259494 3300025922 Unclassified 1570
271 Ga0207646_10286207 3300025922 Bacteria 1489
272 Ga0207659_10049626 3300025926 Bacteria 2978
273 Ga0207700_10191447 3300025928 Bacteria 1719
274 Ga0207690_10041795 3300025932 Bacteria 3007
275 Ga0207690_10126440 3300025932 Bacteria 1865
276 Ga0207706_10001874 3300025933 Bacteria 20609
277 Ga0207706_10030452 3300025933 Bacteria 4813
278 Ga0207706_10134527 3300025933 Bacteria 2174
279 Ga0207686_10001992 3300025934 Bacteria 11253
280 Ga0207709_10023137 3300025935 Bacteria 3533
281 Ga0207669_10088257 3300025937 Bacteria 2010
282 Ga0207704_10018151 3300025938 Bacteria 3666
283 Ga0207665_10005019 3300025939 Bacteria 8833
284 Ga0207665_10015849 3300025939 Bacteria 4947
285 Ga0207665_10164014 3300025939 Bacteria 1600
286 Ga0207691_10061910 3300025940 Bacteria 3398
287 Ga0207711_10050853 3300025941 Unclassified 3549
288 Ga0207711_10071410 3300025941 Bacteria 3012
289 Ga0207689_10001812 3300025942 Bacteria 20170
290 Ga0207651_10045036 3300025960 Unclassified 2957
291 Ga0207712_10023746 3300025961 Bacteria 4051
292 Ga0207640_10031008 3300025981 Bacteria 3299
293 Ga0207640_10544158 3300025981 Unclassified 974
294 Ga0207678_10332536 3300026067 Bacteria 1308
295 Ga0207708_10101587 3300026075 Bacteria 2226
296 Ga0207641_10026080 3300026088 Bacteria 4822
297 Ga0207641_10052044 3300026088 Bacteria 3467
298 Ga0207648_10054502 3300026089 Bacteria 3492
299 Ga0207648_10692376 3300026089 Unclassified 944
300 Ga0207676_10248538 3300026095 Bacteria 1600
301 Ga0207676_10538118 3300026095 Bacteria 1114
302 Ga0207675_100027615 3300026118 Bacteria 5286
303 Ga0207675_100517488 3300026118 Bacteria 1189
304 Ga0207683_10010959 3300026121 Bacteria 7731
305 Ga0209588_1000174 3300027671 Bacteria 18110
306 Ga0209588_1009449 3300027671 Unclassified 2915
307 Ga0209588_1021135 3300027671 Unclassified 2042
308 Ga0207428_10103366 3300027907 Bacteria 2199
309 Ga0268265_10048914 3300028380 Bacteria 3177
310 Ga0268264_10081558 3300028381 Bacteria 2765
311 Ga0307408_100032932 3300031548 Bacteria 3617
312 Ga0307408_100075741 3300031548 Unclassified 2501
313 Ga0307408_100277665 3300031548 Bacteria 1394
314 Ga0307408_100299142 3300031548 Bacteria 1347
315 Ga0307405_10357900 3300031731 Bacteria 1128
316 Ga0307413_10013993 3300031824 Bacteria 4058
317 Ga0307413_10016091 3300031824 Bacteria 3852
318 Ga0307413_10089965 3300031824 Bacteria 1996
319 Ga0307413_10189049 3300031824 Unclassified 1476
320 Ga0307413_10258584 3300031824 Bacteria 1296
321 Ga0307410_10021783 3300031852 Bacteria 3948
322 Ga0307410_10028598 3300031852 Bacteria 3539
323 Ga0307410_10036711 3300031852 Bacteria 3194
324 Ga0307410_10048100 3300031852 Bacteria 2854
325 Ga0307410_10122157 3300031852 Bacteria 1901
326 Ga0307410_10144885 3300031852 Bacteria 1762
327 Ga0307410_10603061 3300031852 Unclassified 916
328 Ga0307406_10022274 3300031901 Bacteria 3757
329 Ga0307406_10056482 3300031901 Unclassified 2514
330 Ga0307406_10087000 3300031901 Bacteria 2094
331 Ga0307406_10321280 3300031901 Bacteria 1197
332 Ga0307407_10022152 3300031903 Bacteria 3291
333 Ga0307407_10041726 3300031903 Bacteria 2568
334 Ga0307407_10104928 3300031903 Bacteria 1762
335 Ga0307407_10183800 3300031903 Bacteria 1387
336 Ga0307407_10196007 3300031903 Unclassified 1350
337 Ga0307412_10048170 3300031911 Bacteria 2802
338 Ga0307412_10097506 3300031911 Bacteria 2071
339 Ga0307409_100004097 3300031995 Bacteria 8112
340 Ga0307409_100008683 3300031995 Bacteria 6185
341 Ga0307409_100088786 3300031995 Bacteria 2525
342 Ga0307409_100096196 3300031995 Bacteria 2442
343 Ga0307409_100103641 3300031995 Unclassified 2367
344 Ga0307416_100026899 3300032002 Bacteria 4248
345 Ga0307416_100074240 3300032002 Bacteria 2840
346 Ga0307416_100264245 3300032002 Bacteria 1684
347 Ga0307416_100290100 3300032002 Unclassified 1619
348 Ga0307416_100323205 3300032002 Bacteria 1546
349 Ga0307416_100497329 3300032002 Unclassified 1283
350 Ga0307416_100741621 3300032002 Unclassified 1074
351 Ga0307414_10016817 3300032004 Bacteria 4460
352 Ga0307414_10102458 3300032004 Bacteria 2157
353 Ga0307414_10251910 3300032004 Unclassified 1468
354 Ga0307414_10260187 3300032004 Bacteria 1448
355 Ga0307411_10000458 3300032005 Bacteria 14073
356 Ga0307411_10036177 3300032005 Unclassified 3091
357 Ga0307411_10053038 3300032005 Bacteria 2654
358 Ga0307411_10075876 3300032005 Bacteria 2296
359 Ga0307411_10091870 3300032005 Bacteria 2121
360 Ga0307415_100001211 3300032126 Bacteria 12106
361 Ga0307415_100066823 3300032126 Bacteria 2511
362 Ga0307415_100691491 3300032126 Bacteria 919
363 Ga0373931_0012661 3300035691 Bacteria 4091
364 Ga0373931_0085446 3300035691 Unclassified 1749
365 Ga0395905_0136790 3300037471 Bacteria 2305
366 Ga0439454_022698 3300042011 Bacteria 937
367 Ga0439446_0003258 3300042156 Bacteria 4007
368 Ga0439446_0024405 3300042156 Bacteria 1725
369 Ga0439446_0031353 3300042156 Bacteria 1538
370 Ga0453683_0019207 3300044673 Bacteria 4378
371 Ga0453684_0669916 3300044712 Unclassified 1130
372 Ga0451576_0052930 3300045051 Bacteria 4253
373 Ga0451576_0071111 3300045051 Unclassified 3621
374 Ga0451576_0161317 3300045051 Bacteria 2340
375 Ga0451576_0170066 3300045051 Bacteria 2274
376 Ga0495603_0030886 3300046455 Unclassified 3226
377 Ga0495603_0145592 3300046455 Bacteria 1377
378 Ga0495580_0026814 3300046472 Bacteria 4197
379 Ga0495594_0079934 3300046499 Bacteria 1825
380 Ga0495663_0005526 3300046525 Unclassified 3508
381 Ga0495609_0014486 3300046538 Unclassified 3705
382 Ga0495636_0036747 3300047318 Bacteria 2021
383 Ga0495677_0026939 3300047445 Bacteria 2085
384 Ga0496101_0178479 3300048904 Bacteria 1634
385 Ga0496101_0604284 3300048904 Unclassified 867
386 Ga0496102_0015023 3300048905 Bacteria 6739
387 Ga0496102_0018257 3300048905 Bacteria 6161
388 Ga0496102_0050191 3300048905 Bacteria 3798
389 Ga0496103_0020565 3300048906 Bacteria 3966
390 Ga0496104_0002198 3300048907 Bacteria 16879
391 Ga0496104_0040491 3300048907 Bacteria 4367
392 Ga0496104_0076028 3300048907 Bacteria 3198
393 Ga0496105_0011466 3300048908 Bacteria 7003
394 Ga0496106_0009402 3300048909 Bacteria 7225
395 Ga0496106_0029997 3300048909 Bacteria 4055
396 Ga0496106_0297792 3300048909 Unclassified 1293
397 Ga0496107_0266987 3300048910 Bacteria 1274
398 Ga0496108_0000421 3300048911 Bacteria 34733
399 Ga0496108_0004999 3300048911 Bacteria 10714
400 Ga0496108_0037869 3300048911 Bacteria 4019
401 Ga0496109_0009900 3300048912 Bacteria 8139
402 Ga0496109_0017992 3300048912 Bacteria 6203
403 Ga0496109_0126757 3300048912 Bacteria 2380
404 Ga0496109_0204647 3300048912 Unclassified 1856
405 Ga0496110_0005127 3300048913 Bacteria 10235
406 Ga0496110_0007014 3300048913 Bacteria 8963
407 Ga0496111_0025171 3300048914 Bacteria 4198
408 Ga0496112_0020754 3300048915 Bacteria 6232
409 Ga0496112_0052707 3300048915 Bacteria 3993
410 Ga0496112_0078435 3300048915 Bacteria 3266
411 Ga0496113_0000833 3300048916 Bacteria 16120
412 Ga0496113_0010416 3300048916 Bacteria 6146
413 Ga0501292_002004 3300049515 Bacteria 2576
414 Ga0501033_0071838 3300049570 Bacteria 2542
415 Ga0501034_0196134 3300049571 Bacteria 1979
416 Ga0501036_0156461 3300049572 Bacteria 1922
417 Ga0501038_0043662 3300049574 Bacteria 3897
418 Ga0501039_0181456 3300049575 Bacteria 1655
419 Ga0501040_0017235 3300049576 Bacteria 4795
420 Ga0501040_0039390 3300049576 Bacteria 3214
421 Ga0501041_0005693 3300049577 Bacteria 7282
422 Ga0501041_0035992 3300049577 Bacteria 3000
423 Ga0501046_0022468 3300049580 Bacteria 5197
424 Ga0501046_0152155 3300049580 Bacteria 1745
425 Ga0501047_0127325 3300049581 Bacteria 2427
426 Ga0501048_0109615 3300049582 Bacteria 1949
427 Ga0501067_0003178 3300049583 Bacteria 9065
428 Ga0501067_0021962 3300049583 Bacteria 3531
429 Ga0501067_0035184 3300049583 Unclassified 2781
430 Ga0501068_0146262 3300049584 Bacteria 1483
431 Ga0501068_0341765 3300049584 Unclassified 961
432 Ga0501069_0000348 3300049585 Bacteria 20870
433 Ga0501069_0000778 3300049585 Bacteria 14973
434 Ga0501069_0021780 3300049585 Bacteria 3481
435 Ga0501070_0036511 3300049586 Bacteria 4103
436 Ga0501070_0183379 3300049586 Unclassified 1722
437 Ga0501070_0238574 3300049586 Bacteria 1488
438 Ga0501071_0002293 3300049587 Bacteria 11541
439 Ga0501071_0005509 3300049587 Bacteria 8147
440 Ga0501072_0017336 3300049588 Bacteria 5534
441 Ga0501072_0043471 3300049588 Bacteria 3530
442 Ga0501073_0004267 3300049589 Bacteria 10714
443 Ga0501073_0137440 3300049589 Bacteria 1693
444 Ga0501074_0076705 3300049590 Bacteria 2398
445 Ga0501075_0009529 3300049591 Bacteria 6797
446 Ga0501076_0008006 3300049592 Bacteria 7718
447 Ga0501076_0015635 3300049592 Bacteria 5738
448 Ga0501076_0130606 3300049592 Bacteria 2037
449 Ga0501076_0430055 3300049592 Bacteria 1086
450 Ga0501077_0000103 3300049593 Bacteria 44618
451 Ga0501077_0017767 3300049593 Bacteria 4493
452 Ga0501077_0336624 3300049593 Unclassified 962
453 Ga0501209_005567 3300049656 Bacteria 2284
454 Ga0501217_035127 3300049661 Bacteria 1252
455 Ga0501243_006763 3300049675 Bacteria 1743
456 Ga0501249_002491 3300049679 Bacteria 3720
457 Ga0501250_009071 3300049680 Bacteria 1111
458 Ga0501257_036596 3300049686 Bacteria 1196
459 Ga0501079_0031191 3300049741 Bacteria 4096
460 Ga0501079_0120595 3300049741 Bacteria 2039
461 Ga0501080_0054080 3300049742 Bacteria 3739
462 Ga0501080_0073547 3300049742 Bacteria 3180
463 Ga0501080_0239192 3300049742 Bacteria 1657
464 Ga0501080_0267263 3300049742 Bacteria 1557
465 Ga0501081_0028467 3300049743 Bacteria 3771
466 Ga0501081_0033747 3300049743 Bacteria 3479
467 Ga0501081_0045048 3300049743 Bacteria 3029
468 Ga0501083_0000964 3300049744 Bacteria 19033
469 Ga0501083_0004725 3300049744 Bacteria 9623
470 Ga0501262_003799 3300049759 Bacteria 1744
471 Ga0501263_005668 3300049760 Bacteria 1417
472 Ga0501268_003640 3300049765 Bacteria 2123
473 Ga0501272_001252 3300049769 Bacteria 2378
474 Ga0501273_006092 3300049770 Bacteria 1384
475 Ga0501274_003512 3300049771 Bacteria 1265
476 Ga0501035_0196417 3300049822 Bacteria 1733
477 Ga0501045_0008481 3300049824 Bacteria 7164
478 nmdc:mga05p37_102429_c1 3300050507 Bacteria 3526
479 nmdc:mga05p37_26273_c1 3300050507 Bacteria 7081
480 nmdc:mga05p37_29581_c1 3300050507 Bacteria 6684
481 nmdc:mga05p37_520744_c1 3300050507 Bacteria 1360
482 nmdc:mga09592_116117_c1 3300050508 Bacteria 2297
483 nmdc:mga09592_12654_c1 3300050508 Bacteria 6878
484 nmdc:mga09592_14338_c1 3300050508 Bacteria 6471
485 nmdc:mga0qj67_216845_c1 3300050509 Unclassified 1554
486 nmdc:mga0qj67_217925_c1 3300050509 Unclassified 1549
487 nmdc:mga0qj67_536000_c1 3300050509 Bacteria 939
488 nmdc:mga0qj67_67180_c1 3300050509 Bacteria 2856
489 nmdc:mga06r32_188395_c1 3300050510 Bacteria 2050
490 nmdc:mga06r32_2816_c1 3300050510 Bacteria 15591
491 nmdc:mga06r32_354386_c1 3300050510 Unclassified 1452
492 nmdc:mga06r32_52442_c1 3300050510 Bacteria 3907
493 nmdc:mga08y16_894988_c1 3300050511 Bacteria 874
494 nmdc:mga0n895_115097_c1 3300050512 Unclassified 2707
495 nmdc:mga0n895_1246_c1 3300050512 Bacteria 18777
496 nmdc:mga0n895_194645_c1 3300050512 Bacteria 2059
497 nmdc:mga0n895_33282_c1 3300050512 Bacteria 4953
498 nmdc:mga0n895_448_c1 3300050512 Bacteria 27643
499 nmdc:mga0n895_53215_c1 3300050512 Bacteria 3977
500 nmdc:mga0n895_59053_c1 3300050512 Bacteria 3785
501 nmdc:mga0n895_6612_c1 3300050512 Bacteria 9870
502 nmdc:mga0n895_770500_c1 3300050512 Bacteria 954
503 nmdc:mga0rr50_18846_c1 3300050513 Unclassified 4645
504 nmdc:mga08x19_10275_c1 3300050514 Bacteria 5618
505 nmdc:mga08x19_144675_c1 3300050514 Unclassified 1607
506 nmdc:mga08x19_178046_c1 3300050514 Bacteria 1451
507 nmdc:mga08x19_38112_c1 3300050514 Bacteria 3053
508 nmdc:mga08x19_443133_c1 3300050514 Unclassified 914
509 nmdc:mga08x19_68080_c1 3300050514 Bacteria 2317
510 nmdc:mga08x19_9576_c1 3300050514 Bacteria 5798
511 nmdc:mga0a205_105075_c1 3300050515 Bacteria 2723
512 nmdc:mga0a205_134589_c1 3300050515 Bacteria 2372
513 nmdc:mga0a205_22021_c1 3300050515 Bacteria 6031
514 nmdc:mga0a205_25865_c1 3300050515 Bacteria 5591
515 nmdc:mga0a205_7164_c1 3300050515 Bacteria 10077
516 nmdc:mga0a205_73401_c1 3300050515 Unclassified 3306
517 nmdc:mga0a205_91482_c1 3300050515 Unclassified 2940
518 Ga0501084_0009611 3300054114 Bacteria 7999
519 Ga0501084_0017124 3300054114 Bacteria 6021
520 Ga0501084_0053650 3300054114 Bacteria 3372
521 Ga0590075_040643 3300059424 Unclassified 1188
522 Ga0590075_048562 3300059424 Unclassified 1088
523 Ga0590077_034582 3300059426 Bacteria 1111
524 Ga0501082_0007952 3300060353 Bacteria 9158
525 Ga0501082_0049497 3300060353 Bacteria 3624
526 Ga0501082_0072364 3300060353 Bacteria 2969
527 Ga0501082_0120051 3300060353 Bacteria 2278
528 Ga0501082_0138816 3300060353 Bacteria 2109
529 Ga0530510_0035503 3300061734 Bacteria 3593

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10183800 Ga0307407_101838002 232
2 3300031911 Ga0307412_10097506 Ga0307412_100975062 233
3 3300005441 Ga0070700_100089077 Ga0070700_1000890772 237
4 3300005444 Ga0070694_100000422 Ga0070694_10000042220 237
5 3300005468 Ga0070707_100020889 Ga0070707_1000208897 237
6 3300005518 Ga0070699_100012572 Ga0070699_1000125727 237
7 3300005536 Ga0070697_100193605 Ga0070697_1001936052 237
8 3300005545 Ga0070695_100017735 Ga0070695_1000177352 237
9 3300005546 Ga0070696_100007271 Ga0070696_1000072712 237
10 3300005549 Ga0070704_100009746 Ga0070704_1000097462 237
11 3300005844 Ga0068862_100071942 Ga0068862_1000719422 237
12 3300013306 Ga0163162_10112124 Ga0163162_101121242 237
13 3300013308 Ga0157375_10098096 Ga0157375_100980965 237
14 3300025922 Ga0207646_10015171 Ga0207646_100151712 237
15 3300028380 Ga0268265_10048914 Ga0268265_100489143 237
16 3300031824 Ga0307413_10258584 Ga0307413_102585842 237
17 3300031852 Ga0307410_10028598 Ga0307410_100285982 237
18 3300047318 Ga0495636_0036747 Ga0495636_0036747_1024_1818 237
19 3300005471 Ga0070698_100236104 Ga0070698_1002361042 240
20 3300046455 Ga0495603_0030886 Ga0495603_0030886_653_1447 241
21 3300046499 Ga0495594_0079934 Ga0495594_0079934_893_1687 241
22 3300005718 Ga0068866_10095824 Ga0068866_100958242 242
23 3300006844 Ga0075428_100306488 Ga0075428_1003064882 242
24 3300050508 nmdc:mga09592_116117_c1 nmdc:mga09592_116117_c1_1093_1890 242
25 3300005328 Ga0070676_10048358 Ga0070676_100483582 244
26 3300005440 Ga0070705_100008530 Ga0070705_1000085304 244
27 3300005445 Ga0070708_100007309 Ga0070708_1000073092 244
28 3300005468 Ga0070707_100001143 Ga0070707_1000011439 244
29 3300009553 Ga0105249_10068419 Ga0105249_100684192 244
30 3300013308 Ga0157375_10041058 Ga0157375_100410584 244
31 3300025922 Ga0207646_10006611 Ga0207646_100066114 244
32 3300044712 Ga0453684_0669916 Ga0453684_0669916_307_1101 244
33 3300045051 Ga0451576_0170066 Ga0451576_0170066_408_1202 244
34 3300009147 Ga0114129_10288433 Ga0114129_102884332 246
35 3300050512 nmdc:mga0n895_194645_c1 nmdc:mga0n895_194645_c1_443_1264 246
36 3300059424 Ga0590075_040643 Ga0590075_040643_198_992 246
37 3300059426 Ga0590077_034582 Ga0590077_034582_115_909 246
38 3300006844 Ga0075428_100003541 Ga0075428_10000354115 247
39 3300006846 Ga0075430_100143369 Ga0075430_1001433693 247
40 3300031548 Ga0307408_100299142 Ga0307408_1002991422 247
41 3300031901 Ga0307406_10022274 Ga0307406_100222745 247
42 3300032002 Ga0307416_100323205 Ga0307416_1003232052 247
43 3300050509 nmdc:mga0qj67_67180_c1 nmdc:mga0qj67_67180_c1_90_893 247
44 3300005468 Ga0070707_100057462 Ga0070707_1000574624 248
45 3300005546 Ga0070696_100039396 Ga0070696_1000393964 248
46 3300005471 Ga0070698_100207035 Ga0070698_1002070352 249
47 3300005471 Ga0070698_100000438 Ga0070698_10000043813 251
48 3300005518 Ga0070699_100127965 Ga0070699_1001279652 251
49 3300005536 Ga0070697_100184830 Ga0070697_1001848302 251
50 3300046525 Ga0495663_0005526 Ga0495663_0005526_993_1838 251
51 3300046538 Ga0495609_0014486 Ga0495609_0014486_399_1244 251
52 3300047445 Ga0495677_0026939 Ga0495677_0026939_287_1132 251
53 3300048904 Ga0496101_0178479 Ga0496101_0178479_774_1529 251
54 3300048905 Ga0496102_0018257 Ga0496102_0018257_5130_5885 251
55 3300048907 Ga0496104_0002198 Ga0496104_0002198_2851_3606 251
56 3300048908 Ga0496105_0011466 Ga0496105_0011466_5937_6692 251
57 3300049571 Ga0501034_0196134 Ga0501034_0196134_211_1017 251
58 3300050512 nmdc:mga0n895_53215_c1 nmdc:mga0n895_53215_c1_540_1295 251
59 3300005518 Ga0070699_100452714 Ga0070699_1004527142 252
60 3300005536 Ga0070697_100179383 Ga0070697_1001793832 252
61 3300005458 Ga0070681_10355875 Ga0070681_103558751 253
62 3300006358 Ga0068871_100750896 Ga0068871_1007508961 254
63 3300031995 Ga0307409_100088786 Ga0307409_1000887862 254
64 3300042156 Ga0439446_0024405 Ga0439446_0024405_695_1522 254
65 3300049592 Ga0501076_0015635 Ga0501076_0015635_4920_5714 254
66 3300049593 Ga0501077_0000103 Ga0501077_0000103_2860_3654 254
67 3300049741 Ga0501079_0120595 Ga0501079_0120595_116_910 254
68 3300049743 Ga0501081_0033747 Ga0501081_0033747_2655_3449 254
69 3300060353 Ga0501082_0049497 Ga0501082_0049497_75_869 254
70 3300005440 Ga0070705_100018358 Ga0070705_1000183582 255
71 3300005564 Ga0070664_100109473 Ga0070664_1001094733 255
72 3300005844 Ga0068862_100663139 Ga0068862_1006631392 255
73 3300005457 Ga0070662_100731273 Ga0070662_1007312731 256
74 3300005471 Ga0070698_100052499 Ga0070698_1000524992 256
75 3300032002 Ga0307416_100741621 Ga0307416_1007416211 256
76 3300050512 nmdc:mga0n895_770500_c1 nmdc:mga0n895_770500_c1_132_902 256
77 3300006880 Ga0075429_100012406 Ga0075429_1000124067 257
78 3300050508 nmdc:mga09592_12654_c1 nmdc:mga09592_12654_c1_3452_4249 257
79 3300005406 Ga0070703_10026224 Ga0070703_100262242 258
80 3300005468 Ga0070707_100053016 Ga0070707_1000530162 258
81 3300005518 Ga0070699_100132650 Ga0070699_1001326502 258
82 3300005564 Ga0070664_100110595 Ga0070664_1001105952 258
83 3300005617 Ga0068859_100368030 Ga0068859_1003680302 258
84 3300006931 Ga0097620_100368051 Ga0097620_1003680512 258
85 3300025910 Ga0207684_10024190 Ga0207684_100241902 258
86 3300025922 Ga0207646_10005811 Ga0207646_1000581111 258
87 3300025922 Ga0207646_10228304 Ga0207646_102283042 258
88 3300025939 Ga0207665_10005019 Ga0207665_100050198 258
89 3300031824 Ga0307413_10089965 Ga0307413_100899652 258
90 3300031852 Ga0307410_10048100 Ga0307410_100481002 258
91 3300031995 Ga0307409_100008683 Ga0307409_1000086832 258
92 3300032002 Ga0307416_100074240 Ga0307416_1000742401 258
93 3300005336 Ga0070680_100013722 Ga0070680_1000137226 259
94 3300005434 Ga0070709_10003102 Ga0070709_100031025 259
95 3300005444 Ga0070694_100000715 Ga0070694_1000007158 259
96 3300005518 Ga0070699_100023409 Ga0070699_1000234094 259
97 3300005518 Ga0070699_100060537 Ga0070699_1000605371 259
98 3300005518 Ga0070699_100101885 Ga0070699_1001018851 259
99 3300005545 Ga0070695_100008791 Ga0070695_1000087915 259
100 3300005549 Ga0070704_100002251 Ga0070704_1000022512 259
101 3300006852 Ga0075433_10006069 Ga0075433_100060696 259
102 3300006914 Ga0075436_100005815 Ga0075436_1000058157 259
103 3300006914 Ga0075436_100138233 Ga0075436_1001382332 259
104 3300025906 Ga0207699_10011498 Ga0207699_100114982 259
105 3300045051 Ga0451576_0071111 Ga0451576_0071111_588_1433 259
106 3300049570 Ga0501033_0071838 Ga0501033_0071838_1159_1953 259
107 3300049572 Ga0501036_0156461 Ga0501036_0156461_693_1487 259
108 3300049574 Ga0501038_0043662 Ga0501038_0043662_1680_2474 259
109 3300049576 Ga0501040_0039390 Ga0501040_0039390_706_1500 259
110 3300049577 Ga0501041_0005693 Ga0501041_0005693_40_834 259
111 3300049580 Ga0501046_0022468 Ga0501046_0022468_3540_4334 259
112 3300049582 Ga0501048_0109615 Ga0501048_0109615_511_1305 259
113 3300049584 Ga0501068_0341765 Ga0501068_0341765_70_864 259
114 3300049587 Ga0501071_0002293 Ga0501071_0002293_5668_6462 259
115 3300049588 Ga0501072_0017336 Ga0501072_0017336_881_1675 259
116 3300049593 Ga0501077_0336624 Ga0501077_0336624_36_830 259
117 3300049741 Ga0501079_0031191 Ga0501079_0031191_2323_3117 259
118 3300049742 Ga0501080_0054080 Ga0501080_0054080_706_1500 259
119 3300049743 Ga0501081_0045048 Ga0501081_0045048_1475_2269 259
120 3300049822 Ga0501035_0196417 Ga0501035_0196417_415_1209 259
121 3300049824 Ga0501045_0008481 Ga0501045_0008481_4946_5740 259
122 3300050514 nmdc:mga08x19_10275_c1 nmdc:mga08x19_10275_c1_3030_3869 259
123 3300050514 nmdc:mga08x19_144675_c1 nmdc:mga08x19_144675_c1_121_936 259
124 3300050515 nmdc:mga0a205_73401_c1 nmdc:mga0a205_73401_c1_1855_2694 259
125 3300054114 Ga0501084_0017124 Ga0501084_0017124_3938_4732 259
126 3300060353 Ga0501082_0072364 Ga0501082_0072364_1192_1986 259
127 3300005440 Ga0070705_100001793 Ga0070705_1000017937 261
128 3300027671 Ga0209588_1021135 Ga0209588_10211352 261
129 3300005545 Ga0070695_100010591 Ga0070695_1000105912 262
130 3300005545 Ga0070695_100247892 Ga0070695_1002478922 262
131 3300005549 Ga0070704_100020882 Ga0070704_1000208823 262
132 3300025910 Ga0207684_10143210 Ga0207684_101432102 262
133 3300005439 Ga0070711_100001898 Ga0070711_1000018987 263
134 3300005440 Ga0070705_100035077 Ga0070705_1000350772 263
135 3300005458 Ga0070681_10055606 Ga0070681_100556065 263
136 3300005518 Ga0070699_100112187 Ga0070699_1001121872 263
137 3300005536 Ga0070697_100141260 Ga0070697_1001412602 263
138 3300005546 Ga0070696_100003742 Ga0070696_1000037428 263
139 3300005549 Ga0070704_100013911 Ga0070704_1000139115 263
140 3300006175 Ga0070712_100042324 Ga0070712_1000423242 263
141 3300009177 Ga0105248_10155375 Ga0105248_101553751 263
142 3300025910 Ga0207684_10130894 Ga0207684_101308942 263
143 3300025915 Ga0207693_10216023 Ga0207693_102160232 263
144 3300045051 Ga0451576_0161317 Ga0451576_0161317_317_1135 263
145 3300005328 Ga0070676_10002532 Ga0070676_100025327 264
146 3300005335 Ga0070666_10035337 Ga0070666_100353372 264
147 3300005336 Ga0070680_100107096 Ga0070680_1001070963 264
148 3300005337 Ga0070682_100206883 Ga0070682_1002068831 264
149 3300005341 Ga0070691_10195046 Ga0070691_101950461 264
150 3300005345 Ga0070692_10026896 Ga0070692_100268963 264
151 3300005347 Ga0070668_100086996 Ga0070668_1000869962 264
152 3300005354 Ga0070675_100036121 Ga0070675_1000361212 264
153 3300005356 Ga0070674_100036668 Ga0070674_1000366682 264
154 3300005356 Ga0070674_100454150 Ga0070674_1004541501 264
155 3300005364 Ga0070673_100072902 Ga0070673_1000729023 264
156 3300005366 Ga0070659_100056844 Ga0070659_1000568442 264
157 3300005366 Ga0070659_100070129 Ga0070659_1000701292 264
158 3300005406 Ga0070703_10025939 Ga0070703_100259391 264
159 3300005406 Ga0070703_10028683 Ga0070703_100286832 264
160 3300005434 Ga0070709_10017764 Ga0070709_100177641 264
161 3300005439 Ga0070711_100002205 Ga0070711_1000022057 264
162 3300005439 Ga0070711_100053078 Ga0070711_1000530783 264
163 3300005440 Ga0070705_100020056 Ga0070705_1000200563 264
164 3300005440 Ga0070705_100021224 Ga0070705_1000212244 264
165 3300005440 Ga0070705_100022616 Ga0070705_1000226164 264
166 3300005444 Ga0070694_100004198 Ga0070694_1000041987 264
167 3300005444 Ga0070694_100039579 Ga0070694_1000395792 264
168 3300005444 Ga0070694_100061439 Ga0070694_1000614392 264
169 3300005444 Ga0070694_100065555 Ga0070694_1000655552 264
170 3300005444 Ga0070694_100083417 Ga0070694_1000834172 264
171 3300005444 Ga0070694_100115070 Ga0070694_1001150702 264
172 3300005444 Ga0070694_100125323 Ga0070694_1001253232 264
173 3300005444 Ga0070694_100271195 Ga0070694_1002711952 264
174 3300005445 Ga0070708_100003522 Ga0070708_1000035227 264
175 3300005445 Ga0070708_100005882 Ga0070708_1000058828 264
176 3300005445 Ga0070708_100038270 Ga0070708_1000382702 264
177 3300005445 Ga0070708_100100223 Ga0070708_1001002232 264
178 3300005445 Ga0070708_100103702 Ga0070708_1001037022 264
179 3300005445 Ga0070708_100455111 Ga0070708_1004551112 264
180 3300005445 Ga0070708_100855185 Ga0070708_1008551851 264
181 3300005455 Ga0070663_100320789 Ga0070663_1003207892 264
182 3300005456 Ga0070678_100004832 Ga0070678_1000048322 264
183 3300005456 Ga0070678_100307052 Ga0070678_1003070522 264
184 3300005457 Ga0070662_100002098 Ga0070662_10000209810 264
185 3300005457 Ga0070662_100322427 Ga0070662_1003224272 264
186 3300005458 Ga0070681_10241276 Ga0070681_102412762 264
187 3300005459 Ga0068867_100003981 Ga0068867_1000039811 264
188 3300005459 Ga0068867_100066755 Ga0068867_1000667552 264
189 3300005467 Ga0070706_100016983 Ga0070706_1000169836 264
190 3300005467 Ga0070706_100068695 Ga0070706_1000686952 264
191 3300005467 Ga0070706_100093243 Ga0070706_1000932433 264
192 3300005467 Ga0070706_100510090 Ga0070706_1005100901 264
193 3300005468 Ga0070707_100033568 Ga0070707_1000335685 264
194 3300005468 Ga0070707_100070461 Ga0070707_1000704611 264
195 3300005468 Ga0070707_100080686 Ga0070707_1000806863 264
196 3300005468 Ga0070707_100081876 Ga0070707_1000818762 264
197 3300005468 Ga0070707_100247169 Ga0070707_1002471692 264
198 3300005468 Ga0070707_100340598 Ga0070707_1003405982 264
199 3300005471 Ga0070698_100036124 Ga0070698_1000361241 264
200 3300005471 Ga0070698_100086726 Ga0070698_1000867264 264
201 3300005471 Ga0070698_100234820 Ga0070698_1002348202 264
202 3300005518 Ga0070699_100000017 Ga0070699_10000001791 264
203 3300005518 Ga0070699_100003578 Ga0070699_1000035785 264
204 3300005518 Ga0070699_100038971 Ga0070699_1000389714 264
205 3300005518 Ga0070699_100135617 Ga0070699_1001356171 264
206 3300005530 Ga0070679_100025810 Ga0070679_1000258103 264
207 3300005530 Ga0070679_100073411 Ga0070679_1000734111 264
208 3300005536 Ga0070697_100012678 Ga0070697_1000126784 264
209 3300005536 Ga0070697_100016658 Ga0070697_1000166585 264
210 3300005536 Ga0070697_100178657 Ga0070697_1001786572 264
211 3300005536 Ga0070697_100236710 Ga0070697_1002367102 264
212 3300005539 Ga0068853_100206522 Ga0068853_1002065222 264
213 3300005543 Ga0070672_100157380 Ga0070672_1001573802 264
214 3300005545 Ga0070695_100006811 Ga0070695_1000068112 264
215 3300005545 Ga0070695_100040744 Ga0070695_1000407443 264
216 3300005545 Ga0070695_100080016 Ga0070695_1000800162 264
217 3300005545 Ga0070695_100109758 Ga0070695_1001097582 264
218 3300005546 Ga0070696_100000782 Ga0070696_10000078215 264
219 3300005546 Ga0070696_100012759 Ga0070696_1000127593 264
220 3300005546 Ga0070696_100019489 Ga0070696_1000194894 264
221 3300005546 Ga0070696_100078107 Ga0070696_1000781072 264
222 3300005546 Ga0070696_100156910 Ga0070696_1001569102 264
223 3300005547 Ga0070693_100022046 Ga0070693_1000220462 264
224 3300005547 Ga0070693_100208081 Ga0070693_1002080811 264
225 3300005549 Ga0070704_100001062 Ga0070704_1000010627 264
226 3300005549 Ga0070704_100006257 Ga0070704_1000062572 264
227 3300005549 Ga0070704_100007539 Ga0070704_1000075395 264
228 3300005549 Ga0070704_100022608 Ga0070704_1000226083 264
229 3300005549 Ga0070704_100023968 Ga0070704_1000239682 264
230 3300005549 Ga0070704_100118374 Ga0070704_1001183742 264
231 3300005578 Ga0068854_100004324 Ga0068854_1000043242 264
232 3300005615 Ga0070702_100004601 Ga0070702_1000046013 264
233 3300005615 Ga0070702_100034936 Ga0070702_1000349362 264
234 3300005616 Ga0068852_100350771 Ga0068852_1003507712 264
235 3300005617 Ga0068859_100060413 Ga0068859_1000604131 264
236 3300005617 Ga0068859_100432207 Ga0068859_1004322072 264
237 3300005618 Ga0068864_100468739 Ga0068864_1004687392 264
238 3300005718 Ga0068866_10000162 Ga0068866_1000016223 264
239 3300005719 Ga0068861_100065029 Ga0068861_1000650292 264
240 3300005719 Ga0068861_100071676 Ga0068861_1000716762 264
241 3300005841 Ga0068863_100012080 Ga0068863_1000120805 264
242 3300005842 Ga0068858_100043138 Ga0068858_1000431383 264
243 3300005843 Ga0068860_100081414 Ga0068860_1000814142 264
244 3300005843 Ga0068860_100120296 Ga0068860_1001202962 264
245 3300005937 Ga0081455_10013309 Ga0081455_100133094 264
246 3300006173 Ga0070716_100103784 Ga0070716_1001037843 264
247 3300006173 Ga0070716_100125086 Ga0070716_1001250862 264
248 3300006237 Ga0097621_100099666 Ga0097621_1000996662 264
249 3300006844 Ga0075428_100012452 Ga0075428_1000124526 264
250 3300006844 Ga0075428_100293735 Ga0075428_1002937352 264
251 3300006846 Ga0075430_100023884 Ga0075430_1000238844 264
252 3300006846 Ga0075430_100625597 Ga0075430_1006255971 264
253 3300006847 Ga0075431_100004957 Ga0075431_1000049574 264
254 3300006847 Ga0075431_100065160 Ga0075431_1000651604 264
255 3300006847 Ga0075431_100075369 Ga0075431_1000753695 264
256 3300006852 Ga0075433_10001211 Ga0075433_100012117 264
257 3300006852 Ga0075433_10009500 Ga0075433_100095006 264
258 3300006852 Ga0075433_10057773 Ga0075433_100577733 264
259 3300006852 Ga0075433_10074047 Ga0075433_100740472 264
260 3300006852 Ga0075433_10095147 Ga0075433_100951473 264
261 3300006852 Ga0075433_10110164 Ga0075433_101101643 264
262 3300006871 Ga0075434_100006336 Ga0075434_1000063362 264
263 3300006871 Ga0075434_100008345 Ga0075434_1000083456 264
264 3300006871 Ga0075434_100015558 Ga0075434_1000155587 264
265 3300006871 Ga0075434_100190664 Ga0075434_1001906642 264
266 3300006871 Ga0075434_100360316 Ga0075434_1003603162 264
267 3300006880 Ga0075429_100023165 Ga0075429_1000231652 264
268 3300006880 Ga0075429_100270642 Ga0075429_1002706422 264
269 3300006880 Ga0075429_100342434 Ga0075429_1003424342 264
270 3300006881 Ga0068865_100001883 Ga0068865_1000018832 264
271 3300006881 Ga0068865_100075783 Ga0068865_1000757832 264
272 3300006914 Ga0075436_100001523 Ga0075436_10000152311 264
273 3300006914 Ga0075436_100004772 Ga0075436_1000047722 264
274 3300006914 Ga0075436_100064730 Ga0075436_1000647302 264
275 3300006914 Ga0075436_100091805 Ga0075436_1000918053 264
276 3300006914 Ga0075436_100114654 Ga0075436_1001146543 264
277 3300006914 Ga0075436_100172572 Ga0075436_1001725722 264
278 3300006914 Ga0075436_100258132 Ga0075436_1002581322 264
279 3300006931 Ga0097620_100060413 Ga0097620_1000604131 264
280 3300006931 Ga0097620_100432235 Ga0097620_1004322352 264
281 3300007076 Ga0075435_100155941 Ga0075435_1001559412 264
282 3300007076 Ga0075435_100317303 Ga0075435_1003173031 264
283 3300007076 Ga0075435_100415346 Ga0075435_1004153462 264
284 3300007265 Ga0099794_10000006 Ga0099794_1000000618 264
285 3300007265 Ga0099794_10018376 Ga0099794_100183763 264
286 3300009093 Ga0105240_10096739 Ga0105240_100967392 264
287 3300009094 Ga0111539_10459788 Ga0111539_104597882 264
288 3300009094 Ga0111539_10573973 Ga0111539_105739732 264
289 3300009094 Ga0111539_11218153 Ga0111539_112181531 264
290 3300009098 Ga0105245_10232427 Ga0105245_102324272 264
291 3300009147 Ga0114129_10000596 Ga0114129_100005963 264
292 3300009147 Ga0114129_10020622 Ga0114129_100206225 264
293 3300009147 Ga0114129_10059112 Ga0114129_100591123 264
294 3300009147 Ga0114129_10080448 Ga0114129_100804484 264
295 3300009147 Ga0114129_10621233 Ga0114129_106212331 264
296 3300009147 Ga0114129_10700340 Ga0114129_107003401 264
297 3300009147 Ga0114129_10868586 Ga0114129_108685862 264
298 3300009148 Ga0105243_10006593 Ga0105243_100065932 264
299 3300009174 Ga0105241_10131060 Ga0105241_101310602 264
300 3300009176 Ga0105242_10088942 Ga0105242_100889422 264
301 3300009177 Ga0105248_10004746 Ga0105248_1000474617 264
302 3300009177 Ga0105248_10153825 Ga0105248_101538252 264
303 3300009177 Ga0105248_10287670 Ga0105248_102876703 264
304 3300009553 Ga0105249_10080883 Ga0105249_100808832 264
305 3300010375 Ga0105239_10391139 Ga0105239_103911392 264
306 3300013102 Ga0157371_10068091 Ga0157371_100680912 264
307 3300013297 Ga0157378_10000489 Ga0157378_1000048921 264
308 3300013306 Ga0163162_10099364 Ga0163162_100993642 264
309 3300013307 Ga0157372_10156599 Ga0157372_101565991 264
310 3300014325 Ga0163163_10065097 Ga0163163_100650973 264
311 3300014968 Ga0157379_10031115 Ga0157379_100311154 264
312 3300014968 Ga0157379_10040410 Ga0157379_100404102 264
313 3300014968 Ga0157379_10194271 Ga0157379_101942712 264
314 3300014969 Ga0157376_10702457 Ga0157376_107024572 264
315 3300025885 Ga0207653_10000039 Ga0207653_1000003931 264
316 3300025885 Ga0207653_10045870 Ga0207653_100458702 264
317 3300025899 Ga0207642_10016994 Ga0207642_100169943 264
318 3300025907 Ga0207645_10009047 Ga0207645_100090472 264
319 3300025910 Ga0207684_10024609 Ga0207684_100246097 264
320 3300025910 Ga0207684_10054876 Ga0207684_100548762 264
321 3300025910 Ga0207684_10113636 Ga0207684_101136363 264
322 3300025912 Ga0207707_10003433 Ga0207707_100034337 264
323 3300025912 Ga0207707_10276070 Ga0207707_102760702 264
324 3300025913 Ga0207695_10212021 Ga0207695_102120212 264
325 3300025916 Ga0207663_10004104 Ga0207663_100041043 264
326 3300025916 Ga0207663_10072040 Ga0207663_100720403 264
327 3300025917 Ga0207660_10063105 Ga0207660_100631052 264
328 3300025917 Ga0207660_10131327 Ga0207660_101313272 264
329 3300025917 Ga0207660_10177086 Ga0207660_101770861 264
330 3300025921 Ga0207652_10010866 Ga0207652_100108665 264
331 3300025921 Ga0207652_10024223 Ga0207652_100242235 264
332 3300025922 Ga0207646_10003946 Ga0207646_100039462 264
333 3300025922 Ga0207646_10014155 Ga0207646_100141554 264
334 3300025922 Ga0207646_10071120 Ga0207646_100711201 264
335 3300025922 Ga0207646_10092695 Ga0207646_100926952 264
336 3300025922 Ga0207646_10259494 Ga0207646_102594942 264
337 3300025922 Ga0207646_10286207 Ga0207646_102862072 264
338 3300025926 Ga0207659_10049626 Ga0207659_100496262 264
339 3300025928 Ga0207700_10191447 Ga0207700_101914472 264
340 3300025932 Ga0207690_10041795 Ga0207690_100417952 264
341 3300025932 Ga0207690_10126440 Ga0207690_101264401 264
342 3300025933 Ga0207706_10001874 Ga0207706_1000187417 264
343 3300025933 Ga0207706_10030452 Ga0207706_100304521 264
344 3300025933 Ga0207706_10134527 Ga0207706_101345272 264
345 3300025934 Ga0207686_10001992 Ga0207686_100019922 264
346 3300025935 Ga0207709_10023137 Ga0207709_100231373 264
347 3300025937 Ga0207669_10088257 Ga0207669_100882573 264
348 3300025938 Ga0207704_10018151 Ga0207704_100181513 264
349 3300025939 Ga0207665_10015849 Ga0207665_100158496 264
350 3300025939 Ga0207665_10164014 Ga0207665_101640142 264
351 3300025940 Ga0207691_10061910 Ga0207691_100619102 264
352 3300025941 Ga0207711_10050853 Ga0207711_100508532 264
353 3300025941 Ga0207711_10071410 Ga0207711_100714102 264
354 3300025942 Ga0207689_10001812 Ga0207689_1000181218 264
355 3300025960 Ga0207651_10045036 Ga0207651_100450362 264
356 3300025961 Ga0207712_10023746 Ga0207712_100237463 264
357 3300025981 Ga0207640_10031008 Ga0207640_100310082 264
358 3300025981 Ga0207640_10544158 Ga0207640_105441581 264
359 3300026067 Ga0207678_10332536 Ga0207678_103325362 264
360 3300026075 Ga0207708_10101587 Ga0207708_101015872 264
361 3300026088 Ga0207641_10026080 Ga0207641_100260805 264
362 3300026088 Ga0207641_10052044 Ga0207641_100520444 264
363 3300026089 Ga0207648_10054502 Ga0207648_100545023 264
364 3300026089 Ga0207648_10692376 Ga0207648_106923761 264
365 3300026095 Ga0207676_10248538 Ga0207676_102485382 264
366 3300026095 Ga0207676_10538118 Ga0207676_105381181 264
367 3300026118 Ga0207675_100027615 Ga0207675_1000276153 264
368 3300026118 Ga0207675_100517488 Ga0207675_1005174882 264
369 3300026121 Ga0207683_10010959 Ga0207683_100109597 264
370 3300027671 Ga0209588_1000174 Ga0209588_10001744 264
371 3300027671 Ga0209588_1009449 Ga0209588_10094492 264
372 3300027907 Ga0207428_10103366 Ga0207428_101033662 264
373 3300028381 Ga0268264_10081558 Ga0268264_100815582 264
374 3300031548 Ga0307408_100032932 Ga0307408_1000329323 264
375 3300031548 Ga0307408_100075741 Ga0307408_1000757412 264
376 3300031548 Ga0307408_100277665 Ga0307408_1002776652 264
377 3300031731 Ga0307405_10357900 Ga0307405_103579002 264
378 3300031824 Ga0307413_10013993 Ga0307413_100139932 264
379 3300031824 Ga0307413_10016091 Ga0307413_100160911 264
380 3300031824 Ga0307413_10189049 Ga0307413_101890491 264
381 3300031852 Ga0307410_10021783 Ga0307410_100217834 264
382 3300031852 Ga0307410_10036711 Ga0307410_100367113 264
383 3300031852 Ga0307410_10122157 Ga0307410_101221572 264
384 3300031852 Ga0307410_10144885 Ga0307410_101448851 264
385 3300031852 Ga0307410_10603061 Ga0307410_106030612 264
386 3300031901 Ga0307406_10056482 Ga0307406_100564822 264
387 3300031901 Ga0307406_10087000 Ga0307406_100870002 264
388 3300031901 Ga0307406_10321280 Ga0307406_103212803 264
389 3300031903 Ga0307407_10022152 Ga0307407_100221522 264
390 3300031903 Ga0307407_10041726 Ga0307407_100417263 264
391 3300031903 Ga0307407_10104928 Ga0307407_101049283 264
392 3300031903 Ga0307407_10196007 Ga0307407_101960072 264
393 3300031911 Ga0307412_10048170 Ga0307412_100481703 264
394 3300031995 Ga0307409_100004097 Ga0307409_1000040974 264
395 3300031995 Ga0307409_100096196 Ga0307409_1000961963 264
396 3300031995 Ga0307409_100103641 Ga0307409_1001036413 264
397 3300032002 Ga0307416_100026899 Ga0307416_1000268993 264
398 3300032002 Ga0307416_100264245 Ga0307416_1002642452 264
399 3300032002 Ga0307416_100290100 Ga0307416_1002901002 264
400 3300032002 Ga0307416_100497329 Ga0307416_1004973292 264
401 3300032004 Ga0307414_10016817 Ga0307414_100168175 264
402 3300032004 Ga0307414_10102458 Ga0307414_101024582 264
403 3300032004 Ga0307414_10251910 Ga0307414_102519102 264
404 3300032004 Ga0307414_10260187 Ga0307414_102601872 264
405 3300032005 Ga0307411_10000458 Ga0307411_100004583 264
406 3300032005 Ga0307411_10036177 Ga0307411_100361771 264
407 3300032005 Ga0307411_10053038 Ga0307411_100530382 264
408 3300032005 Ga0307411_10075876 Ga0307411_100758762 264
409 3300032005 Ga0307411_10091870 Ga0307411_100918702 264
410 3300032126 Ga0307415_100001211 Ga0307415_1000012111 264
411 3300032126 Ga0307415_100066823 Ga0307415_1000668231 264
412 3300032126 Ga0307415_100691491 Ga0307415_1006914911 264
413 3300035691 Ga0373931_0012661 Ga0373931_0012661_2307_3101 264
414 3300035691 Ga0373931_0085446 Ga0373931_0085446_789_1583 264
415 3300037471 Ga0395905_0136790 Ga0395905_0136790_81_875 264
416 3300042011 Ga0439454_022698 Ga0439454_022698_19_813 264
417 3300042156 Ga0439446_0003258 Ga0439446_0003258_192_1013 264
418 3300042156 Ga0439446_0031353 Ga0439446_0031353_212_1006 264
419 3300044673 Ga0453683_0019207 Ga0453683_0019207_2999_3826 264
420 3300045051 Ga0451576_0052930 Ga0451576_0052930_1844_2671 264
421 3300046455 Ga0495603_0145592 Ga0495603_0145592_88_882 264
422 3300046472 Ga0495580_0026814 Ga0495580_0026814_1050_1865 264
423 3300048904 Ga0496101_0604284 Ga0496101_0604284_36_830 264
424 3300048905 Ga0496102_0015023 Ga0496102_0015023_5749_6579 264
425 3300048905 Ga0496102_0050191 Ga0496102_0050191_142_936 264
426 3300048906 Ga0496103_0020565 Ga0496103_0020565_749_1567 264
427 3300048907 Ga0496104_0040491 Ga0496104_0040491_1251_2045 264
428 3300048907 Ga0496104_0076028 Ga0496104_0076028_1869_2663 264
429 3300048909 Ga0496106_0009402 Ga0496106_0009402_5418_6236 264
430 3300048909 Ga0496106_0029997 Ga0496106_0029997_126_920 264
431 3300048909 Ga0496106_0297792 Ga0496106_0297792_236_1030 264
432 3300048910 Ga0496107_0266987 Ga0496107_0266987_427_1221 264
433 3300048911 Ga0496108_0000421 Ga0496108_0000421_20898_21716 264
434 3300048911 Ga0496108_0004999 Ga0496108_0004999_3039_3833 264
435 3300048911 Ga0496108_0037869 Ga0496108_0037869_1424_2218 264
436 3300048912 Ga0496109_0009900 Ga0496109_0009900_6783_7601 264
437 3300048912 Ga0496109_0017992 Ga0496109_0017992_2377_3171 264
438 3300048912 Ga0496109_0126757 Ga0496109_0126757_1321_2115 264
439 3300048912 Ga0496109_0204647 Ga0496109_0204647_815_1609 264
440 3300048913 Ga0496110_0005127 Ga0496110_0005127_3541_4359 264
441 3300048913 Ga0496110_0007014 Ga0496110_0007014_2326_3120 264
442 3300048914 Ga0496111_0025171 Ga0496111_0025171_3073_3891 264
443 3300048915 Ga0496112_0020754 Ga0496112_0020754_3062_3856 264
444 3300048915 Ga0496112_0052707 Ga0496112_0052707_2780_3574 264
445 3300048915 Ga0496112_0078435 Ga0496112_0078435_188_1006 264
446 3300048916 Ga0496113_0000833 Ga0496113_0000833_7813_8631 264
447 3300048916 Ga0496113_0010416 Ga0496113_0010416_2316_3110 264
448 3300049515 Ga0501292_002004 Ga0501292_002004_181_978 264
449 3300049575 Ga0501039_0181456 Ga0501039_0181456_727_1521 264
450 3300049576 Ga0501040_0017235 Ga0501040_0017235_3341_4135 264
451 3300049577 Ga0501041_0035992 Ga0501041_0035992_1111_1905 264
452 3300049580 Ga0501046_0152155 Ga0501046_0152155_641_1435 264
453 3300049581 Ga0501047_0127325 Ga0501047_0127325_1415_2239 264
454 3300049583 Ga0501067_0003178 Ga0501067_0003178_604_1428 264
455 3300049583 Ga0501067_0021962 Ga0501067_0021962_666_1460 264
456 3300049583 Ga0501067_0035184 Ga0501067_0035184_1687_2481 264
457 3300049584 Ga0501068_0146262 Ga0501068_0146262_503_1327 264
458 3300049585 Ga0501069_0000348 Ga0501069_0000348_6406_7230 264
459 3300049585 Ga0501069_0000778 Ga0501069_0000778_12423_13247 264
460 3300049585 Ga0501069_0021780 Ga0501069_0021780_274_1077 264
461 3300049586 Ga0501070_0036511 Ga0501070_0036511_2823_3647 264
462 3300049586 Ga0501070_0183379 Ga0501070_0183379_304_1107 264
463 3300049586 Ga0501070_0238574 Ga0501070_0238574_211_1035 264
464 3300049587 Ga0501071_0005509 Ga0501071_0005509_581_1405 264
465 3300049588 Ga0501072_0043471 Ga0501072_0043471_1839_2663 264
466 3300049589 Ga0501073_0004267 Ga0501073_0004267_554_1378 264
467 3300049589 Ga0501073_0137440 Ga0501073_0137440_185_1009 264
468 3300049590 Ga0501074_0076705 Ga0501074_0076705_1521_2345 264
469 3300049591 Ga0501075_0009529 Ga0501075_0009529_3588_4382 264
470 3300049592 Ga0501076_0008006 Ga0501076_0008006_4555_5349 264
471 3300049592 Ga0501076_0130606 Ga0501076_0130606_723_1547 264
472 3300049592 Ga0501076_0430055 Ga0501076_0430055_112_936 264
473 3300049593 Ga0501077_0017767 Ga0501077_0017767_2170_2964 264
474 3300049656 Ga0501209_005567 Ga0501209_005567_569_1366 264
475 3300049661 Ga0501217_035127 Ga0501217_035127_121_918 264
476 3300049675 Ga0501243_006763 Ga0501243_006763_919_1716 264
477 3300049679 Ga0501249_002491 Ga0501249_002491_669_1466 264
478 3300049680 Ga0501250_009071 Ga0501250_009071_67_864 264
479 3300049686 Ga0501257_036596 Ga0501257_036596_255_1052 264
480 3300049742 Ga0501080_0073547 Ga0501080_0073547_2244_3038 264
481 3300049742 Ga0501080_0239192 Ga0501080_0239192_320_1144 264
482 3300049742 Ga0501080_0267263 Ga0501080_0267263_454_1263 264
483 3300049743 Ga0501081_0028467 Ga0501081_0028467_2272_3066 264
484 3300049744 Ga0501083_0000964 Ga0501083_0000964_11450_12274 264
485 3300049744 Ga0501083_0004725 Ga0501083_0004725_1560_2384 264
486 3300049759 Ga0501262_003799 Ga0501262_003799_187_984 264
487 3300049760 Ga0501263_005668 Ga0501263_005668_83_880 264
488 3300049765 Ga0501268_003640 Ga0501268_003640_658_1455 264
489 3300049769 Ga0501272_001252 Ga0501272_001252_163_960 264
490 3300049770 Ga0501273_006092 Ga0501273_006092_323_1120 264
491 3300049771 Ga0501274_003512 Ga0501274_003512_296_1093 264
492 3300050507 nmdc:mga05p37_102429_c1 nmdc:mga05p37_102429_c1_1000_1800 264
493 3300050507 nmdc:mga05p37_26273_c1 nmdc:mga05p37_26273_c1_1803_2621 264
494 3300050507 nmdc:mga05p37_29581_c1 nmdc:mga05p37_29581_c1_3314_4108 264
495 3300050507 nmdc:mga05p37_520744_c1 nmdc:mga05p37_520744_c1_173_967 264
496 3300050508 nmdc:mga09592_14338_c1 nmdc:mga09592_14338_c1_288_1106 264
497 3300050509 nmdc:mga0qj67_216845_c1 nmdc:mga0qj67_216845_c1_254_1417 264
498 3300050509 nmdc:mga0qj67_217925_c1 nmdc:mga0qj67_217925_c1_443_1237 264
499 3300050509 nmdc:mga0qj67_536000_c1 nmdc:mga0qj67_536000_c1_64_861 264
500 3300050510 nmdc:mga06r32_188395_c1 nmdc:mga06r32_188395_c1_635_1429 264
501 3300050510 nmdc:mga06r32_2816_c1 nmdc:mga06r32_2816_c1_1180_1974 264
502 3300050510 nmdc:mga06r32_354386_c1 nmdc:mga06r32_354386_c1_283_1119 264
503 3300050510 nmdc:mga06r32_52442_c1 nmdc:mga06r32_52442_c1_2546_3376 264
504 3300050511 nmdc:mga08y16_894988_c1 nmdc:mga08y16_894988_c1_41_835 264
505 3300050512 nmdc:mga0n895_115097_c1 nmdc:mga0n895_115097_c1_1694_2524 264
506 3300050512 nmdc:mga0n895_1246_c1 nmdc:mga0n895_1246_c1_17439_18266 264
507 3300050512 nmdc:mga0n895_33282_c1 nmdc:mga0n895_33282_c1_1720_2535 264
508 3300050512 nmdc:mga0n895_448_c1 nmdc:mga0n895_448_c1_5223_6023 264
509 3300050512 nmdc:mga0n895_59053_c1 nmdc:mga0n895_59053_c1_1742_2542 264
510 3300050512 nmdc:mga0n895_6612_c1 nmdc:mga0n895_6612_c1_5118_5936 264
511 3300050513 nmdc:mga0rr50_18846_c1 nmdc:mga0rr50_18846_c1_2468_3295 264
512 3300050514 nmdc:mga08x19_178046_c1 nmdc:mga08x19_178046_c1_110_949 264
513 3300050514 nmdc:mga08x19_38112_c1 nmdc:mga08x19_38112_c1_1699_2499 264
514 3300050514 nmdc:mga08x19_443133_c1 nmdc:mga08x19_443133_c1_66_866 264
515 3300050514 nmdc:mga08x19_68080_c1 nmdc:mga08x19_68080_c1_748_1575 264
516 3300050514 nmdc:mga08x19_9576_c1 nmdc:mga08x19_9576_c1_66_866 264
517 3300050515 nmdc:mga0a205_105075_c1 nmdc:mga0a205_105075_c1_852_1652 264
518 3300050515 nmdc:mga0a205_134589_c1 nmdc:mga0a205_134589_c1_1142_1936 264
519 3300050515 nmdc:mga0a205_22021_c1 nmdc:mga0a205_22021_c1_1836_2663 264
520 3300050515 nmdc:mga0a205_25865_c1 nmdc:mga0a205_25865_c1_1244_2044 264
521 3300050515 nmdc:mga0a205_7164_c1 nmdc:mga0a205_7164_c1_3651_4466 264
522 3300050515 nmdc:mga0a205_91482_c1 nmdc:mga0a205_91482_c1_1262_2059 264
523 3300054114 Ga0501084_0009611 Ga0501084_0009611_85_909 264
524 3300054114 Ga0501084_0053650 Ga0501084_0053650_708_1532 264
525 3300059424 Ga0590075_048562 Ga0590075_048562_232_1026 264
526 3300060353 Ga0501082_0007952 Ga0501082_0007952_2894_3688 264
527 3300060353 Ga0501082_0120051 Ga0501082_0120051_457_1281 264
528 3300060353 Ga0501082_0138816 Ga0501082_0138816_669_1493 264
529 3300061734 Ga0530510_0035503 Ga0530510_0035503_890_1684 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01976

DUF116

Protein of unknown function DUF116

229

313

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m5t-assembly1.cif.gz_A crystal structure of the response regulator divk 0.6864 163 237
6ejj-assembly1.cif.gz_A structure of a glycosyltransferase / state 2 0.6857 163 238
2jrl-assembly1.cif.gz_B solution structure of the beryllofluoride-activated ntrc4 receiver domain dimer 0.6809 164 214
7s5m-assembly2.cif.gz_C crystal structure of a 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme a ligase from mycobacterium smegmatis 0.6733 159 237
1xhf-assembly1.cif.gz_A crystal structure of the bef3-activated receiver domain of redox response regulator arca 0.6681 164 214
ID Description Score Start End Superfamily
af_A0A1D8PNH8_1039_1172_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.7054 159 222 3.40.50.10190
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.683 163 237 3.40.50.2300
af_A0A1D6LQI5_808_963_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6784 158 214 3.40.50.2300
af_Q2G119_4_242_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.6691 160 214 3.40.640.10
af_Q54YH4_1831_1968_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.669 163 214 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V1ZUI6-F1-model_v4 DUF116 domain-containing protein 0.9408 136 263
AF-A0A524H2Z2-F1-model_v4 DUF116 domain-containing protein 0.9334 127 264
AF-A0A2W4RXM2-F1-model_v4 DUF116 domain-containing protein 0.921 3 263 GO:0016020
AF-A0A2W4RXM2-F1-model_v4 DUF116 domain-containing protein 0.9078 3 263 GO:0016020
AF-A0A2V7NYM1-F1-model_v4 DUF116 domain-containing protein 0.8975 1 263 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.93 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map