F459761
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 212 | 529 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100013722|Ga0070680_1000137226 |
| Length | 319 |
| Sequence | VLDQRDDVGWSLGNGYGSGDNAIHPGTFCVGGADAGIGQEHTSNLTPMNHNVKLRSSMARAQLIHIEVDRRLGHEWDEWNGRPLPGGGDFSAPPGLFFRFAALTIVAATAAIALLLYLIGPRLRGLWRPLPSVQWIALATLAALSALYLGVLAVSYYSGRNLLPERLMERGLYLKLMNYTSLVARAFGKRDWVEHAAIDVYNTLALRRGRKVGKGELLVLIPRCLSKQALDGVLEIAGRYDVPVFVATRGQLARRVIRERRPRAVVAVACERDMMTGLRDVAGKLPVLGLTMQLPNGPCRDAAIDLEQMEKWVQGLVAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 124 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 134 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 135 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 136 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 156 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 157 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 160 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 182 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 183 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 184 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 185 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 186 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 187 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 192 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 193 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 194 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 195 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 196 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 210 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 211 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.48 |
| Rhizosphere | 94.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10002532 | 3300005328 | Bacteria | 9387 |
| 2 | Ga0070676_10048358 | 3300005328 | Bacteria | 2487 |
| 3 | Ga0070666_10035337 | 3300005335 | Bacteria | 3315 |
| 4 | Ga0070680_100013722 | 3300005336 | Bacteria | 6319 |
| 5 | Ga0070680_100107096 | 3300005336 | Bacteria | 2325 |
| 6 | Ga0070682_100206883 | 3300005337 | Bacteria | 1388 |
| 7 | Ga0070691_10195046 | 3300005341 | Unclassified | 1061 |
| 8 | Ga0070692_10026896 | 3300005345 | Bacteria | 2848 |
| 9 | Ga0070668_100086996 | 3300005347 | Bacteria | 2458 |
| 10 | Ga0070675_100036121 | 3300005354 | Bacteria | 4019 |
| 11 | Ga0070674_100036668 | 3300005356 | Bacteria | 3293 |
| 12 | Ga0070674_100454150 | 3300005356 | Unclassified | 1058 |
| 13 | Ga0070673_100072902 | 3300005364 | Unclassified | 2763 |
| 14 | Ga0070659_100056844 | 3300005366 | Bacteria | 3085 |
| 15 | Ga0070659_100070129 | 3300005366 | Bacteria | 2784 |
| 16 | Ga0070703_10025939 | 3300005406 | Unclassified | 1740 |
| 17 | Ga0070703_10026224 | 3300005406 | Unclassified | 1731 |
| 18 | Ga0070703_10028683 | 3300005406 | Unclassified | 1665 |
| 19 | Ga0070709_10003102 | 3300005434 | Bacteria | 8925 |
| 20 | Ga0070709_10017764 | 3300005434 | Bacteria | 4086 |
| 21 | Ga0070711_100001898 | 3300005439 | Bacteria | 11680 |
| 22 | Ga0070711_100002205 | 3300005439 | Bacteria | 11056 |
| 23 | Ga0070711_100053078 | 3300005439 | Bacteria | 2792 |
| 24 | Ga0070705_100001793 | 3300005440 | Bacteria | 11099 |
| 25 | Ga0070705_100008530 | 3300005440 | Bacteria | 5077 |
| 26 | Ga0070705_100018358 | 3300005440 | Bacteria | 3666 |
| 27 | Ga0070705_100020056 | 3300005440 | Bacteria | 3530 |
| 28 | Ga0070705_100021224 | 3300005440 | Bacteria | 3451 |
| 29 | Ga0070705_100022616 | 3300005440 | Bacteria | 3362 |
| 30 | Ga0070705_100035077 | 3300005440 | Unclassified | 2810 |
| 31 | Ga0070700_100089077 | 3300005441 | Bacteria | 2010 |
| 32 | Ga0070694_100000422 | 3300005444 | Bacteria | 23097 |
| 33 | Ga0070694_100000715 | 3300005444 | Bacteria | 18468 |
| 34 | Ga0070694_100004198 | 3300005444 | Bacteria | 8657 |
| 35 | Ga0070694_100039579 | 3300005444 | Bacteria | 3139 |
| 36 | Ga0070694_100061439 | 3300005444 | Bacteria | 2564 |
| 37 | Ga0070694_100065555 | 3300005444 | Unclassified | 2488 |
| 38 | Ga0070694_100083417 | 3300005444 | Unclassified | 2227 |
| 39 | Ga0070694_100115070 | 3300005444 | Unclassified | 1921 |
| 40 | Ga0070694_100125323 | 3300005444 | Bacteria | 1848 |
| 41 | Ga0070694_100271195 | 3300005444 | Bacteria | 1291 |
| 42 | Ga0070708_100003522 | 3300005445 | Bacteria | 12259 |
| 43 | Ga0070708_100005882 | 3300005445 | Bacteria | 9741 |
| 44 | Ga0070708_100007309 | 3300005445 | Bacteria | 8839 |
| 45 | Ga0070708_100038270 | 3300005445 | Bacteria | 4191 |
| 46 | Ga0070708_100100223 | 3300005445 | Bacteria | 2651 |
| 47 | Ga0070708_100103702 | 3300005445 | Bacteria | 2608 |
| 48 | Ga0070708_100455111 | 3300005445 | Unclassified | 1207 |
| 49 | Ga0070708_100855185 | 3300005445 | Unclassified | 854 |
| 50 | Ga0070663_100320789 | 3300005455 | Unclassified | 1246 |
| 51 | Ga0070678_100004832 | 3300005456 | Bacteria | 7694 |
| 52 | Ga0070678_100307052 | 3300005456 | Unclassified | 1350 |
| 53 | Ga0070662_100002098 | 3300005457 | Bacteria | 12226 |
| 54 | Ga0070662_100322427 | 3300005457 | Bacteria | 1260 |
| 55 | Ga0070662_100731273 | 3300005457 | Unclassified | 838 |
| 56 | Ga0070681_10055606 | 3300005458 | Bacteria | 3940 |
| 57 | Ga0070681_10241276 | 3300005458 | Unclassified | 1721 |
| 58 | Ga0070681_10355875 | 3300005458 | Bacteria | 1374 |
| 59 | Ga0068867_100003981 | 3300005459 | Bacteria | 10392 |
| 60 | Ga0068867_100066755 | 3300005459 | Bacteria | 2680 |
| 61 | Ga0070706_100016983 | 3300005467 | Bacteria | 6722 |
| 62 | Ga0070706_100068695 | 3300005467 | Bacteria | 3277 |
| 63 | Ga0070706_100093243 | 3300005467 | Bacteria | 2794 |
| 64 | Ga0070706_100510090 | 3300005467 | Bacteria | 1119 |
| 65 | Ga0070707_100001143 | 3300005468 | Bacteria | 26117 |
| 66 | Ga0070707_100020889 | 3300005468 | Bacteria | 6181 |
| 67 | Ga0070707_100033568 | 3300005468 | Bacteria | 4893 |
| 68 | Ga0070707_100053016 | 3300005468 | Bacteria | 3888 |
| 69 | Ga0070707_100057462 | 3300005468 | Bacteria | 3732 |
| 70 | Ga0070707_100070461 | 3300005468 | Bacteria | 3367 |
| 71 | Ga0070707_100080686 | 3300005468 | Bacteria | 3140 |
| 72 | Ga0070707_100081876 | 3300005468 | Bacteria | 3117 |
| 73 | Ga0070707_100247169 | 3300005468 | Unclassified | 1736 |
| 74 | Ga0070707_100340598 | 3300005468 | Bacteria | 1457 |
| 75 | Ga0070698_100000438 | 3300005471 | Bacteria | 44134 |
| 76 | Ga0070698_100036124 | 3300005471 | Bacteria | 5107 |
| 77 | Ga0070698_100052499 | 3300005471 | Unclassified | 4147 |
| 78 | Ga0070698_100086726 | 3300005471 | Bacteria | 3117 |
| 79 | Ga0070698_100207035 | 3300005471 | Bacteria | 1897 |
| 80 | Ga0070698_100234820 | 3300005471 | Bacteria | 1767 |
| 81 | Ga0070698_100236104 | 3300005471 | Bacteria | 1761 |
| 82 | Ga0070699_100000017 | 3300005518 | Bacteria | 201366 |
| 83 | Ga0070699_100003578 | 3300005518 | Bacteria | 13740 |
| 84 | Ga0070699_100012572 | 3300005518 | Bacteria | 7301 |
| 85 | Ga0070699_100023409 | 3300005518 | Bacteria | 5320 |
| 86 | Ga0070699_100038971 | 3300005518 | Bacteria | 4114 |
| 87 | Ga0070699_100060537 | 3300005518 | Bacteria | 3281 |
| 88 | Ga0070699_100101885 | 3300005518 | Bacteria | 2517 |
| 89 | Ga0070699_100112187 | 3300005518 | Bacteria | 2395 |
| 90 | Ga0070699_100127965 | 3300005518 | Bacteria | 2237 |
| 91 | Ga0070699_100132650 | 3300005518 | Bacteria | 2196 |
| 92 | Ga0070699_100135617 | 3300005518 | Bacteria | 2171 |
| 93 | Ga0070699_100452714 | 3300005518 | Bacteria | 1164 |
| 94 | Ga0070679_100025810 | 3300005530 | Bacteria | 5766 |
| 95 | Ga0070679_100073411 | 3300005530 | Bacteria | 3413 |
| 96 | Ga0070697_100012678 | 3300005536 | Bacteria | 6604 |
| 97 | Ga0070697_100016658 | 3300005536 | Bacteria | 5782 |
| 98 | Ga0070697_100141260 | 3300005536 | Bacteria | 2025 |
| 99 | Ga0070697_100178657 | 3300005536 | Unclassified | 1799 |
| 100 | Ga0070697_100179383 | 3300005536 | Bacteria | 1795 |
| 101 | Ga0070697_100184830 | 3300005536 | Unclassified | 1768 |
| 102 | Ga0070697_100193605 | 3300005536 | Bacteria | 1726 |
| 103 | Ga0070697_100236710 | 3300005536 | Unclassified | 1558 |
| 104 | Ga0068853_100206522 | 3300005539 | Bacteria | 1789 |
| 105 | Ga0070672_100157380 | 3300005543 | Bacteria | 1882 |
| 106 | Ga0070695_100006811 | 3300005545 | Bacteria | 6765 |
| 107 | Ga0070695_100008791 | 3300005545 | Bacteria | 6002 |
| 108 | Ga0070695_100010591 | 3300005545 | Bacteria | 5511 |
| 109 | Ga0070695_100017735 | 3300005545 | Bacteria | 4319 |
| 110 | Ga0070695_100040744 | 3300005545 | Bacteria | 2942 |
| 111 | Ga0070695_100080016 | 3300005545 | Unclassified | 2158 |
| 112 | Ga0070695_100109758 | 3300005545 | Bacteria | 1870 |
| 113 | Ga0070695_100247892 | 3300005545 | Bacteria | 1295 |
| 114 | Ga0070696_100000782 | 3300005546 | Bacteria | 20460 |
| 115 | Ga0070696_100003742 | 3300005546 | Bacteria | 10159 |
| 116 | Ga0070696_100007271 | 3300005546 | Bacteria | 7391 |
| 117 | Ga0070696_100012759 | 3300005546 | Bacteria | 5641 |
| 118 | Ga0070696_100019489 | 3300005546 | Bacteria | 4593 |
| 119 | Ga0070696_100039396 | 3300005546 | Bacteria | 3263 |
| 120 | Ga0070696_100078107 | 3300005546 | Unclassified | 2340 |
| 121 | Ga0070696_100156910 | 3300005546 | Bacteria | 1674 |
| 122 | Ga0070693_100022046 | 3300005547 | Bacteria | 3381 |
| 123 | Ga0070693_100208081 | 3300005547 | Bacteria | 1275 |
| 124 | Ga0070704_100001062 | 3300005549 | Bacteria | 14224 |
| 125 | Ga0070704_100002251 | 3300005549 | Bacteria | 10772 |
| 126 | Ga0070704_100006257 | 3300005549 | Bacteria | 7004 |
| 127 | Ga0070704_100007539 | 3300005549 | Bacteria | 6479 |
| 128 | Ga0070704_100009746 | 3300005549 | Bacteria | 5823 |
| 129 | Ga0070704_100013911 | 3300005549 | Bacteria | 5012 |
| 130 | Ga0070704_100020882 | 3300005549 | Bacteria | 4234 |
| 131 | Ga0070704_100022608 | 3300005549 | Unclassified | 4094 |
| 132 | Ga0070704_100023968 | 3300005549 | Bacteria | 3997 |
| 133 | Ga0070704_100118374 | 3300005549 | Bacteria | 2029 |
| 134 | Ga0070664_100109473 | 3300005564 | Bacteria | 2410 |
| 135 | Ga0070664_100110595 | 3300005564 | Bacteria | 2398 |
| 136 | Ga0068854_100004324 | 3300005578 | Bacteria | 8950 |
| 137 | Ga0070702_100004601 | 3300005615 | Bacteria | 6320 |
| 138 | Ga0070702_100034936 | 3300005615 | Bacteria | 2774 |
| 139 | Ga0068852_100350771 | 3300005616 | Bacteria | 1441 |
| 140 | Ga0068859_100060413 | 3300005617 | Bacteria | 3819 |
| 141 | Ga0068859_100368030 | 3300005617 | Bacteria | 1533 |
| 142 | Ga0068859_100432207 | 3300005617 | Bacteria | 1413 |
| 143 | Ga0068864_100468739 | 3300005618 | Bacteria | 1207 |
| 144 | Ga0068866_10000162 | 3300005718 | Bacteria | 30927 |
| 145 | Ga0068866_10095824 | 3300005718 | Unclassified | 1626 |
| 146 | Ga0068861_100065029 | 3300005719 | Bacteria | 2808 |
| 147 | Ga0068861_100071676 | 3300005719 | Bacteria | 2686 |
| 148 | Ga0068863_100012080 | 3300005841 | Bacteria | 8342 |
| 149 | Ga0068858_100043138 | 3300005842 | Bacteria | 4182 |
| 150 | Ga0068860_100081414 | 3300005843 | Bacteria | 3079 |
| 151 | Ga0068860_100120296 | 3300005843 | Bacteria | 2514 |
| 152 | Ga0068862_100071942 | 3300005844 | Bacteria | 2986 |
| 153 | Ga0068862_100663139 | 3300005844 | Bacteria | 1007 |
| 154 | Ga0081455_10013309 | 3300005937 | Bacteria | 8142 |
| 155 | Ga0070716_100103784 | 3300006173 | Unclassified | 1749 |
| 156 | Ga0070716_100125086 | 3300006173 | Bacteria | 1616 |
| 157 | Ga0070712_100042324 | 3300006175 | Unclassified | 3132 |
| 158 | Ga0097621_100099666 | 3300006237 | Bacteria | 2442 |
| 159 | Ga0068871_100750896 | 3300006358 | Unclassified | 897 |
| 160 | Ga0075428_100003541 | 3300006844 | Bacteria | 17102 |
| 161 | Ga0075428_100012452 | 3300006844 | Bacteria | 9459 |
| 162 | Ga0075428_100293735 | 3300006844 | Unclassified | 1748 |
| 163 | Ga0075428_100306488 | 3300006844 | Bacteria | 1707 |
| 164 | Ga0075430_100023884 | 3300006846 | Bacteria | 5206 |
| 165 | Ga0075430_100143369 | 3300006846 | Bacteria | 1989 |
| 166 | Ga0075430_100625597 | 3300006846 | Bacteria | 888 |
| 167 | Ga0075431_100004957 | 3300006847 | Bacteria | 13102 |
| 168 | Ga0075431_100065160 | 3300006847 | Bacteria | 3762 |
| 169 | Ga0075431_100075369 | 3300006847 | Bacteria | 3481 |
| 170 | Ga0075433_10001211 | 3300006852 | Bacteria | 18816 |
| 171 | Ga0075433_10006069 | 3300006852 | Bacteria | 9522 |
| 172 | Ga0075433_10009500 | 3300006852 | Bacteria | 7771 |
| 173 | Ga0075433_10057773 | 3300006852 | Bacteria | 3392 |
| 174 | Ga0075433_10074047 | 3300006852 | Bacteria | 2996 |
| 175 | Ga0075433_10095147 | 3300006852 | Bacteria | 2636 |
| 176 | Ga0075433_10110164 | 3300006852 | Unclassified | 2443 |
| 177 | Ga0075434_100006336 | 3300006871 | Bacteria | 10849 |
| 178 | Ga0075434_100008345 | 3300006871 | Bacteria | 9627 |
| 179 | Ga0075434_100015558 | 3300006871 | Bacteria | 7301 |
| 180 | Ga0075434_100190664 | 3300006871 | Bacteria | 2070 |
| 181 | Ga0075434_100360316 | 3300006871 | Bacteria | 1475 |
| 182 | Ga0075429_100012406 | 3300006880 | Bacteria | 7392 |
| 183 | Ga0075429_100023165 | 3300006880 | Bacteria | 5385 |
| 184 | Ga0075429_100270642 | 3300006880 | Unclassified | 1488 |
| 185 | Ga0075429_100342434 | 3300006880 | Bacteria | 1309 |
| 186 | Ga0068865_100001883 | 3300006881 | Bacteria | 12336 |
| 187 | Ga0068865_100075783 | 3300006881 | Bacteria | 2399 |
| 188 | Ga0075436_100001523 | 3300006914 | Bacteria | 15811 |
| 189 | Ga0075436_100004772 | 3300006914 | Bacteria | 9309 |
| 190 | Ga0075436_100005815 | 3300006914 | Bacteria | 8467 |
| 191 | Ga0075436_100064730 | 3300006914 | Bacteria | 2527 |
| 192 | Ga0075436_100091805 | 3300006914 | Bacteria | 2111 |
| 193 | Ga0075436_100114654 | 3300006914 | Bacteria | 1882 |
| 194 | Ga0075436_100138233 | 3300006914 | Bacteria | 1711 |
| 195 | Ga0075436_100172572 | 3300006914 | Bacteria | 1527 |
| 196 | Ga0075436_100258132 | 3300006914 | Unclassified | 1242 |
| 197 | Ga0097620_100060413 | 3300006931 | Bacteria | 3819 |
| 198 | Ga0097620_100368051 | 3300006931 | Bacteria | 1533 |
| 199 | Ga0097620_100432235 | 3300006931 | Bacteria | 1413 |
| 200 | Ga0075435_100155941 | 3300007076 | Unclassified | 1921 |
| 201 | Ga0075435_100317303 | 3300007076 | Bacteria | 1334 |
| 202 | Ga0075435_100415346 | 3300007076 | Unclassified | 1158 |
| 203 | Ga0099794_10000006 | 3300007265 | Bacteria | 130517 |
| 204 | Ga0099794_10018376 | 3300007265 | Unclassified | 3134 |
| 205 | Ga0105240_10096739 | 3300009093 | Bacteria | 3597 |
| 206 | Ga0111539_10459788 | 3300009094 | Bacteria | 1482 |
| 207 | Ga0111539_10573973 | 3300009094 | Bacteria | 1314 |
| 208 | Ga0111539_11218153 | 3300009094 | Bacteria | 874 |
| 209 | Ga0105245_10232427 | 3300009098 | Bacteria | 1784 |
| 210 | Ga0114129_10000596 | 3300009147 | Bacteria | 44594 |
| 211 | Ga0114129_10020622 | 3300009147 | Bacteria | 9370 |
| 212 | Ga0114129_10059112 | 3300009147 | Bacteria | 5360 |
| 213 | Ga0114129_10080448 | 3300009147 | Bacteria | 4529 |
| 214 | Ga0114129_10288433 | 3300009147 | Bacteria | 2191 |
| 215 | Ga0114129_10621233 | 3300009147 | Unclassified | 1398 |
| 216 | Ga0114129_10700340 | 3300009147 | Bacteria | 1302 |
| 217 | Ga0114129_10868586 | 3300009147 | Bacteria | 1145 |
| 218 | Ga0105243_10006593 | 3300009148 | Bacteria | 8967 |
| 219 | Ga0105241_10131060 | 3300009174 | Bacteria | 2030 |
| 220 | Ga0105242_10088942 | 3300009176 | Bacteria | 2595 |
| 221 | Ga0105248_10004746 | 3300009177 | Bacteria | 15049 |
| 222 | Ga0105248_10153825 | 3300009177 | Bacteria | 2595 |
| 223 | Ga0105248_10155375 | 3300009177 | Unclassified | 2581 |
| 224 | Ga0105248_10287670 | 3300009177 | Bacteria | 1851 |
| 225 | Ga0105249_10068419 | 3300009553 | Bacteria | 3275 |
| 226 | Ga0105249_10080883 | 3300009553 | Bacteria | 3019 |
| 227 | Ga0105239_10391139 | 3300010375 | Bacteria | 1573 |
| 228 | Ga0157371_10068091 | 3300013102 | Bacteria | 2519 |
| 229 | Ga0157378_10000489 | 3300013297 | Bacteria | 37509 |
| 230 | Ga0163162_10099364 | 3300013306 | Bacteria | 3001 |
| 231 | Ga0163162_10112124 | 3300013306 | Bacteria | 2826 |
| 232 | Ga0157372_10156599 | 3300013307 | Bacteria | 2632 |
| 233 | Ga0157375_10041058 | 3300013308 | Bacteria | 4465 |
| 234 | Ga0157375_10098096 | 3300013308 | Bacteria | 3006 |
| 235 | Ga0163163_10065097 | 3300014325 | Bacteria | 3617 |
| 236 | Ga0157379_10031115 | 3300014968 | Bacteria | 4754 |
| 237 | Ga0157379_10040410 | 3300014968 | Bacteria | 4163 |
| 238 | Ga0157379_10194271 | 3300014968 | Bacteria | 1834 |
| 239 | Ga0157376_10702457 | 3300014969 | Bacteria | 1016 |
| 240 | Ga0207653_10000039 | 3300025885 | Bacteria | 98540 |
| 241 | Ga0207653_10045870 | 3300025885 | Bacteria | 1444 |
| 242 | Ga0207642_10016994 | 3300025899 | Bacteria | 2756 |
| 243 | Ga0207699_10011498 | 3300025906 | Unclassified | 4473 |
| 244 | Ga0207645_10009047 | 3300025907 | Bacteria | 6912 |
| 245 | Ga0207684_10024190 | 3300025910 | Bacteria | 5180 |
| 246 | Ga0207684_10024609 | 3300025910 | Bacteria | 5133 |
| 247 | Ga0207684_10054876 | 3300025910 | Unclassified | 3381 |
| 248 | Ga0207684_10113636 | 3300025910 | Bacteria | 2318 |
| 249 | Ga0207684_10130894 | 3300025910 | Unclassified | 2153 |
| 250 | Ga0207684_10143210 | 3300025910 | Bacteria | 2056 |
| 251 | Ga0207707_10003433 | 3300025912 | Bacteria | 14056 |
| 252 | Ga0207707_10276070 | 3300025912 | Unclassified | 1456 |
| 253 | Ga0207695_10212021 | 3300025913 | Bacteria | 1847 |
| 254 | Ga0207693_10216023 | 3300025915 | Unclassified | 1507 |
| 255 | Ga0207663_10004104 | 3300025916 | Bacteria | 7220 |
| 256 | Ga0207663_10072040 | 3300025916 | Bacteria | 2232 |
| 257 | Ga0207660_10063105 | 3300025917 | Bacteria | 2670 |
| 258 | Ga0207660_10131327 | 3300025917 | Bacteria | 1907 |
| 259 | Ga0207660_10177086 | 3300025917 | Bacteria | 1654 |
| 260 | Ga0207652_10010866 | 3300025921 | Bacteria | 7336 |
| 261 | Ga0207652_10024223 | 3300025921 | Bacteria | 5034 |
| 262 | Ga0207646_10003946 | 3300025922 | Bacteria | 16451 |
| 263 | Ga0207646_10005811 | 3300025922 | Bacteria | 12915 |
| 264 | Ga0207646_10006611 | 3300025922 | Bacteria | 11969 |
| 265 | Ga0207646_10014155 | 3300025922 | Bacteria | 7585 |
| 266 | Ga0207646_10015171 | 3300025922 | Bacteria | 7289 |
| 267 | Ga0207646_10071120 | 3300025922 | Bacteria | 3107 |
| 268 | Ga0207646_10092695 | 3300025922 | Bacteria | 2704 |
| 269 | Ga0207646_10228304 | 3300025922 | Bacteria | 1682 |
| 270 | Ga0207646_10259494 | 3300025922 | Unclassified | 1570 |
| 271 | Ga0207646_10286207 | 3300025922 | Bacteria | 1489 |
| 272 | Ga0207659_10049626 | 3300025926 | Bacteria | 2978 |
| 273 | Ga0207700_10191447 | 3300025928 | Bacteria | 1719 |
| 274 | Ga0207690_10041795 | 3300025932 | Bacteria | 3007 |
| 275 | Ga0207690_10126440 | 3300025932 | Bacteria | 1865 |
| 276 | Ga0207706_10001874 | 3300025933 | Bacteria | 20609 |
| 277 | Ga0207706_10030452 | 3300025933 | Bacteria | 4813 |
| 278 | Ga0207706_10134527 | 3300025933 | Bacteria | 2174 |
| 279 | Ga0207686_10001992 | 3300025934 | Bacteria | 11253 |
| 280 | Ga0207709_10023137 | 3300025935 | Bacteria | 3533 |
| 281 | Ga0207669_10088257 | 3300025937 | Bacteria | 2010 |
| 282 | Ga0207704_10018151 | 3300025938 | Bacteria | 3666 |
| 283 | Ga0207665_10005019 | 3300025939 | Bacteria | 8833 |
| 284 | Ga0207665_10015849 | 3300025939 | Bacteria | 4947 |
| 285 | Ga0207665_10164014 | 3300025939 | Bacteria | 1600 |
| 286 | Ga0207691_10061910 | 3300025940 | Bacteria | 3398 |
| 287 | Ga0207711_10050853 | 3300025941 | Unclassified | 3549 |
| 288 | Ga0207711_10071410 | 3300025941 | Bacteria | 3012 |
| 289 | Ga0207689_10001812 | 3300025942 | Bacteria | 20170 |
| 290 | Ga0207651_10045036 | 3300025960 | Unclassified | 2957 |
| 291 | Ga0207712_10023746 | 3300025961 | Bacteria | 4051 |
| 292 | Ga0207640_10031008 | 3300025981 | Bacteria | 3299 |
| 293 | Ga0207640_10544158 | 3300025981 | Unclassified | 974 |
| 294 | Ga0207678_10332536 | 3300026067 | Bacteria | 1308 |
| 295 | Ga0207708_10101587 | 3300026075 | Bacteria | 2226 |
| 296 | Ga0207641_10026080 | 3300026088 | Bacteria | 4822 |
| 297 | Ga0207641_10052044 | 3300026088 | Bacteria | 3467 |
| 298 | Ga0207648_10054502 | 3300026089 | Bacteria | 3492 |
| 299 | Ga0207648_10692376 | 3300026089 | Unclassified | 944 |
| 300 | Ga0207676_10248538 | 3300026095 | Bacteria | 1600 |
| 301 | Ga0207676_10538118 | 3300026095 | Bacteria | 1114 |
| 302 | Ga0207675_100027615 | 3300026118 | Bacteria | 5286 |
| 303 | Ga0207675_100517488 | 3300026118 | Bacteria | 1189 |
| 304 | Ga0207683_10010959 | 3300026121 | Bacteria | 7731 |
| 305 | Ga0209588_1000174 | 3300027671 | Bacteria | 18110 |
| 306 | Ga0209588_1009449 | 3300027671 | Unclassified | 2915 |
| 307 | Ga0209588_1021135 | 3300027671 | Unclassified | 2042 |
| 308 | Ga0207428_10103366 | 3300027907 | Bacteria | 2199 |
| 309 | Ga0268265_10048914 | 3300028380 | Bacteria | 3177 |
| 310 | Ga0268264_10081558 | 3300028381 | Bacteria | 2765 |
| 311 | Ga0307408_100032932 | 3300031548 | Bacteria | 3617 |
| 312 | Ga0307408_100075741 | 3300031548 | Unclassified | 2501 |
| 313 | Ga0307408_100277665 | 3300031548 | Bacteria | 1394 |
| 314 | Ga0307408_100299142 | 3300031548 | Bacteria | 1347 |
| 315 | Ga0307405_10357900 | 3300031731 | Bacteria | 1128 |
| 316 | Ga0307413_10013993 | 3300031824 | Bacteria | 4058 |
| 317 | Ga0307413_10016091 | 3300031824 | Bacteria | 3852 |
| 318 | Ga0307413_10089965 | 3300031824 | Bacteria | 1996 |
| 319 | Ga0307413_10189049 | 3300031824 | Unclassified | 1476 |
| 320 | Ga0307413_10258584 | 3300031824 | Bacteria | 1296 |
| 321 | Ga0307410_10021783 | 3300031852 | Bacteria | 3948 |
| 322 | Ga0307410_10028598 | 3300031852 | Bacteria | 3539 |
| 323 | Ga0307410_10036711 | 3300031852 | Bacteria | 3194 |
| 324 | Ga0307410_10048100 | 3300031852 | Bacteria | 2854 |
| 325 | Ga0307410_10122157 | 3300031852 | Bacteria | 1901 |
| 326 | Ga0307410_10144885 | 3300031852 | Bacteria | 1762 |
| 327 | Ga0307410_10603061 | 3300031852 | Unclassified | 916 |
| 328 | Ga0307406_10022274 | 3300031901 | Bacteria | 3757 |
| 329 | Ga0307406_10056482 | 3300031901 | Unclassified | 2514 |
| 330 | Ga0307406_10087000 | 3300031901 | Bacteria | 2094 |
| 331 | Ga0307406_10321280 | 3300031901 | Bacteria | 1197 |
| 332 | Ga0307407_10022152 | 3300031903 | Bacteria | 3291 |
| 333 | Ga0307407_10041726 | 3300031903 | Bacteria | 2568 |
| 334 | Ga0307407_10104928 | 3300031903 | Bacteria | 1762 |
| 335 | Ga0307407_10183800 | 3300031903 | Bacteria | 1387 |
| 336 | Ga0307407_10196007 | 3300031903 | Unclassified | 1350 |
| 337 | Ga0307412_10048170 | 3300031911 | Bacteria | 2802 |
| 338 | Ga0307412_10097506 | 3300031911 | Bacteria | 2071 |
| 339 | Ga0307409_100004097 | 3300031995 | Bacteria | 8112 |
| 340 | Ga0307409_100008683 | 3300031995 | Bacteria | 6185 |
| 341 | Ga0307409_100088786 | 3300031995 | Bacteria | 2525 |
| 342 | Ga0307409_100096196 | 3300031995 | Bacteria | 2442 |
| 343 | Ga0307409_100103641 | 3300031995 | Unclassified | 2367 |
| 344 | Ga0307416_100026899 | 3300032002 | Bacteria | 4248 |
| 345 | Ga0307416_100074240 | 3300032002 | Bacteria | 2840 |
| 346 | Ga0307416_100264245 | 3300032002 | Bacteria | 1684 |
| 347 | Ga0307416_100290100 | 3300032002 | Unclassified | 1619 |
| 348 | Ga0307416_100323205 | 3300032002 | Bacteria | 1546 |
| 349 | Ga0307416_100497329 | 3300032002 | Unclassified | 1283 |
| 350 | Ga0307416_100741621 | 3300032002 | Unclassified | 1074 |
| 351 | Ga0307414_10016817 | 3300032004 | Bacteria | 4460 |
| 352 | Ga0307414_10102458 | 3300032004 | Bacteria | 2157 |
| 353 | Ga0307414_10251910 | 3300032004 | Unclassified | 1468 |
| 354 | Ga0307414_10260187 | 3300032004 | Bacteria | 1448 |
| 355 | Ga0307411_10000458 | 3300032005 | Bacteria | 14073 |
| 356 | Ga0307411_10036177 | 3300032005 | Unclassified | 3091 |
| 357 | Ga0307411_10053038 | 3300032005 | Bacteria | 2654 |
| 358 | Ga0307411_10075876 | 3300032005 | Bacteria | 2296 |
| 359 | Ga0307411_10091870 | 3300032005 | Bacteria | 2121 |
| 360 | Ga0307415_100001211 | 3300032126 | Bacteria | 12106 |
| 361 | Ga0307415_100066823 | 3300032126 | Bacteria | 2511 |
| 362 | Ga0307415_100691491 | 3300032126 | Bacteria | 919 |
| 363 | Ga0373931_0012661 | 3300035691 | Bacteria | 4091 |
| 364 | Ga0373931_0085446 | 3300035691 | Unclassified | 1749 |
| 365 | Ga0395905_0136790 | 3300037471 | Bacteria | 2305 |
| 366 | Ga0439454_022698 | 3300042011 | Bacteria | 937 |
| 367 | Ga0439446_0003258 | 3300042156 | Bacteria | 4007 |
| 368 | Ga0439446_0024405 | 3300042156 | Bacteria | 1725 |
| 369 | Ga0439446_0031353 | 3300042156 | Bacteria | 1538 |
| 370 | Ga0453683_0019207 | 3300044673 | Bacteria | 4378 |
| 371 | Ga0453684_0669916 | 3300044712 | Unclassified | 1130 |
| 372 | Ga0451576_0052930 | 3300045051 | Bacteria | 4253 |
| 373 | Ga0451576_0071111 | 3300045051 | Unclassified | 3621 |
| 374 | Ga0451576_0161317 | 3300045051 | Bacteria | 2340 |
| 375 | Ga0451576_0170066 | 3300045051 | Bacteria | 2274 |
| 376 | Ga0495603_0030886 | 3300046455 | Unclassified | 3226 |
| 377 | Ga0495603_0145592 | 3300046455 | Bacteria | 1377 |
| 378 | Ga0495580_0026814 | 3300046472 | Bacteria | 4197 |
| 379 | Ga0495594_0079934 | 3300046499 | Bacteria | 1825 |
| 380 | Ga0495663_0005526 | 3300046525 | Unclassified | 3508 |
| 381 | Ga0495609_0014486 | 3300046538 | Unclassified | 3705 |
| 382 | Ga0495636_0036747 | 3300047318 | Bacteria | 2021 |
| 383 | Ga0495677_0026939 | 3300047445 | Bacteria | 2085 |
| 384 | Ga0496101_0178479 | 3300048904 | Bacteria | 1634 |
| 385 | Ga0496101_0604284 | 3300048904 | Unclassified | 867 |
| 386 | Ga0496102_0015023 | 3300048905 | Bacteria | 6739 |
| 387 | Ga0496102_0018257 | 3300048905 | Bacteria | 6161 |
| 388 | Ga0496102_0050191 | 3300048905 | Bacteria | 3798 |
| 389 | Ga0496103_0020565 | 3300048906 | Bacteria | 3966 |
| 390 | Ga0496104_0002198 | 3300048907 | Bacteria | 16879 |
| 391 | Ga0496104_0040491 | 3300048907 | Bacteria | 4367 |
| 392 | Ga0496104_0076028 | 3300048907 | Bacteria | 3198 |
| 393 | Ga0496105_0011466 | 3300048908 | Bacteria | 7003 |
| 394 | Ga0496106_0009402 | 3300048909 | Bacteria | 7225 |
| 395 | Ga0496106_0029997 | 3300048909 | Bacteria | 4055 |
| 396 | Ga0496106_0297792 | 3300048909 | Unclassified | 1293 |
| 397 | Ga0496107_0266987 | 3300048910 | Bacteria | 1274 |
| 398 | Ga0496108_0000421 | 3300048911 | Bacteria | 34733 |
| 399 | Ga0496108_0004999 | 3300048911 | Bacteria | 10714 |
| 400 | Ga0496108_0037869 | 3300048911 | Bacteria | 4019 |
| 401 | Ga0496109_0009900 | 3300048912 | Bacteria | 8139 |
| 402 | Ga0496109_0017992 | 3300048912 | Bacteria | 6203 |
| 403 | Ga0496109_0126757 | 3300048912 | Bacteria | 2380 |
| 404 | Ga0496109_0204647 | 3300048912 | Unclassified | 1856 |
| 405 | Ga0496110_0005127 | 3300048913 | Bacteria | 10235 |
| 406 | Ga0496110_0007014 | 3300048913 | Bacteria | 8963 |
| 407 | Ga0496111_0025171 | 3300048914 | Bacteria | 4198 |
| 408 | Ga0496112_0020754 | 3300048915 | Bacteria | 6232 |
| 409 | Ga0496112_0052707 | 3300048915 | Bacteria | 3993 |
| 410 | Ga0496112_0078435 | 3300048915 | Bacteria | 3266 |
| 411 | Ga0496113_0000833 | 3300048916 | Bacteria | 16120 |
| 412 | Ga0496113_0010416 | 3300048916 | Bacteria | 6146 |
| 413 | Ga0501292_002004 | 3300049515 | Bacteria | 2576 |
| 414 | Ga0501033_0071838 | 3300049570 | Bacteria | 2542 |
| 415 | Ga0501034_0196134 | 3300049571 | Bacteria | 1979 |
| 416 | Ga0501036_0156461 | 3300049572 | Bacteria | 1922 |
| 417 | Ga0501038_0043662 | 3300049574 | Bacteria | 3897 |
| 418 | Ga0501039_0181456 | 3300049575 | Bacteria | 1655 |
| 419 | Ga0501040_0017235 | 3300049576 | Bacteria | 4795 |
| 420 | Ga0501040_0039390 | 3300049576 | Bacteria | 3214 |
| 421 | Ga0501041_0005693 | 3300049577 | Bacteria | 7282 |
| 422 | Ga0501041_0035992 | 3300049577 | Bacteria | 3000 |
| 423 | Ga0501046_0022468 | 3300049580 | Bacteria | 5197 |
| 424 | Ga0501046_0152155 | 3300049580 | Bacteria | 1745 |
| 425 | Ga0501047_0127325 | 3300049581 | Bacteria | 2427 |
| 426 | Ga0501048_0109615 | 3300049582 | Bacteria | 1949 |
| 427 | Ga0501067_0003178 | 3300049583 | Bacteria | 9065 |
| 428 | Ga0501067_0021962 | 3300049583 | Bacteria | 3531 |
| 429 | Ga0501067_0035184 | 3300049583 | Unclassified | 2781 |
| 430 | Ga0501068_0146262 | 3300049584 | Bacteria | 1483 |
| 431 | Ga0501068_0341765 | 3300049584 | Unclassified | 961 |
| 432 | Ga0501069_0000348 | 3300049585 | Bacteria | 20870 |
| 433 | Ga0501069_0000778 | 3300049585 | Bacteria | 14973 |
| 434 | Ga0501069_0021780 | 3300049585 | Bacteria | 3481 |
| 435 | Ga0501070_0036511 | 3300049586 | Bacteria | 4103 |
| 436 | Ga0501070_0183379 | 3300049586 | Unclassified | 1722 |
| 437 | Ga0501070_0238574 | 3300049586 | Bacteria | 1488 |
| 438 | Ga0501071_0002293 | 3300049587 | Bacteria | 11541 |
| 439 | Ga0501071_0005509 | 3300049587 | Bacteria | 8147 |
| 440 | Ga0501072_0017336 | 3300049588 | Bacteria | 5534 |
| 441 | Ga0501072_0043471 | 3300049588 | Bacteria | 3530 |
| 442 | Ga0501073_0004267 | 3300049589 | Bacteria | 10714 |
| 443 | Ga0501073_0137440 | 3300049589 | Bacteria | 1693 |
| 444 | Ga0501074_0076705 | 3300049590 | Bacteria | 2398 |
| 445 | Ga0501075_0009529 | 3300049591 | Bacteria | 6797 |
| 446 | Ga0501076_0008006 | 3300049592 | Bacteria | 7718 |
| 447 | Ga0501076_0015635 | 3300049592 | Bacteria | 5738 |
| 448 | Ga0501076_0130606 | 3300049592 | Bacteria | 2037 |
| 449 | Ga0501076_0430055 | 3300049592 | Bacteria | 1086 |
| 450 | Ga0501077_0000103 | 3300049593 | Bacteria | 44618 |
| 451 | Ga0501077_0017767 | 3300049593 | Bacteria | 4493 |
| 452 | Ga0501077_0336624 | 3300049593 | Unclassified | 962 |
| 453 | Ga0501209_005567 | 3300049656 | Bacteria | 2284 |
| 454 | Ga0501217_035127 | 3300049661 | Bacteria | 1252 |
| 455 | Ga0501243_006763 | 3300049675 | Bacteria | 1743 |
| 456 | Ga0501249_002491 | 3300049679 | Bacteria | 3720 |
| 457 | Ga0501250_009071 | 3300049680 | Bacteria | 1111 |
| 458 | Ga0501257_036596 | 3300049686 | Bacteria | 1196 |
| 459 | Ga0501079_0031191 | 3300049741 | Bacteria | 4096 |
| 460 | Ga0501079_0120595 | 3300049741 | Bacteria | 2039 |
| 461 | Ga0501080_0054080 | 3300049742 | Bacteria | 3739 |
| 462 | Ga0501080_0073547 | 3300049742 | Bacteria | 3180 |
| 463 | Ga0501080_0239192 | 3300049742 | Bacteria | 1657 |
| 464 | Ga0501080_0267263 | 3300049742 | Bacteria | 1557 |
| 465 | Ga0501081_0028467 | 3300049743 | Bacteria | 3771 |
| 466 | Ga0501081_0033747 | 3300049743 | Bacteria | 3479 |
| 467 | Ga0501081_0045048 | 3300049743 | Bacteria | 3029 |
| 468 | Ga0501083_0000964 | 3300049744 | Bacteria | 19033 |
| 469 | Ga0501083_0004725 | 3300049744 | Bacteria | 9623 |
| 470 | Ga0501262_003799 | 3300049759 | Bacteria | 1744 |
| 471 | Ga0501263_005668 | 3300049760 | Bacteria | 1417 |
| 472 | Ga0501268_003640 | 3300049765 | Bacteria | 2123 |
| 473 | Ga0501272_001252 | 3300049769 | Bacteria | 2378 |
| 474 | Ga0501273_006092 | 3300049770 | Bacteria | 1384 |
| 475 | Ga0501274_003512 | 3300049771 | Bacteria | 1265 |
| 476 | Ga0501035_0196417 | 3300049822 | Bacteria | 1733 |
| 477 | Ga0501045_0008481 | 3300049824 | Bacteria | 7164 |
| 478 | nmdc:mga05p37_102429_c1 | 3300050507 | Bacteria | 3526 |
| 479 | nmdc:mga05p37_26273_c1 | 3300050507 | Bacteria | 7081 |
| 480 | nmdc:mga05p37_29581_c1 | 3300050507 | Bacteria | 6684 |
| 481 | nmdc:mga05p37_520744_c1 | 3300050507 | Bacteria | 1360 |
| 482 | nmdc:mga09592_116117_c1 | 3300050508 | Bacteria | 2297 |
| 483 | nmdc:mga09592_12654_c1 | 3300050508 | Bacteria | 6878 |
| 484 | nmdc:mga09592_14338_c1 | 3300050508 | Bacteria | 6471 |
| 485 | nmdc:mga0qj67_216845_c1 | 3300050509 | Unclassified | 1554 |
| 486 | nmdc:mga0qj67_217925_c1 | 3300050509 | Unclassified | 1549 |
| 487 | nmdc:mga0qj67_536000_c1 | 3300050509 | Bacteria | 939 |
| 488 | nmdc:mga0qj67_67180_c1 | 3300050509 | Bacteria | 2856 |
| 489 | nmdc:mga06r32_188395_c1 | 3300050510 | Bacteria | 2050 |
| 490 | nmdc:mga06r32_2816_c1 | 3300050510 | Bacteria | 15591 |
| 491 | nmdc:mga06r32_354386_c1 | 3300050510 | Unclassified | 1452 |
| 492 | nmdc:mga06r32_52442_c1 | 3300050510 | Bacteria | 3907 |
| 493 | nmdc:mga08y16_894988_c1 | 3300050511 | Bacteria | 874 |
| 494 | nmdc:mga0n895_115097_c1 | 3300050512 | Unclassified | 2707 |
| 495 | nmdc:mga0n895_1246_c1 | 3300050512 | Bacteria | 18777 |
| 496 | nmdc:mga0n895_194645_c1 | 3300050512 | Bacteria | 2059 |
| 497 | nmdc:mga0n895_33282_c1 | 3300050512 | Bacteria | 4953 |
| 498 | nmdc:mga0n895_448_c1 | 3300050512 | Bacteria | 27643 |
| 499 | nmdc:mga0n895_53215_c1 | 3300050512 | Bacteria | 3977 |
| 500 | nmdc:mga0n895_59053_c1 | 3300050512 | Bacteria | 3785 |
| 501 | nmdc:mga0n895_6612_c1 | 3300050512 | Bacteria | 9870 |
| 502 | nmdc:mga0n895_770500_c1 | 3300050512 | Bacteria | 954 |
| 503 | nmdc:mga0rr50_18846_c1 | 3300050513 | Unclassified | 4645 |
| 504 | nmdc:mga08x19_10275_c1 | 3300050514 | Bacteria | 5618 |
| 505 | nmdc:mga08x19_144675_c1 | 3300050514 | Unclassified | 1607 |
| 506 | nmdc:mga08x19_178046_c1 | 3300050514 | Bacteria | 1451 |
| 507 | nmdc:mga08x19_38112_c1 | 3300050514 | Bacteria | 3053 |
| 508 | nmdc:mga08x19_443133_c1 | 3300050514 | Unclassified | 914 |
| 509 | nmdc:mga08x19_68080_c1 | 3300050514 | Bacteria | 2317 |
| 510 | nmdc:mga08x19_9576_c1 | 3300050514 | Bacteria | 5798 |
| 511 | nmdc:mga0a205_105075_c1 | 3300050515 | Bacteria | 2723 |
| 512 | nmdc:mga0a205_134589_c1 | 3300050515 | Bacteria | 2372 |
| 513 | nmdc:mga0a205_22021_c1 | 3300050515 | Bacteria | 6031 |
| 514 | nmdc:mga0a205_25865_c1 | 3300050515 | Bacteria | 5591 |
| 515 | nmdc:mga0a205_7164_c1 | 3300050515 | Bacteria | 10077 |
| 516 | nmdc:mga0a205_73401_c1 | 3300050515 | Unclassified | 3306 |
| 517 | nmdc:mga0a205_91482_c1 | 3300050515 | Unclassified | 2940 |
| 518 | Ga0501084_0009611 | 3300054114 | Bacteria | 7999 |
| 519 | Ga0501084_0017124 | 3300054114 | Bacteria | 6021 |
| 520 | Ga0501084_0053650 | 3300054114 | Bacteria | 3372 |
| 521 | Ga0590075_040643 | 3300059424 | Unclassified | 1188 |
| 522 | Ga0590075_048562 | 3300059424 | Unclassified | 1088 |
| 523 | Ga0590077_034582 | 3300059426 | Bacteria | 1111 |
| 524 | Ga0501082_0007952 | 3300060353 | Bacteria | 9158 |
| 525 | Ga0501082_0049497 | 3300060353 | Bacteria | 3624 |
| 526 | Ga0501082_0072364 | 3300060353 | Bacteria | 2969 |
| 527 | Ga0501082_0120051 | 3300060353 | Bacteria | 2278 |
| 528 | Ga0501082_0138816 | 3300060353 | Bacteria | 2109 |
| 529 | Ga0530510_0035503 | 3300061734 | Bacteria | 3593 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031903 | Ga0307407_10183800 | Ga0307407_101838002 | 232 |
| 2 | 3300031911 | Ga0307412_10097506 | Ga0307412_100975062 | 233 |
| 3 | 3300005441 | Ga0070700_100089077 | Ga0070700_1000890772 | 237 |
| 4 | 3300005444 | Ga0070694_100000422 | Ga0070694_10000042220 | 237 |
| 5 | 3300005468 | Ga0070707_100020889 | Ga0070707_1000208897 | 237 |
| 6 | 3300005518 | Ga0070699_100012572 | Ga0070699_1000125727 | 237 |
| 7 | 3300005536 | Ga0070697_100193605 | Ga0070697_1001936052 | 237 |
| 8 | 3300005545 | Ga0070695_100017735 | Ga0070695_1000177352 | 237 |
| 9 | 3300005546 | Ga0070696_100007271 | Ga0070696_1000072712 | 237 |
| 10 | 3300005549 | Ga0070704_100009746 | Ga0070704_1000097462 | 237 |
| 11 | 3300005844 | Ga0068862_100071942 | Ga0068862_1000719422 | 237 |
| 12 | 3300013306 | Ga0163162_10112124 | Ga0163162_101121242 | 237 |
| 13 | 3300013308 | Ga0157375_10098096 | Ga0157375_100980965 | 237 |
| 14 | 3300025922 | Ga0207646_10015171 | Ga0207646_100151712 | 237 |
| 15 | 3300028380 | Ga0268265_10048914 | Ga0268265_100489143 | 237 |
| 16 | 3300031824 | Ga0307413_10258584 | Ga0307413_102585842 | 237 |
| 17 | 3300031852 | Ga0307410_10028598 | Ga0307410_100285982 | 237 |
| 18 | 3300047318 | Ga0495636_0036747 | Ga0495636_0036747_1024_1818 | 237 |
| 19 | 3300005471 | Ga0070698_100236104 | Ga0070698_1002361042 | 240 |
| 20 | 3300046455 | Ga0495603_0030886 | Ga0495603_0030886_653_1447 | 241 |
| 21 | 3300046499 | Ga0495594_0079934 | Ga0495594_0079934_893_1687 | 241 |
| 22 | 3300005718 | Ga0068866_10095824 | Ga0068866_100958242 | 242 |
| 23 | 3300006844 | Ga0075428_100306488 | Ga0075428_1003064882 | 242 |
| 24 | 3300050508 | nmdc:mga09592_116117_c1 | nmdc:mga09592_116117_c1_1093_1890 | 242 |
| 25 | 3300005328 | Ga0070676_10048358 | Ga0070676_100483582 | 244 |
| 26 | 3300005440 | Ga0070705_100008530 | Ga0070705_1000085304 | 244 |
| 27 | 3300005445 | Ga0070708_100007309 | Ga0070708_1000073092 | 244 |
| 28 | 3300005468 | Ga0070707_100001143 | Ga0070707_1000011439 | 244 |
| 29 | 3300009553 | Ga0105249_10068419 | Ga0105249_100684192 | 244 |
| 30 | 3300013308 | Ga0157375_10041058 | Ga0157375_100410584 | 244 |
| 31 | 3300025922 | Ga0207646_10006611 | Ga0207646_100066114 | 244 |
| 32 | 3300044712 | Ga0453684_0669916 | Ga0453684_0669916_307_1101 | 244 |
| 33 | 3300045051 | Ga0451576_0170066 | Ga0451576_0170066_408_1202 | 244 |
| 34 | 3300009147 | Ga0114129_10288433 | Ga0114129_102884332 | 246 |
| 35 | 3300050512 | nmdc:mga0n895_194645_c1 | nmdc:mga0n895_194645_c1_443_1264 | 246 |
| 36 | 3300059424 | Ga0590075_040643 | Ga0590075_040643_198_992 | 246 |
| 37 | 3300059426 | Ga0590077_034582 | Ga0590077_034582_115_909 | 246 |
| 38 | 3300006844 | Ga0075428_100003541 | Ga0075428_10000354115 | 247 |
| 39 | 3300006846 | Ga0075430_100143369 | Ga0075430_1001433693 | 247 |
| 40 | 3300031548 | Ga0307408_100299142 | Ga0307408_1002991422 | 247 |
| 41 | 3300031901 | Ga0307406_10022274 | Ga0307406_100222745 | 247 |
| 42 | 3300032002 | Ga0307416_100323205 | Ga0307416_1003232052 | 247 |
| 43 | 3300050509 | nmdc:mga0qj67_67180_c1 | nmdc:mga0qj67_67180_c1_90_893 | 247 |
| 44 | 3300005468 | Ga0070707_100057462 | Ga0070707_1000574624 | 248 |
| 45 | 3300005546 | Ga0070696_100039396 | Ga0070696_1000393964 | 248 |
| 46 | 3300005471 | Ga0070698_100207035 | Ga0070698_1002070352 | 249 |
| 47 | 3300005471 | Ga0070698_100000438 | Ga0070698_10000043813 | 251 |
| 48 | 3300005518 | Ga0070699_100127965 | Ga0070699_1001279652 | 251 |
| 49 | 3300005536 | Ga0070697_100184830 | Ga0070697_1001848302 | 251 |
| 50 | 3300046525 | Ga0495663_0005526 | Ga0495663_0005526_993_1838 | 251 |
| 51 | 3300046538 | Ga0495609_0014486 | Ga0495609_0014486_399_1244 | 251 |
| 52 | 3300047445 | Ga0495677_0026939 | Ga0495677_0026939_287_1132 | 251 |
| 53 | 3300048904 | Ga0496101_0178479 | Ga0496101_0178479_774_1529 | 251 |
| 54 | 3300048905 | Ga0496102_0018257 | Ga0496102_0018257_5130_5885 | 251 |
| 55 | 3300048907 | Ga0496104_0002198 | Ga0496104_0002198_2851_3606 | 251 |
| 56 | 3300048908 | Ga0496105_0011466 | Ga0496105_0011466_5937_6692 | 251 |
| 57 | 3300049571 | Ga0501034_0196134 | Ga0501034_0196134_211_1017 | 251 |
| 58 | 3300050512 | nmdc:mga0n895_53215_c1 | nmdc:mga0n895_53215_c1_540_1295 | 251 |
| 59 | 3300005518 | Ga0070699_100452714 | Ga0070699_1004527142 | 252 |
| 60 | 3300005536 | Ga0070697_100179383 | Ga0070697_1001793832 | 252 |
| 61 | 3300005458 | Ga0070681_10355875 | Ga0070681_103558751 | 253 |
| 62 | 3300006358 | Ga0068871_100750896 | Ga0068871_1007508961 | 254 |
| 63 | 3300031995 | Ga0307409_100088786 | Ga0307409_1000887862 | 254 |
| 64 | 3300042156 | Ga0439446_0024405 | Ga0439446_0024405_695_1522 | 254 |
| 65 | 3300049592 | Ga0501076_0015635 | Ga0501076_0015635_4920_5714 | 254 |
| 66 | 3300049593 | Ga0501077_0000103 | Ga0501077_0000103_2860_3654 | 254 |
| 67 | 3300049741 | Ga0501079_0120595 | Ga0501079_0120595_116_910 | 254 |
| 68 | 3300049743 | Ga0501081_0033747 | Ga0501081_0033747_2655_3449 | 254 |
| 69 | 3300060353 | Ga0501082_0049497 | Ga0501082_0049497_75_869 | 254 |
| 70 | 3300005440 | Ga0070705_100018358 | Ga0070705_1000183582 | 255 |
| 71 | 3300005564 | Ga0070664_100109473 | Ga0070664_1001094733 | 255 |
| 72 | 3300005844 | Ga0068862_100663139 | Ga0068862_1006631392 | 255 |
| 73 | 3300005457 | Ga0070662_100731273 | Ga0070662_1007312731 | 256 |
| 74 | 3300005471 | Ga0070698_100052499 | Ga0070698_1000524992 | 256 |
| 75 | 3300032002 | Ga0307416_100741621 | Ga0307416_1007416211 | 256 |
| 76 | 3300050512 | nmdc:mga0n895_770500_c1 | nmdc:mga0n895_770500_c1_132_902 | 256 |
| 77 | 3300006880 | Ga0075429_100012406 | Ga0075429_1000124067 | 257 |
| 78 | 3300050508 | nmdc:mga09592_12654_c1 | nmdc:mga09592_12654_c1_3452_4249 | 257 |
| 79 | 3300005406 | Ga0070703_10026224 | Ga0070703_100262242 | 258 |
| 80 | 3300005468 | Ga0070707_100053016 | Ga0070707_1000530162 | 258 |
| 81 | 3300005518 | Ga0070699_100132650 | Ga0070699_1001326502 | 258 |
| 82 | 3300005564 | Ga0070664_100110595 | Ga0070664_1001105952 | 258 |
| 83 | 3300005617 | Ga0068859_100368030 | Ga0068859_1003680302 | 258 |
| 84 | 3300006931 | Ga0097620_100368051 | Ga0097620_1003680512 | 258 |
| 85 | 3300025910 | Ga0207684_10024190 | Ga0207684_100241902 | 258 |
| 86 | 3300025922 | Ga0207646_10005811 | Ga0207646_1000581111 | 258 |
| 87 | 3300025922 | Ga0207646_10228304 | Ga0207646_102283042 | 258 |
| 88 | 3300025939 | Ga0207665_10005019 | Ga0207665_100050198 | 258 |
| 89 | 3300031824 | Ga0307413_10089965 | Ga0307413_100899652 | 258 |
| 90 | 3300031852 | Ga0307410_10048100 | Ga0307410_100481002 | 258 |
| 91 | 3300031995 | Ga0307409_100008683 | Ga0307409_1000086832 | 258 |
| 92 | 3300032002 | Ga0307416_100074240 | Ga0307416_1000742401 | 258 |
| 93 | 3300005336 | Ga0070680_100013722 | Ga0070680_1000137226 | 259 |
| 94 | 3300005434 | Ga0070709_10003102 | Ga0070709_100031025 | 259 |
| 95 | 3300005444 | Ga0070694_100000715 | Ga0070694_1000007158 | 259 |
| 96 | 3300005518 | Ga0070699_100023409 | Ga0070699_1000234094 | 259 |
| 97 | 3300005518 | Ga0070699_100060537 | Ga0070699_1000605371 | 259 |
| 98 | 3300005518 | Ga0070699_100101885 | Ga0070699_1001018851 | 259 |
| 99 | 3300005545 | Ga0070695_100008791 | Ga0070695_1000087915 | 259 |
| 100 | 3300005549 | Ga0070704_100002251 | Ga0070704_1000022512 | 259 |
| 101 | 3300006852 | Ga0075433_10006069 | Ga0075433_100060696 | 259 |
| 102 | 3300006914 | Ga0075436_100005815 | Ga0075436_1000058157 | 259 |
| 103 | 3300006914 | Ga0075436_100138233 | Ga0075436_1001382332 | 259 |
| 104 | 3300025906 | Ga0207699_10011498 | Ga0207699_100114982 | 259 |
| 105 | 3300045051 | Ga0451576_0071111 | Ga0451576_0071111_588_1433 | 259 |
| 106 | 3300049570 | Ga0501033_0071838 | Ga0501033_0071838_1159_1953 | 259 |
| 107 | 3300049572 | Ga0501036_0156461 | Ga0501036_0156461_693_1487 | 259 |
| 108 | 3300049574 | Ga0501038_0043662 | Ga0501038_0043662_1680_2474 | 259 |
| 109 | 3300049576 | Ga0501040_0039390 | Ga0501040_0039390_706_1500 | 259 |
| 110 | 3300049577 | Ga0501041_0005693 | Ga0501041_0005693_40_834 | 259 |
| 111 | 3300049580 | Ga0501046_0022468 | Ga0501046_0022468_3540_4334 | 259 |
| 112 | 3300049582 | Ga0501048_0109615 | Ga0501048_0109615_511_1305 | 259 |
| 113 | 3300049584 | Ga0501068_0341765 | Ga0501068_0341765_70_864 | 259 |
| 114 | 3300049587 | Ga0501071_0002293 | Ga0501071_0002293_5668_6462 | 259 |
| 115 | 3300049588 | Ga0501072_0017336 | Ga0501072_0017336_881_1675 | 259 |
| 116 | 3300049593 | Ga0501077_0336624 | Ga0501077_0336624_36_830 | 259 |
| 117 | 3300049741 | Ga0501079_0031191 | Ga0501079_0031191_2323_3117 | 259 |
| 118 | 3300049742 | Ga0501080_0054080 | Ga0501080_0054080_706_1500 | 259 |
| 119 | 3300049743 | Ga0501081_0045048 | Ga0501081_0045048_1475_2269 | 259 |
| 120 | 3300049822 | Ga0501035_0196417 | Ga0501035_0196417_415_1209 | 259 |
| 121 | 3300049824 | Ga0501045_0008481 | Ga0501045_0008481_4946_5740 | 259 |
| 122 | 3300050514 | nmdc:mga08x19_10275_c1 | nmdc:mga08x19_10275_c1_3030_3869 | 259 |
| 123 | 3300050514 | nmdc:mga08x19_144675_c1 | nmdc:mga08x19_144675_c1_121_936 | 259 |
| 124 | 3300050515 | nmdc:mga0a205_73401_c1 | nmdc:mga0a205_73401_c1_1855_2694 | 259 |
| 125 | 3300054114 | Ga0501084_0017124 | Ga0501084_0017124_3938_4732 | 259 |
| 126 | 3300060353 | Ga0501082_0072364 | Ga0501082_0072364_1192_1986 | 259 |
| 127 | 3300005440 | Ga0070705_100001793 | Ga0070705_1000017937 | 261 |
| 128 | 3300027671 | Ga0209588_1021135 | Ga0209588_10211352 | 261 |
| 129 | 3300005545 | Ga0070695_100010591 | Ga0070695_1000105912 | 262 |
| 130 | 3300005545 | Ga0070695_100247892 | Ga0070695_1002478922 | 262 |
| 131 | 3300005549 | Ga0070704_100020882 | Ga0070704_1000208823 | 262 |
| 132 | 3300025910 | Ga0207684_10143210 | Ga0207684_101432102 | 262 |
| 133 | 3300005439 | Ga0070711_100001898 | Ga0070711_1000018987 | 263 |
| 134 | 3300005440 | Ga0070705_100035077 | Ga0070705_1000350772 | 263 |
| 135 | 3300005458 | Ga0070681_10055606 | Ga0070681_100556065 | 263 |
| 136 | 3300005518 | Ga0070699_100112187 | Ga0070699_1001121872 | 263 |
| 137 | 3300005536 | Ga0070697_100141260 | Ga0070697_1001412602 | 263 |
| 138 | 3300005546 | Ga0070696_100003742 | Ga0070696_1000037428 | 263 |
| 139 | 3300005549 | Ga0070704_100013911 | Ga0070704_1000139115 | 263 |
| 140 | 3300006175 | Ga0070712_100042324 | Ga0070712_1000423242 | 263 |
| 141 | 3300009177 | Ga0105248_10155375 | Ga0105248_101553751 | 263 |
| 142 | 3300025910 | Ga0207684_10130894 | Ga0207684_101308942 | 263 |
| 143 | 3300025915 | Ga0207693_10216023 | Ga0207693_102160232 | 263 |
| 144 | 3300045051 | Ga0451576_0161317 | Ga0451576_0161317_317_1135 | 263 |
| 145 | 3300005328 | Ga0070676_10002532 | Ga0070676_100025327 | 264 |
| 146 | 3300005335 | Ga0070666_10035337 | Ga0070666_100353372 | 264 |
| 147 | 3300005336 | Ga0070680_100107096 | Ga0070680_1001070963 | 264 |
| 148 | 3300005337 | Ga0070682_100206883 | Ga0070682_1002068831 | 264 |
| 149 | 3300005341 | Ga0070691_10195046 | Ga0070691_101950461 | 264 |
| 150 | 3300005345 | Ga0070692_10026896 | Ga0070692_100268963 | 264 |
| 151 | 3300005347 | Ga0070668_100086996 | Ga0070668_1000869962 | 264 |
| 152 | 3300005354 | Ga0070675_100036121 | Ga0070675_1000361212 | 264 |
| 153 | 3300005356 | Ga0070674_100036668 | Ga0070674_1000366682 | 264 |
| 154 | 3300005356 | Ga0070674_100454150 | Ga0070674_1004541501 | 264 |
| 155 | 3300005364 | Ga0070673_100072902 | Ga0070673_1000729023 | 264 |
| 156 | 3300005366 | Ga0070659_100056844 | Ga0070659_1000568442 | 264 |
| 157 | 3300005366 | Ga0070659_100070129 | Ga0070659_1000701292 | 264 |
| 158 | 3300005406 | Ga0070703_10025939 | Ga0070703_100259391 | 264 |
| 159 | 3300005406 | Ga0070703_10028683 | Ga0070703_100286832 | 264 |
| 160 | 3300005434 | Ga0070709_10017764 | Ga0070709_100177641 | 264 |
| 161 | 3300005439 | Ga0070711_100002205 | Ga0070711_1000022057 | 264 |
| 162 | 3300005439 | Ga0070711_100053078 | Ga0070711_1000530783 | 264 |
| 163 | 3300005440 | Ga0070705_100020056 | Ga0070705_1000200563 | 264 |
| 164 | 3300005440 | Ga0070705_100021224 | Ga0070705_1000212244 | 264 |
| 165 | 3300005440 | Ga0070705_100022616 | Ga0070705_1000226164 | 264 |
| 166 | 3300005444 | Ga0070694_100004198 | Ga0070694_1000041987 | 264 |
| 167 | 3300005444 | Ga0070694_100039579 | Ga0070694_1000395792 | 264 |
| 168 | 3300005444 | Ga0070694_100061439 | Ga0070694_1000614392 | 264 |
| 169 | 3300005444 | Ga0070694_100065555 | Ga0070694_1000655552 | 264 |
| 170 | 3300005444 | Ga0070694_100083417 | Ga0070694_1000834172 | 264 |
| 171 | 3300005444 | Ga0070694_100115070 | Ga0070694_1001150702 | 264 |
| 172 | 3300005444 | Ga0070694_100125323 | Ga0070694_1001253232 | 264 |
| 173 | 3300005444 | Ga0070694_100271195 | Ga0070694_1002711952 | 264 |
| 174 | 3300005445 | Ga0070708_100003522 | Ga0070708_1000035227 | 264 |
| 175 | 3300005445 | Ga0070708_100005882 | Ga0070708_1000058828 | 264 |
| 176 | 3300005445 | Ga0070708_100038270 | Ga0070708_1000382702 | 264 |
| 177 | 3300005445 | Ga0070708_100100223 | Ga0070708_1001002232 | 264 |
| 178 | 3300005445 | Ga0070708_100103702 | Ga0070708_1001037022 | 264 |
| 179 | 3300005445 | Ga0070708_100455111 | Ga0070708_1004551112 | 264 |
| 180 | 3300005445 | Ga0070708_100855185 | Ga0070708_1008551851 | 264 |
| 181 | 3300005455 | Ga0070663_100320789 | Ga0070663_1003207892 | 264 |
| 182 | 3300005456 | Ga0070678_100004832 | Ga0070678_1000048322 | 264 |
| 183 | 3300005456 | Ga0070678_100307052 | Ga0070678_1003070522 | 264 |
| 184 | 3300005457 | Ga0070662_100002098 | Ga0070662_10000209810 | 264 |
| 185 | 3300005457 | Ga0070662_100322427 | Ga0070662_1003224272 | 264 |
| 186 | 3300005458 | Ga0070681_10241276 | Ga0070681_102412762 | 264 |
| 187 | 3300005459 | Ga0068867_100003981 | Ga0068867_1000039811 | 264 |
| 188 | 3300005459 | Ga0068867_100066755 | Ga0068867_1000667552 | 264 |
| 189 | 3300005467 | Ga0070706_100016983 | Ga0070706_1000169836 | 264 |
| 190 | 3300005467 | Ga0070706_100068695 | Ga0070706_1000686952 | 264 |
| 191 | 3300005467 | Ga0070706_100093243 | Ga0070706_1000932433 | 264 |
| 192 | 3300005467 | Ga0070706_100510090 | Ga0070706_1005100901 | 264 |
| 193 | 3300005468 | Ga0070707_100033568 | Ga0070707_1000335685 | 264 |
| 194 | 3300005468 | Ga0070707_100070461 | Ga0070707_1000704611 | 264 |
| 195 | 3300005468 | Ga0070707_100080686 | Ga0070707_1000806863 | 264 |
| 196 | 3300005468 | Ga0070707_100081876 | Ga0070707_1000818762 | 264 |
| 197 | 3300005468 | Ga0070707_100247169 | Ga0070707_1002471692 | 264 |
| 198 | 3300005468 | Ga0070707_100340598 | Ga0070707_1003405982 | 264 |
| 199 | 3300005471 | Ga0070698_100036124 | Ga0070698_1000361241 | 264 |
| 200 | 3300005471 | Ga0070698_100086726 | Ga0070698_1000867264 | 264 |
| 201 | 3300005471 | Ga0070698_100234820 | Ga0070698_1002348202 | 264 |
| 202 | 3300005518 | Ga0070699_100000017 | Ga0070699_10000001791 | 264 |
| 203 | 3300005518 | Ga0070699_100003578 | Ga0070699_1000035785 | 264 |
| 204 | 3300005518 | Ga0070699_100038971 | Ga0070699_1000389714 | 264 |
| 205 | 3300005518 | Ga0070699_100135617 | Ga0070699_1001356171 | 264 |
| 206 | 3300005530 | Ga0070679_100025810 | Ga0070679_1000258103 | 264 |
| 207 | 3300005530 | Ga0070679_100073411 | Ga0070679_1000734111 | 264 |
| 208 | 3300005536 | Ga0070697_100012678 | Ga0070697_1000126784 | 264 |
| 209 | 3300005536 | Ga0070697_100016658 | Ga0070697_1000166585 | 264 |
| 210 | 3300005536 | Ga0070697_100178657 | Ga0070697_1001786572 | 264 |
| 211 | 3300005536 | Ga0070697_100236710 | Ga0070697_1002367102 | 264 |
| 212 | 3300005539 | Ga0068853_100206522 | Ga0068853_1002065222 | 264 |
| 213 | 3300005543 | Ga0070672_100157380 | Ga0070672_1001573802 | 264 |
| 214 | 3300005545 | Ga0070695_100006811 | Ga0070695_1000068112 | 264 |
| 215 | 3300005545 | Ga0070695_100040744 | Ga0070695_1000407443 | 264 |
| 216 | 3300005545 | Ga0070695_100080016 | Ga0070695_1000800162 | 264 |
| 217 | 3300005545 | Ga0070695_100109758 | Ga0070695_1001097582 | 264 |
| 218 | 3300005546 | Ga0070696_100000782 | Ga0070696_10000078215 | 264 |
| 219 | 3300005546 | Ga0070696_100012759 | Ga0070696_1000127593 | 264 |
| 220 | 3300005546 | Ga0070696_100019489 | Ga0070696_1000194894 | 264 |
| 221 | 3300005546 | Ga0070696_100078107 | Ga0070696_1000781072 | 264 |
| 222 | 3300005546 | Ga0070696_100156910 | Ga0070696_1001569102 | 264 |
| 223 | 3300005547 | Ga0070693_100022046 | Ga0070693_1000220462 | 264 |
| 224 | 3300005547 | Ga0070693_100208081 | Ga0070693_1002080811 | 264 |
| 225 | 3300005549 | Ga0070704_100001062 | Ga0070704_1000010627 | 264 |
| 226 | 3300005549 | Ga0070704_100006257 | Ga0070704_1000062572 | 264 |
| 227 | 3300005549 | Ga0070704_100007539 | Ga0070704_1000075395 | 264 |
| 228 | 3300005549 | Ga0070704_100022608 | Ga0070704_1000226083 | 264 |
| 229 | 3300005549 | Ga0070704_100023968 | Ga0070704_1000239682 | 264 |
| 230 | 3300005549 | Ga0070704_100118374 | Ga0070704_1001183742 | 264 |
| 231 | 3300005578 | Ga0068854_100004324 | Ga0068854_1000043242 | 264 |
| 232 | 3300005615 | Ga0070702_100004601 | Ga0070702_1000046013 | 264 |
| 233 | 3300005615 | Ga0070702_100034936 | Ga0070702_1000349362 | 264 |
| 234 | 3300005616 | Ga0068852_100350771 | Ga0068852_1003507712 | 264 |
| 235 | 3300005617 | Ga0068859_100060413 | Ga0068859_1000604131 | 264 |
| 236 | 3300005617 | Ga0068859_100432207 | Ga0068859_1004322072 | 264 |
| 237 | 3300005618 | Ga0068864_100468739 | Ga0068864_1004687392 | 264 |
| 238 | 3300005718 | Ga0068866_10000162 | Ga0068866_1000016223 | 264 |
| 239 | 3300005719 | Ga0068861_100065029 | Ga0068861_1000650292 | 264 |
| 240 | 3300005719 | Ga0068861_100071676 | Ga0068861_1000716762 | 264 |
| 241 | 3300005841 | Ga0068863_100012080 | Ga0068863_1000120805 | 264 |
| 242 | 3300005842 | Ga0068858_100043138 | Ga0068858_1000431383 | 264 |
| 243 | 3300005843 | Ga0068860_100081414 | Ga0068860_1000814142 | 264 |
| 244 | 3300005843 | Ga0068860_100120296 | Ga0068860_1001202962 | 264 |
| 245 | 3300005937 | Ga0081455_10013309 | Ga0081455_100133094 | 264 |
| 246 | 3300006173 | Ga0070716_100103784 | Ga0070716_1001037843 | 264 |
| 247 | 3300006173 | Ga0070716_100125086 | Ga0070716_1001250862 | 264 |
| 248 | 3300006237 | Ga0097621_100099666 | Ga0097621_1000996662 | 264 |
| 249 | 3300006844 | Ga0075428_100012452 | Ga0075428_1000124526 | 264 |
| 250 | 3300006844 | Ga0075428_100293735 | Ga0075428_1002937352 | 264 |
| 251 | 3300006846 | Ga0075430_100023884 | Ga0075430_1000238844 | 264 |
| 252 | 3300006846 | Ga0075430_100625597 | Ga0075430_1006255971 | 264 |
| 253 | 3300006847 | Ga0075431_100004957 | Ga0075431_1000049574 | 264 |
| 254 | 3300006847 | Ga0075431_100065160 | Ga0075431_1000651604 | 264 |
| 255 | 3300006847 | Ga0075431_100075369 | Ga0075431_1000753695 | 264 |
| 256 | 3300006852 | Ga0075433_10001211 | Ga0075433_100012117 | 264 |
| 257 | 3300006852 | Ga0075433_10009500 | Ga0075433_100095006 | 264 |
| 258 | 3300006852 | Ga0075433_10057773 | Ga0075433_100577733 | 264 |
| 259 | 3300006852 | Ga0075433_10074047 | Ga0075433_100740472 | 264 |
| 260 | 3300006852 | Ga0075433_10095147 | Ga0075433_100951473 | 264 |
| 261 | 3300006852 | Ga0075433_10110164 | Ga0075433_101101643 | 264 |
| 262 | 3300006871 | Ga0075434_100006336 | Ga0075434_1000063362 | 264 |
| 263 | 3300006871 | Ga0075434_100008345 | Ga0075434_1000083456 | 264 |
| 264 | 3300006871 | Ga0075434_100015558 | Ga0075434_1000155587 | 264 |
| 265 | 3300006871 | Ga0075434_100190664 | Ga0075434_1001906642 | 264 |
| 266 | 3300006871 | Ga0075434_100360316 | Ga0075434_1003603162 | 264 |
| 267 | 3300006880 | Ga0075429_100023165 | Ga0075429_1000231652 | 264 |
| 268 | 3300006880 | Ga0075429_100270642 | Ga0075429_1002706422 | 264 |
| 269 | 3300006880 | Ga0075429_100342434 | Ga0075429_1003424342 | 264 |
| 270 | 3300006881 | Ga0068865_100001883 | Ga0068865_1000018832 | 264 |
| 271 | 3300006881 | Ga0068865_100075783 | Ga0068865_1000757832 | 264 |
| 272 | 3300006914 | Ga0075436_100001523 | Ga0075436_10000152311 | 264 |
| 273 | 3300006914 | Ga0075436_100004772 | Ga0075436_1000047722 | 264 |
| 274 | 3300006914 | Ga0075436_100064730 | Ga0075436_1000647302 | 264 |
| 275 | 3300006914 | Ga0075436_100091805 | Ga0075436_1000918053 | 264 |
| 276 | 3300006914 | Ga0075436_100114654 | Ga0075436_1001146543 | 264 |
| 277 | 3300006914 | Ga0075436_100172572 | Ga0075436_1001725722 | 264 |
| 278 | 3300006914 | Ga0075436_100258132 | Ga0075436_1002581322 | 264 |
| 279 | 3300006931 | Ga0097620_100060413 | Ga0097620_1000604131 | 264 |
| 280 | 3300006931 | Ga0097620_100432235 | Ga0097620_1004322352 | 264 |
| 281 | 3300007076 | Ga0075435_100155941 | Ga0075435_1001559412 | 264 |
| 282 | 3300007076 | Ga0075435_100317303 | Ga0075435_1003173031 | 264 |
| 283 | 3300007076 | Ga0075435_100415346 | Ga0075435_1004153462 | 264 |
| 284 | 3300007265 | Ga0099794_10000006 | Ga0099794_1000000618 | 264 |
| 285 | 3300007265 | Ga0099794_10018376 | Ga0099794_100183763 | 264 |
| 286 | 3300009093 | Ga0105240_10096739 | Ga0105240_100967392 | 264 |
| 287 | 3300009094 | Ga0111539_10459788 | Ga0111539_104597882 | 264 |
| 288 | 3300009094 | Ga0111539_10573973 | Ga0111539_105739732 | 264 |
| 289 | 3300009094 | Ga0111539_11218153 | Ga0111539_112181531 | 264 |
| 290 | 3300009098 | Ga0105245_10232427 | Ga0105245_102324272 | 264 |
| 291 | 3300009147 | Ga0114129_10000596 | Ga0114129_100005963 | 264 |
| 292 | 3300009147 | Ga0114129_10020622 | Ga0114129_100206225 | 264 |
| 293 | 3300009147 | Ga0114129_10059112 | Ga0114129_100591123 | 264 |
| 294 | 3300009147 | Ga0114129_10080448 | Ga0114129_100804484 | 264 |
| 295 | 3300009147 | Ga0114129_10621233 | Ga0114129_106212331 | 264 |
| 296 | 3300009147 | Ga0114129_10700340 | Ga0114129_107003401 | 264 |
| 297 | 3300009147 | Ga0114129_10868586 | Ga0114129_108685862 | 264 |
| 298 | 3300009148 | Ga0105243_10006593 | Ga0105243_100065932 | 264 |
| 299 | 3300009174 | Ga0105241_10131060 | Ga0105241_101310602 | 264 |
| 300 | 3300009176 | Ga0105242_10088942 | Ga0105242_100889422 | 264 |
| 301 | 3300009177 | Ga0105248_10004746 | Ga0105248_1000474617 | 264 |
| 302 | 3300009177 | Ga0105248_10153825 | Ga0105248_101538252 | 264 |
| 303 | 3300009177 | Ga0105248_10287670 | Ga0105248_102876703 | 264 |
| 304 | 3300009553 | Ga0105249_10080883 | Ga0105249_100808832 | 264 |
| 305 | 3300010375 | Ga0105239_10391139 | Ga0105239_103911392 | 264 |
| 306 | 3300013102 | Ga0157371_10068091 | Ga0157371_100680912 | 264 |
| 307 | 3300013297 | Ga0157378_10000489 | Ga0157378_1000048921 | 264 |
| 308 | 3300013306 | Ga0163162_10099364 | Ga0163162_100993642 | 264 |
| 309 | 3300013307 | Ga0157372_10156599 | Ga0157372_101565991 | 264 |
| 310 | 3300014325 | Ga0163163_10065097 | Ga0163163_100650973 | 264 |
| 311 | 3300014968 | Ga0157379_10031115 | Ga0157379_100311154 | 264 |
| 312 | 3300014968 | Ga0157379_10040410 | Ga0157379_100404102 | 264 |
| 313 | 3300014968 | Ga0157379_10194271 | Ga0157379_101942712 | 264 |
| 314 | 3300014969 | Ga0157376_10702457 | Ga0157376_107024572 | 264 |
| 315 | 3300025885 | Ga0207653_10000039 | Ga0207653_1000003931 | 264 |
| 316 | 3300025885 | Ga0207653_10045870 | Ga0207653_100458702 | 264 |
| 317 | 3300025899 | Ga0207642_10016994 | Ga0207642_100169943 | 264 |
| 318 | 3300025907 | Ga0207645_10009047 | Ga0207645_100090472 | 264 |
| 319 | 3300025910 | Ga0207684_10024609 | Ga0207684_100246097 | 264 |
| 320 | 3300025910 | Ga0207684_10054876 | Ga0207684_100548762 | 264 |
| 321 | 3300025910 | Ga0207684_10113636 | Ga0207684_101136363 | 264 |
| 322 | 3300025912 | Ga0207707_10003433 | Ga0207707_100034337 | 264 |
| 323 | 3300025912 | Ga0207707_10276070 | Ga0207707_102760702 | 264 |
| 324 | 3300025913 | Ga0207695_10212021 | Ga0207695_102120212 | 264 |
| 325 | 3300025916 | Ga0207663_10004104 | Ga0207663_100041043 | 264 |
| 326 | 3300025916 | Ga0207663_10072040 | Ga0207663_100720403 | 264 |
| 327 | 3300025917 | Ga0207660_10063105 | Ga0207660_100631052 | 264 |
| 328 | 3300025917 | Ga0207660_10131327 | Ga0207660_101313272 | 264 |
| 329 | 3300025917 | Ga0207660_10177086 | Ga0207660_101770861 | 264 |
| 330 | 3300025921 | Ga0207652_10010866 | Ga0207652_100108665 | 264 |
| 331 | 3300025921 | Ga0207652_10024223 | Ga0207652_100242235 | 264 |
| 332 | 3300025922 | Ga0207646_10003946 | Ga0207646_100039462 | 264 |
| 333 | 3300025922 | Ga0207646_10014155 | Ga0207646_100141554 | 264 |
| 334 | 3300025922 | Ga0207646_10071120 | Ga0207646_100711201 | 264 |
| 335 | 3300025922 | Ga0207646_10092695 | Ga0207646_100926952 | 264 |
| 336 | 3300025922 | Ga0207646_10259494 | Ga0207646_102594942 | 264 |
| 337 | 3300025922 | Ga0207646_10286207 | Ga0207646_102862072 | 264 |
| 338 | 3300025926 | Ga0207659_10049626 | Ga0207659_100496262 | 264 |
| 339 | 3300025928 | Ga0207700_10191447 | Ga0207700_101914472 | 264 |
| 340 | 3300025932 | Ga0207690_10041795 | Ga0207690_100417952 | 264 |
| 341 | 3300025932 | Ga0207690_10126440 | Ga0207690_101264401 | 264 |
| 342 | 3300025933 | Ga0207706_10001874 | Ga0207706_1000187417 | 264 |
| 343 | 3300025933 | Ga0207706_10030452 | Ga0207706_100304521 | 264 |
| 344 | 3300025933 | Ga0207706_10134527 | Ga0207706_101345272 | 264 |
| 345 | 3300025934 | Ga0207686_10001992 | Ga0207686_100019922 | 264 |
| 346 | 3300025935 | Ga0207709_10023137 | Ga0207709_100231373 | 264 |
| 347 | 3300025937 | Ga0207669_10088257 | Ga0207669_100882573 | 264 |
| 348 | 3300025938 | Ga0207704_10018151 | Ga0207704_100181513 | 264 |
| 349 | 3300025939 | Ga0207665_10015849 | Ga0207665_100158496 | 264 |
| 350 | 3300025939 | Ga0207665_10164014 | Ga0207665_101640142 | 264 |
| 351 | 3300025940 | Ga0207691_10061910 | Ga0207691_100619102 | 264 |
| 352 | 3300025941 | Ga0207711_10050853 | Ga0207711_100508532 | 264 |
| 353 | 3300025941 | Ga0207711_10071410 | Ga0207711_100714102 | 264 |
| 354 | 3300025942 | Ga0207689_10001812 | Ga0207689_1000181218 | 264 |
| 355 | 3300025960 | Ga0207651_10045036 | Ga0207651_100450362 | 264 |
| 356 | 3300025961 | Ga0207712_10023746 | Ga0207712_100237463 | 264 |
| 357 | 3300025981 | Ga0207640_10031008 | Ga0207640_100310082 | 264 |
| 358 | 3300025981 | Ga0207640_10544158 | Ga0207640_105441581 | 264 |
| 359 | 3300026067 | Ga0207678_10332536 | Ga0207678_103325362 | 264 |
| 360 | 3300026075 | Ga0207708_10101587 | Ga0207708_101015872 | 264 |
| 361 | 3300026088 | Ga0207641_10026080 | Ga0207641_100260805 | 264 |
| 362 | 3300026088 | Ga0207641_10052044 | Ga0207641_100520444 | 264 |
| 363 | 3300026089 | Ga0207648_10054502 | Ga0207648_100545023 | 264 |
| 364 | 3300026089 | Ga0207648_10692376 | Ga0207648_106923761 | 264 |
| 365 | 3300026095 | Ga0207676_10248538 | Ga0207676_102485382 | 264 |
| 366 | 3300026095 | Ga0207676_10538118 | Ga0207676_105381181 | 264 |
| 367 | 3300026118 | Ga0207675_100027615 | Ga0207675_1000276153 | 264 |
| 368 | 3300026118 | Ga0207675_100517488 | Ga0207675_1005174882 | 264 |
| 369 | 3300026121 | Ga0207683_10010959 | Ga0207683_100109597 | 264 |
| 370 | 3300027671 | Ga0209588_1000174 | Ga0209588_10001744 | 264 |
| 371 | 3300027671 | Ga0209588_1009449 | Ga0209588_10094492 | 264 |
| 372 | 3300027907 | Ga0207428_10103366 | Ga0207428_101033662 | 264 |
| 373 | 3300028381 | Ga0268264_10081558 | Ga0268264_100815582 | 264 |
| 374 | 3300031548 | Ga0307408_100032932 | Ga0307408_1000329323 | 264 |
| 375 | 3300031548 | Ga0307408_100075741 | Ga0307408_1000757412 | 264 |
| 376 | 3300031548 | Ga0307408_100277665 | Ga0307408_1002776652 | 264 |
| 377 | 3300031731 | Ga0307405_10357900 | Ga0307405_103579002 | 264 |
| 378 | 3300031824 | Ga0307413_10013993 | Ga0307413_100139932 | 264 |
| 379 | 3300031824 | Ga0307413_10016091 | Ga0307413_100160911 | 264 |
| 380 | 3300031824 | Ga0307413_10189049 | Ga0307413_101890491 | 264 |
| 381 | 3300031852 | Ga0307410_10021783 | Ga0307410_100217834 | 264 |
| 382 | 3300031852 | Ga0307410_10036711 | Ga0307410_100367113 | 264 |
| 383 | 3300031852 | Ga0307410_10122157 | Ga0307410_101221572 | 264 |
| 384 | 3300031852 | Ga0307410_10144885 | Ga0307410_101448851 | 264 |
| 385 | 3300031852 | Ga0307410_10603061 | Ga0307410_106030612 | 264 |
| 386 | 3300031901 | Ga0307406_10056482 | Ga0307406_100564822 | 264 |
| 387 | 3300031901 | Ga0307406_10087000 | Ga0307406_100870002 | 264 |
| 388 | 3300031901 | Ga0307406_10321280 | Ga0307406_103212803 | 264 |
| 389 | 3300031903 | Ga0307407_10022152 | Ga0307407_100221522 | 264 |
| 390 | 3300031903 | Ga0307407_10041726 | Ga0307407_100417263 | 264 |
| 391 | 3300031903 | Ga0307407_10104928 | Ga0307407_101049283 | 264 |
| 392 | 3300031903 | Ga0307407_10196007 | Ga0307407_101960072 | 264 |
| 393 | 3300031911 | Ga0307412_10048170 | Ga0307412_100481703 | 264 |
| 394 | 3300031995 | Ga0307409_100004097 | Ga0307409_1000040974 | 264 |
| 395 | 3300031995 | Ga0307409_100096196 | Ga0307409_1000961963 | 264 |
| 396 | 3300031995 | Ga0307409_100103641 | Ga0307409_1001036413 | 264 |
| 397 | 3300032002 | Ga0307416_100026899 | Ga0307416_1000268993 | 264 |
| 398 | 3300032002 | Ga0307416_100264245 | Ga0307416_1002642452 | 264 |
| 399 | 3300032002 | Ga0307416_100290100 | Ga0307416_1002901002 | 264 |
| 400 | 3300032002 | Ga0307416_100497329 | Ga0307416_1004973292 | 264 |
| 401 | 3300032004 | Ga0307414_10016817 | Ga0307414_100168175 | 264 |
| 402 | 3300032004 | Ga0307414_10102458 | Ga0307414_101024582 | 264 |
| 403 | 3300032004 | Ga0307414_10251910 | Ga0307414_102519102 | 264 |
| 404 | 3300032004 | Ga0307414_10260187 | Ga0307414_102601872 | 264 |
| 405 | 3300032005 | Ga0307411_10000458 | Ga0307411_100004583 | 264 |
| 406 | 3300032005 | Ga0307411_10036177 | Ga0307411_100361771 | 264 |
| 407 | 3300032005 | Ga0307411_10053038 | Ga0307411_100530382 | 264 |
| 408 | 3300032005 | Ga0307411_10075876 | Ga0307411_100758762 | 264 |
| 409 | 3300032005 | Ga0307411_10091870 | Ga0307411_100918702 | 264 |
| 410 | 3300032126 | Ga0307415_100001211 | Ga0307415_1000012111 | 264 |
| 411 | 3300032126 | Ga0307415_100066823 | Ga0307415_1000668231 | 264 |
| 412 | 3300032126 | Ga0307415_100691491 | Ga0307415_1006914911 | 264 |
| 413 | 3300035691 | Ga0373931_0012661 | Ga0373931_0012661_2307_3101 | 264 |
| 414 | 3300035691 | Ga0373931_0085446 | Ga0373931_0085446_789_1583 | 264 |
| 415 | 3300037471 | Ga0395905_0136790 | Ga0395905_0136790_81_875 | 264 |
| 416 | 3300042011 | Ga0439454_022698 | Ga0439454_022698_19_813 | 264 |
| 417 | 3300042156 | Ga0439446_0003258 | Ga0439446_0003258_192_1013 | 264 |
| 418 | 3300042156 | Ga0439446_0031353 | Ga0439446_0031353_212_1006 | 264 |
| 419 | 3300044673 | Ga0453683_0019207 | Ga0453683_0019207_2999_3826 | 264 |
| 420 | 3300045051 | Ga0451576_0052930 | Ga0451576_0052930_1844_2671 | 264 |
| 421 | 3300046455 | Ga0495603_0145592 | Ga0495603_0145592_88_882 | 264 |
| 422 | 3300046472 | Ga0495580_0026814 | Ga0495580_0026814_1050_1865 | 264 |
| 423 | 3300048904 | Ga0496101_0604284 | Ga0496101_0604284_36_830 | 264 |
| 424 | 3300048905 | Ga0496102_0015023 | Ga0496102_0015023_5749_6579 | 264 |
| 425 | 3300048905 | Ga0496102_0050191 | Ga0496102_0050191_142_936 | 264 |
| 426 | 3300048906 | Ga0496103_0020565 | Ga0496103_0020565_749_1567 | 264 |
| 427 | 3300048907 | Ga0496104_0040491 | Ga0496104_0040491_1251_2045 | 264 |
| 428 | 3300048907 | Ga0496104_0076028 | Ga0496104_0076028_1869_2663 | 264 |
| 429 | 3300048909 | Ga0496106_0009402 | Ga0496106_0009402_5418_6236 | 264 |
| 430 | 3300048909 | Ga0496106_0029997 | Ga0496106_0029997_126_920 | 264 |
| 431 | 3300048909 | Ga0496106_0297792 | Ga0496106_0297792_236_1030 | 264 |
| 432 | 3300048910 | Ga0496107_0266987 | Ga0496107_0266987_427_1221 | 264 |
| 433 | 3300048911 | Ga0496108_0000421 | Ga0496108_0000421_20898_21716 | 264 |
| 434 | 3300048911 | Ga0496108_0004999 | Ga0496108_0004999_3039_3833 | 264 |
| 435 | 3300048911 | Ga0496108_0037869 | Ga0496108_0037869_1424_2218 | 264 |
| 436 | 3300048912 | Ga0496109_0009900 | Ga0496109_0009900_6783_7601 | 264 |
| 437 | 3300048912 | Ga0496109_0017992 | Ga0496109_0017992_2377_3171 | 264 |
| 438 | 3300048912 | Ga0496109_0126757 | Ga0496109_0126757_1321_2115 | 264 |
| 439 | 3300048912 | Ga0496109_0204647 | Ga0496109_0204647_815_1609 | 264 |
| 440 | 3300048913 | Ga0496110_0005127 | Ga0496110_0005127_3541_4359 | 264 |
| 441 | 3300048913 | Ga0496110_0007014 | Ga0496110_0007014_2326_3120 | 264 |
| 442 | 3300048914 | Ga0496111_0025171 | Ga0496111_0025171_3073_3891 | 264 |
| 443 | 3300048915 | Ga0496112_0020754 | Ga0496112_0020754_3062_3856 | 264 |
| 444 | 3300048915 | Ga0496112_0052707 | Ga0496112_0052707_2780_3574 | 264 |
| 445 | 3300048915 | Ga0496112_0078435 | Ga0496112_0078435_188_1006 | 264 |
| 446 | 3300048916 | Ga0496113_0000833 | Ga0496113_0000833_7813_8631 | 264 |
| 447 | 3300048916 | Ga0496113_0010416 | Ga0496113_0010416_2316_3110 | 264 |
| 448 | 3300049515 | Ga0501292_002004 | Ga0501292_002004_181_978 | 264 |
| 449 | 3300049575 | Ga0501039_0181456 | Ga0501039_0181456_727_1521 | 264 |
| 450 | 3300049576 | Ga0501040_0017235 | Ga0501040_0017235_3341_4135 | 264 |
| 451 | 3300049577 | Ga0501041_0035992 | Ga0501041_0035992_1111_1905 | 264 |
| 452 | 3300049580 | Ga0501046_0152155 | Ga0501046_0152155_641_1435 | 264 |
| 453 | 3300049581 | Ga0501047_0127325 | Ga0501047_0127325_1415_2239 | 264 |
| 454 | 3300049583 | Ga0501067_0003178 | Ga0501067_0003178_604_1428 | 264 |
| 455 | 3300049583 | Ga0501067_0021962 | Ga0501067_0021962_666_1460 | 264 |
| 456 | 3300049583 | Ga0501067_0035184 | Ga0501067_0035184_1687_2481 | 264 |
| 457 | 3300049584 | Ga0501068_0146262 | Ga0501068_0146262_503_1327 | 264 |
| 458 | 3300049585 | Ga0501069_0000348 | Ga0501069_0000348_6406_7230 | 264 |
| 459 | 3300049585 | Ga0501069_0000778 | Ga0501069_0000778_12423_13247 | 264 |
| 460 | 3300049585 | Ga0501069_0021780 | Ga0501069_0021780_274_1077 | 264 |
| 461 | 3300049586 | Ga0501070_0036511 | Ga0501070_0036511_2823_3647 | 264 |
| 462 | 3300049586 | Ga0501070_0183379 | Ga0501070_0183379_304_1107 | 264 |
| 463 | 3300049586 | Ga0501070_0238574 | Ga0501070_0238574_211_1035 | 264 |
| 464 | 3300049587 | Ga0501071_0005509 | Ga0501071_0005509_581_1405 | 264 |
| 465 | 3300049588 | Ga0501072_0043471 | Ga0501072_0043471_1839_2663 | 264 |
| 466 | 3300049589 | Ga0501073_0004267 | Ga0501073_0004267_554_1378 | 264 |
| 467 | 3300049589 | Ga0501073_0137440 | Ga0501073_0137440_185_1009 | 264 |
| 468 | 3300049590 | Ga0501074_0076705 | Ga0501074_0076705_1521_2345 | 264 |
| 469 | 3300049591 | Ga0501075_0009529 | Ga0501075_0009529_3588_4382 | 264 |
| 470 | 3300049592 | Ga0501076_0008006 | Ga0501076_0008006_4555_5349 | 264 |
| 471 | 3300049592 | Ga0501076_0130606 | Ga0501076_0130606_723_1547 | 264 |
| 472 | 3300049592 | Ga0501076_0430055 | Ga0501076_0430055_112_936 | 264 |
| 473 | 3300049593 | Ga0501077_0017767 | Ga0501077_0017767_2170_2964 | 264 |
| 474 | 3300049656 | Ga0501209_005567 | Ga0501209_005567_569_1366 | 264 |
| 475 | 3300049661 | Ga0501217_035127 | Ga0501217_035127_121_918 | 264 |
| 476 | 3300049675 | Ga0501243_006763 | Ga0501243_006763_919_1716 | 264 |
| 477 | 3300049679 | Ga0501249_002491 | Ga0501249_002491_669_1466 | 264 |
| 478 | 3300049680 | Ga0501250_009071 | Ga0501250_009071_67_864 | 264 |
| 479 | 3300049686 | Ga0501257_036596 | Ga0501257_036596_255_1052 | 264 |
| 480 | 3300049742 | Ga0501080_0073547 | Ga0501080_0073547_2244_3038 | 264 |
| 481 | 3300049742 | Ga0501080_0239192 | Ga0501080_0239192_320_1144 | 264 |
| 482 | 3300049742 | Ga0501080_0267263 | Ga0501080_0267263_454_1263 | 264 |
| 483 | 3300049743 | Ga0501081_0028467 | Ga0501081_0028467_2272_3066 | 264 |
| 484 | 3300049744 | Ga0501083_0000964 | Ga0501083_0000964_11450_12274 | 264 |
| 485 | 3300049744 | Ga0501083_0004725 | Ga0501083_0004725_1560_2384 | 264 |
| 486 | 3300049759 | Ga0501262_003799 | Ga0501262_003799_187_984 | 264 |
| 487 | 3300049760 | Ga0501263_005668 | Ga0501263_005668_83_880 | 264 |
| 488 | 3300049765 | Ga0501268_003640 | Ga0501268_003640_658_1455 | 264 |
| 489 | 3300049769 | Ga0501272_001252 | Ga0501272_001252_163_960 | 264 |
| 490 | 3300049770 | Ga0501273_006092 | Ga0501273_006092_323_1120 | 264 |
| 491 | 3300049771 | Ga0501274_003512 | Ga0501274_003512_296_1093 | 264 |
| 492 | 3300050507 | nmdc:mga05p37_102429_c1 | nmdc:mga05p37_102429_c1_1000_1800 | 264 |
| 493 | 3300050507 | nmdc:mga05p37_26273_c1 | nmdc:mga05p37_26273_c1_1803_2621 | 264 |
| 494 | 3300050507 | nmdc:mga05p37_29581_c1 | nmdc:mga05p37_29581_c1_3314_4108 | 264 |
| 495 | 3300050507 | nmdc:mga05p37_520744_c1 | nmdc:mga05p37_520744_c1_173_967 | 264 |
| 496 | 3300050508 | nmdc:mga09592_14338_c1 | nmdc:mga09592_14338_c1_288_1106 | 264 |
| 497 | 3300050509 | nmdc:mga0qj67_216845_c1 | nmdc:mga0qj67_216845_c1_254_1417 | 264 |
| 498 | 3300050509 | nmdc:mga0qj67_217925_c1 | nmdc:mga0qj67_217925_c1_443_1237 | 264 |
| 499 | 3300050509 | nmdc:mga0qj67_536000_c1 | nmdc:mga0qj67_536000_c1_64_861 | 264 |
| 500 | 3300050510 | nmdc:mga06r32_188395_c1 | nmdc:mga06r32_188395_c1_635_1429 | 264 |
| 501 | 3300050510 | nmdc:mga06r32_2816_c1 | nmdc:mga06r32_2816_c1_1180_1974 | 264 |
| 502 | 3300050510 | nmdc:mga06r32_354386_c1 | nmdc:mga06r32_354386_c1_283_1119 | 264 |
| 503 | 3300050510 | nmdc:mga06r32_52442_c1 | nmdc:mga06r32_52442_c1_2546_3376 | 264 |
| 504 | 3300050511 | nmdc:mga08y16_894988_c1 | nmdc:mga08y16_894988_c1_41_835 | 264 |
| 505 | 3300050512 | nmdc:mga0n895_115097_c1 | nmdc:mga0n895_115097_c1_1694_2524 | 264 |
| 506 | 3300050512 | nmdc:mga0n895_1246_c1 | nmdc:mga0n895_1246_c1_17439_18266 | 264 |
| 507 | 3300050512 | nmdc:mga0n895_33282_c1 | nmdc:mga0n895_33282_c1_1720_2535 | 264 |
| 508 | 3300050512 | nmdc:mga0n895_448_c1 | nmdc:mga0n895_448_c1_5223_6023 | 264 |
| 509 | 3300050512 | nmdc:mga0n895_59053_c1 | nmdc:mga0n895_59053_c1_1742_2542 | 264 |
| 510 | 3300050512 | nmdc:mga0n895_6612_c1 | nmdc:mga0n895_6612_c1_5118_5936 | 264 |
| 511 | 3300050513 | nmdc:mga0rr50_18846_c1 | nmdc:mga0rr50_18846_c1_2468_3295 | 264 |
| 512 | 3300050514 | nmdc:mga08x19_178046_c1 | nmdc:mga08x19_178046_c1_110_949 | 264 |
| 513 | 3300050514 | nmdc:mga08x19_38112_c1 | nmdc:mga08x19_38112_c1_1699_2499 | 264 |
| 514 | 3300050514 | nmdc:mga08x19_443133_c1 | nmdc:mga08x19_443133_c1_66_866 | 264 |
| 515 | 3300050514 | nmdc:mga08x19_68080_c1 | nmdc:mga08x19_68080_c1_748_1575 | 264 |
| 516 | 3300050514 | nmdc:mga08x19_9576_c1 | nmdc:mga08x19_9576_c1_66_866 | 264 |
| 517 | 3300050515 | nmdc:mga0a205_105075_c1 | nmdc:mga0a205_105075_c1_852_1652 | 264 |
| 518 | 3300050515 | nmdc:mga0a205_134589_c1 | nmdc:mga0a205_134589_c1_1142_1936 | 264 |
| 519 | 3300050515 | nmdc:mga0a205_22021_c1 | nmdc:mga0a205_22021_c1_1836_2663 | 264 |
| 520 | 3300050515 | nmdc:mga0a205_25865_c1 | nmdc:mga0a205_25865_c1_1244_2044 | 264 |
| 521 | 3300050515 | nmdc:mga0a205_7164_c1 | nmdc:mga0a205_7164_c1_3651_4466 | 264 |
| 522 | 3300050515 | nmdc:mga0a205_91482_c1 | nmdc:mga0a205_91482_c1_1262_2059 | 264 |
| 523 | 3300054114 | Ga0501084_0009611 | Ga0501084_0009611_85_909 | 264 |
| 524 | 3300054114 | Ga0501084_0053650 | Ga0501084_0053650_708_1532 | 264 |
| 525 | 3300059424 | Ga0590075_048562 | Ga0590075_048562_232_1026 | 264 |
| 526 | 3300060353 | Ga0501082_0007952 | Ga0501082_0007952_2894_3688 | 264 |
| 527 | 3300060353 | Ga0501082_0120051 | Ga0501082_0120051_457_1281 | 264 |
| 528 | 3300060353 | Ga0501082_0138816 | Ga0501082_0138816_669_1493 | 264 |
| 529 | 3300061734 | Ga0530510_0035503 | Ga0530510_0035503_890_1684 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1m5t-assembly1.cif.gz_A | crystal structure of the response regulator divk | 0.6864 | 163 | 237 |
| 6ejj-assembly1.cif.gz_A | structure of a glycosyltransferase / state 2 | 0.6857 | 163 | 238 |
| 2jrl-assembly1.cif.gz_B | solution structure of the beryllofluoride-activated ntrc4 receiver domain dimer | 0.6809 | 164 | 214 |
| 7s5m-assembly2.cif.gz_C | crystal structure of a 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme a ligase from mycobacterium smegmatis | 0.6733 | 159 | 237 |
| 1xhf-assembly1.cif.gz_A | crystal structure of the bef3-activated receiver domain of redox response regulator arca | 0.6681 | 164 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PNH8_1039_1172_3.40.50.10190 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain | 0.7054 | 159 | 222 | 3.40.50.10190 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.683 | 163 | 237 | 3.40.50.2300 |
| af_A0A1D6LQI5_808_963_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6784 | 158 | 214 | 3.40.50.2300 |
| af_Q2G119_4_242_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.6691 | 160 | 214 | 3.40.640.10 |
| af_Q54YH4_1831_1968_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.669 | 163 | 214 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V1ZUI6-F1-model_v4 | DUF116 domain-containing protein | 0.9408 | 136 | 263 |
|
| AF-A0A524H2Z2-F1-model_v4 | DUF116 domain-containing protein | 0.9334 | 127 | 264 |
|
| AF-A0A2W4RXM2-F1-model_v4 | DUF116 domain-containing protein | 0.921 | 3 | 263 |
GO:0016020
|
| AF-A0A2W4RXM2-F1-model_v4 | DUF116 domain-containing protein | 0.9078 | 3 | 263 |
GO:0016020
|
| AF-A0A2V7NYM1-F1-model_v4 | DUF116 domain-containing protein | 0.8975 | 1 | 263 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar