F459638

General Info

Members Datasets Scaffolds Average Seq Length
528 238 1056 227

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100263387|Ga0070707_1002633872
Length 253
Sequence VKHTEPLTYDRCPQREPNRVTRPTELPPNVRRLVDEIESEMGETDVGVDDIVGSRGDERLGEMAGNGRVEAAVREILGEIGEDPDRQGLAGTPQRVHRMYTELTAGYHVDPERLINGAIFDIAYSEMVVVKNVPFYSLCEHHLLPFFGTAAVAYIPRGRVIGLSKIPRVVEMYARRLQVQERLTQQIADFLQDRLAPQGVGVVLEATHLCAVMRGVRKPGTVMTTSSVLGLFRTRDRTRAEFFAHLERHAPEA

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 12.69
Rhizosphere 85.61
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100263387 3300005468 Bacteria 1677
2 rootH1_10132324 3300003323 Bacteria 6354
3 Ga0070683_100217489 3300005329 Bacteria 1816
4 Ga0070690_100020286 3300005330 Bacteria 4048
5 Ga0070670_100046550 3300005331 Bacteria 3730
6 Ga0068869_100075202 3300005334 Bacteria 2509
7 Ga0068869_100434361 3300005334 Bacteria 1086
8 Ga0070680_100000001 3300005336 Bacteria 276263
9 Ga0068868_100105425 3300005338 Bacteria 2286
10 Ga0068868_100311720 3300005338 Bacteria 1339
11 Ga0070660_100178292 3300005339 Bacteria 1719
12 Ga0070675_100070336 3300005354 Bacteria 2900
13 Ga0070671_100211087 3300005355 Bacteria 1647
14 Ga0070671_100471735 3300005355 Bacteria 1078
15 Ga0070674_100309189 3300005356 Bacteria 1263
16 Ga0070673_100275180 3300005364 Bacteria 1475
17 Ga0070673_100504471 3300005364 Bacteria 1095
18 Ga0070659_100310584 3300005366 Bacteria 1316
19 Ga0070703_10147242 3300005406 Bacteria 881
20 Ga0070701_10031896 3300005438 Bacteria 2618
21 Ga0070701_10217538 3300005438 Bacteria 1138
22 Ga0070711_100482017 3300005439 Bacteria 1020
23 Ga0070705_100029423 3300005440 Bacteria 3021
24 Ga0070705_100092672 3300005440 Bacteria 1886
25 Ga0070705_100123483 3300005440 Bacteria 1676
26 Ga0070705_100124733 3300005440 Bacteria 1669
27 Ga0070705_100523029 3300005440 Bacteria 904
28 Ga0070694_100037169 3300005444 Bacteria 3228
29 Ga0070694_100210837 3300005444 Bacteria 1453
30 Ga0070708_100000821 3300005445 Bacteria 23435
31 Ga0070708_100014098 3300005445 Bacteria 6570
32 Ga0070708_100060539 3300005445 Bacteria 3380
33 Ga0070708_100175285 3300005445 Bacteria 2003
34 Ga0070678_100092746 3300005456 Bacteria 2321
35 Ga0070681_10221296 3300005458 Bacteria 1808
36 Ga0070685_10016992 3300005466 Bacteria 3886
37 Ga0070706_100002583 3300005467 Bacteria 18203
38 Ga0070706_100022733 3300005467 Bacteria 5775
39 Ga0070706_100106390 3300005467 Bacteria 2610
40 Ga0070706_100469554 3300005467 Bacteria 1171
41 Ga0070707_100000163 3300005468 Bacteria 63764
42 Ga0070707_100038400 3300005468 Bacteria 4573
43 Ga0070707_100162019 3300005468 Bacteria 2179
44 Ga0070698_100016770 3300005471 Bacteria 7726
45 Ga0070698_100030465 3300005471 Bacteria 5592
46 Ga0070698_100056405 3300005471 Bacteria 3981
47 Ga0070698_100295203 3300005471 Bacteria 1552
48 Ga0070698_100374614 3300005471 Bacteria 1356
49 Ga0070699_100001296 3300005518 Bacteria 23080
50 Ga0070699_100006966 3300005518 Bacteria 9826
51 Ga0070699_100008469 3300005518 Bacteria 8908
52 Ga0070699_100147870 3300005518 Bacteria 2076
53 Ga0070699_100188661 3300005518 Bacteria 1831
54 Ga0070684_100135795 3300005535 Bacteria 2222
55 Ga0070697_100020155 3300005536 Bacteria 5271
56 Ga0070697_100100936 3300005536 Bacteria 2397
57 Ga0070697_100315874 3300005536 Bacteria 1345
58 Ga0070697_100336715 3300005536 Bacteria 1301
59 Ga0070686_100046074 3300005544 Bacteria 2749
60 Ga0070686_100103887 3300005544 Bacteria 1924
61 Ga0070686_100119015 3300005544 Bacteria 1811
62 Ga0070686_100282115 3300005544 Bacteria 1225
63 Ga0070686_100416115 3300005544 Unclassified 1026
64 Ga0070695_100005199 3300005545 Bacteria 7678
65 Ga0070695_100175311 3300005545 Bacteria 1515
66 Ga0070695_100310671 3300005545 Bacteria 1168
67 Ga0070696_100017275 3300005546 Bacteria 4869
68 Ga0070696_100043198 3300005546 Bacteria 3118
69 Ga0070696_100061240 3300005546 Bacteria 2632
70 Ga0070696_100062353 3300005546 Bacteria 2609
71 Ga0070696_100085580 3300005546 Bacteria 2238
72 Ga0070696_100340052 3300005546 Bacteria 1160
73 Ga0070665_100481556 3300005548 Bacteria 1252
74 Ga0070704_100233124 3300005549 Bacteria 1503
75 Ga0070704_100464315 3300005549 Bacteria 1093
76 Ga0068855_100474259 3300005563 Bacteria 1363
77 Ga0068857_100597736 3300005577 Bacteria 1043
78 Ga0068856_100254759 3300005614 Bacteria 1770
79 Ga0070702_100036169 3300005615 Bacteria 2733
80 Ga0068852_100033278 3300005616 Bacteria 4278
81 Ga0068859_101383905 3300005617 Bacteria 776
82 Ga0068864_100016751 3300005618 Bacteria 6108
83 Ga0068864_100231117 3300005618 Bacteria 1710
84 Ga0068864_100804160 3300005618 Bacteria 924
85 Ga0068861_100044817 3300005719 Bacteria 3328
86 Ga0068858_100071346 3300005842 Bacteria 3221
87 Ga0068858_100315767 3300005842 Bacteria 1493
88 Ga0068858_100826190 3300005842 Bacteria 904
89 Ga0068860_100021677 3300005843 Bacteria 6219
90 Ga0068860_100404018 3300005843 Bacteria 1352
91 Ga0081455_10058099 3300005937 Bacteria 3275
92 Ga0081538_10115030 3300005981 Bacteria 1309
93 Ga0081539_10004486 3300005985 Bacteria 15363
94 Ga0081539_10004682 3300005985 Bacteria 14847
95 Ga0081539_10224244 3300005985 Bacteria 853
96 Ga0075365_10100702 3300006038 Bacteria 1978
97 Ga0075365_10123070 3300006038 Bacteria 1791
98 Ga0068871_100263570 3300006358 Bacteria 1504
99 Ga0075428_100006306 3300006844 Bacteria 13183
100 Ga0075428_100139365 3300006844 Bacteria 2637
101 Ga0075428_100401646 3300006844 Bacteria 1469
102 Ga0075431_100361650 3300006847 Bacteria 1457
103 Ga0075433_10010909 3300006852 Bacteria 7310
104 Ga0075433_10059339 3300006852 Bacteria 3347
105 Ga0075433_10448014 3300006852 Bacteria 1138
106 Ga0075434_100085179 3300006871 Bacteria 3160
107 Ga0075434_100285329 3300006871 Bacteria 1670
108 Ga0075434_100531196 3300006871 Bacteria 1196
109 Ga0068865_100115942 3300006881 Bacteria 1983
110 Ga0075436_100079486 3300006914 Bacteria 2272
111 Ga0075436_100338607 3300006914 Bacteria 1083
112 Ga0097620_101383649 3300006931 Bacteria 776
113 Ga0075435_100218619 3300007076 Bacteria 1618
114 Ga0111539_10050526 3300009094 Bacteria 4954
115 Ga0111539_10061763 3300009094 Bacteria 4438
116 Ga0111539_10226672 3300009094 Bacteria 2176
117 Ga0111539_10779176 3300009094 Bacteria 1113
118 Ga0105245_10011782 3300009098 Bacteria 7607
119 Ga0105245_10027477 3300009098 Bacteria 5013
120 Ga0105245_10142338 3300009098 Bacteria 2260
121 Ga0105245_10343376 3300009098 Bacteria 1477
122 Ga0114129_10017170 3300009147 Bacteria 10308
123 Ga0114129_10023210 3300009147 Bacteria 8799
124 Ga0114129_10031372 3300009147 Bacteria 7513
125 Ga0114129_10078320 3300009147 Bacteria 4598
126 Ga0114129_10163365 3300009147 Bacteria 3040
127 Ga0114129_10179484 3300009147 Bacteria 2882
128 Ga0114129_10248139 3300009147 Bacteria 2390
129 Ga0114129_10632605 3300009147 Bacteria 1383
130 Ga0114129_10659761 3300009147 Bacteria 1349
131 Ga0105243_10177854 3300009148 Bacteria 1848
132 Ga0105243_10344277 3300009148 Bacteria 1367
133 Ga0105243_10784397 3300009148 Bacteria 937
134 Ga0105243_10817300 3300009148 Bacteria 920
135 Ga0105242_10015410 3300009176 Bacteria 5936
136 Ga0105242_10057001 3300009176 Bacteria 3198
137 Ga0105242_10408873 3300009176 Bacteria 1269
138 Ga0105242_10489532 3300009176 Bacteria 1167
139 Ga0105248_10053695 3300009177 Bacteria 4520
140 Ga0105248_10462505 3300009177 Bacteria 1430
141 Ga0105237_10290433 3300009545 Bacteria 1638
142 Ga0105238_10058938 3300009551 Bacteria 3848
143 Ga0105249_10017648 3300009553 Bacteria 6337
144 Ga0105249_10049105 3300009553 Bacteria 3848
145 Ga0105249_10099722 3300009553 Bacteria 2730
146 Ga0105239_10030852 3300010375 Bacteria 5896
147 Ga0105239_10030875 3300010375 Bacteria 5895
148 Ga0105239_10152943 3300010375 Bacteria 2575
149 Ga0105239_10500849 3300010375 Bacteria 1381
150 Ga0105239_10574667 3300010375 Bacteria 1284
151 Ga0105246_10118752 3300011119 Unclassified 1956
152 Ga0105246_10387068 3300011119 Bacteria 1157
153 Ga0157371_10420184 3300013102 Bacteria 980
154 Ga0157378_10036328 3300013297 Bacteria 4360
155 Ga0157378_10101067 3300013297 Bacteria 2634
156 Ga0157378_10269438 3300013297 Bacteria 1637
157 Ga0157378_10525618 3300013297 Bacteria 1185
158 Ga0163162_10132545 3300013306 Bacteria 2601
159 Ga0157372_10602861 3300013307 Bacteria 1280
160 Ga0157375_10132318 3300013308 Bacteria 2615
161 Ga0157375_10165714 3300013308 Bacteria 2354
162 Ga0157375_10362588 3300013308 Bacteria 1615
163 Ga0157375_11103393 3300013308 Bacteria 929
164 Ga0163163_10040014 3300014325 Bacteria 4577
165 Ga0163163_10047205 3300014325 Bacteria 4232
166 Ga0163163_10053799 3300014325 Bacteria 3975
167 Ga0163163_10111233 3300014325 Bacteria 2768
168 Ga0163163_10143296 3300014325 Bacteria 2432
169 Ga0157380_10109263 3300014326 Unclassified 2320
170 Ga0182008_10045516 3300014497 Bacteria 2181
171 Ga0182008_10248401 3300014497 Bacteria 917
172 Ga0157377_10167358 3300014745 Bacteria 1372
173 Ga0157379_10097165 3300014968 Bacteria 2644
174 Ga0157379_10476379 3300014968 Bacteria 1155
175 Ga0157379_10629737 3300014968 Bacteria 1003
176 Ga0157376_10246182 3300014969 Bacteria 1668
177 Ga0157376_10629851 3300014969 Bacteria 1071
178 Ga0163161_10024639 3300017792 Bacteria 4252
179 Ga0213875_10037545 3300021388 Bacteria 2282
180 Ga0207688_10042154 3300025901 Bacteria 2541
181 Ga0207645_10087342 3300025907 Bacteria 2004
182 Ga0207643_10026836 3300025908 Bacteria 3191
183 Ga0207684_10004490 3300025910 Bacteria 13125
184 Ga0207684_10020103 3300025910 Bacteria 5704
185 Ga0207684_10065472 3300025910 Bacteria 3086
186 Ga0207654_10359516 3300025911 Bacteria 1004
187 Ga0207707_10271369 3300025912 Bacteria 1470
188 Ga0207707_10299902 3300025912 Bacteria 1390
189 Ga0207660_10000001 3300025917 Bacteria 1034169
190 Ga0207660_10227969 3300025917 Bacteria 1464
191 Ga0207662_10013089 3300025918 Bacteria 4634
192 Ga0207662_10259675 3300025918 Bacteria 1143
193 Ga0207646_10024913 3300025922 Bacteria 5475
194 Ga0207646_10027694 3300025922 Bacteria 5166
195 Ga0207646_10063249 3300025922 Bacteria 3304
196 Ga0207646_10149853 3300025922 Bacteria 2103
197 Ga0207646_10201290 3300025922 Bacteria 1799
198 Ga0207646_10229683 3300025922 Bacteria 1676
199 Ga0207646_10716099 3300025922 Bacteria 894
200 Ga0207694_10042763 3300025924 Bacteria 3496
201 Ga0207659_10316623 3300025926 Bacteria 1286
202 Ga0207687_10030545 3300025927 Bacteria 3634
203 Ga0207687_10083898 3300025927 Bacteria 2308
204 Ga0207690_10313882 3300025932 Bacteria 1230
205 Ga0207706_10197276 3300025933 Bacteria 1765
206 Ga0207709_10105765 3300025935 Bacteria 1871
207 Ga0207709_10573319 3300025935 Bacteria 890
208 Ga0207669_10091358 3300025937 Bacteria 1983
209 Ga0207669_10147345 3300025937 Bacteria 1643
210 Ga0207704_10341086 3300025938 Bacteria 1163
211 Ga0207689_10253336 3300025942 Bacteria 1456
212 Ga0207661_10110268 3300025944 Bacteria 2326
213 Ga0207651_10293039 3300025960 Bacteria 1350
214 Ga0207712_10026386 3300025961 Bacteria 3870
215 Ga0207668_10188619 3300025972 Bacteria 1632
216 Ga0207640_10604732 3300025981 Bacteria 929
217 Ga0207677_10129034 3300026023 Bacteria 1916
218 Ga0207677_10211134 3300026023 Bacteria 1550
219 Ga0207677_10422074 3300026023 Bacteria 1136
220 Ga0207677_10540084 3300026023 Bacteria 1014
221 Ga0207703_10379353 3300026035 Bacteria 1307
222 Ga0207678_10029229 3300026067 Bacteria 4809
223 Ga0207678_10579863 3300026067 Bacteria 982
224 Ga0207641_10359712 3300026088 Bacteria 1389
225 Ga0207648_10005758 3300026089 Bacteria 12417
226 Ga0207676_10036764 3300026095 Bacteria 3728
227 Ga0207676_10077572 3300026095 Bacteria 2688
228 Ga0207676_10436196 3300026095 Bacteria 1232
229 Ga0207676_10621375 3300026095 Bacteria 1040
230 Ga0207674_10007027 3300026116 Bacteria 13163
231 Ga0207675_100031518 3300026118 Bacteria 4938
232 Ga0207675_100199946 3300026118 Bacteria 1919
233 Ga0207675_100461633 3300026118 Bacteria 1260
234 Ga0207675_100567278 3300026118 Bacteria 1136
235 Ga0207683_10019227 3300026121 Bacteria 5832
236 Ga0207683_10162205 3300026121 Bacteria 2021
237 Ga0207683_10585366 3300026121 Bacteria 1032
238 Ga0207428_10182096 3300027907 Bacteria 1587
239 Ga0268264_10303073 3300028381 Bacteria 1505
240 Ga0268264_11004635 3300028381 Bacteria 841
241 Ga0265319_1017322 3300028563 Bacteria 2740
242 Ga0265334_10016828 3300028573 Bacteria 3023
243 Ga0265318_10011380 3300028577 Bacteria 3833
244 Ga0265336_10021994 3300028666 Bacteria 2033
245 Ga0265324_10013719 3300029957 Bacteria 3015
246 Ga0265325_10088202 3300031241 Bacteria 1533
247 Ga0265325_10140426 3300031241 Bacteria 1149
248 Ga0265329_10006016 3300031242 Bacteria 4854
249 Ga0265340_10047916 3300031247 Bacteria 2079
250 Ga0265339_10111577 3300031249 Bacteria 1414
251 Ga0265331_10068999 3300031250 Bacteria 1656
252 Ga0265316_10094337 3300031344 Bacteria 2280
253 Ga0265316_10314759 3300031344 Bacteria 1138
254 Ga0307408_100052251 3300031548 Bacteria 2947
255 Ga0265313_10081082 3300031595 Bacteria 1473
256 Ga0265314_10007700 3300031711 Bacteria 9313
257 Ga0265314_10025249 3300031711 Bacteria 4488
258 Ga0265342_10095601 3300031712 Bacteria 1698
259 Ga0265342_10273362 3300031712 Bacteria 896
260 Ga0316577_10176096 3300031733 Bacteria 1208
261 Ga0307406_10052370 3300031901 Bacteria 2596
262 Ga0307407_10121315 3300031903 Bacteria 1658
263 Ga0307407_10187122 3300031903 Bacteria 1377
264 Ga0307407_10307437 3300031903 Bacteria 1108
265 Ga0307407_10329237 3300031903 Bacteria 1075
266 Ga0307409_100119016 3300031995 Bacteria 2232
267 Ga0307409_100173093 3300031995 Bacteria 1902
268 Ga0307409_100554412 3300031995 Bacteria 1129
269 Ga0307416_100001078 3300032002 Bacteria 14560
270 Ga0307416_100360052 3300032002 Bacteria 1476
271 Ga0307415_100017280 3300032126 Bacteria 4322
272 Ga0307415_100029246 3300032126 Bacteria 3519
273 Ga0307415_100192450 3300032126 Bacteria 1611
274 Ga0316596_1056142 3300033541 Bacteria 1046
275 Ga0373932_0013873 3300035112 Bacteria 2015
276 Ga0373931_0364167 3300035691 Bacteria 908
277 Ga0373937_0287334 3300036401 Bacteria 1554
278 Ga0373937_0354700 3300036401 Bacteria 1390
279 Ga0373937_0613016 3300036401 Bacteria 1033
280 Ga0436364_1141177 3300037853 Bacteria 3323
281 Ga0436365_0436981 3300039437 Bacteria 1379
282 Ga0439466_0075890 3300041411 Bacteria 1065
283 Ga0439465_0068609 3300041413 Bacteria 1185
284 Ga0439465_0084158 3300041413 Bacteria 1082
285 Ga0451800_1543090 3300041459 Bacteria 1124
286 Ga0451845_0804036 3300041501 Bacteria 896
287 Ga0451577_0363193 3300042876 Bacteria 1313
288 Ga0451577_0430704 3300042876 Bacteria 1198
289 Ga0466972_0015333 3300044658 Bacteria 3831
290 Ga0466965_0002780 3300044683 Bacteria 7523
291 Ga0453684_0352095 3300044712 Bacteria 1660
292 Ga0466968_0007567 3300044735 Bacteria 4134
293 Ga0466960_0004790 3300044901 Bacteria 5317
294 Ga0466960_0130455 3300044901 Bacteria 1326
295 Ga0451576_0180712 3300045051 Bacteria 2203
296 Ga0451576_1090473 3300045051 Bacteria 836
297 Ga0495592_0273486 3300046454 Bacteria 1107
298 Ga0495603_0106824 3300046455 Bacteria 1634
299 Ga0495629_0165705 3300046459 Bacteria 1535
300 Ga0495641_0062364 3300046461 Bacteria 1682
301 Ga0495651_0029801 3300046462 Bacteria 4255
302 Ga0495618_0156353 3300046514 Bacteria 1455
303 Ga0495628_0095484 3300046516 Bacteria 2297
304 Ga0495628_0131263 3300046516 Bacteria 1916
305 Ga0495630_0318814 3300046517 Bacteria 1188
306 Ga0495644_0123725 3300046523 Bacteria 985
307 Ga0495652_0091843 3300046529 Bacteria 2481
308 Ga0495640_0076817 3300046533 Bacteria 2228
309 Ga0495645_0054379 3300046543 Bacteria 2909
310 Ga0495667_0081332 3300046559 Bacteria 2106
311 Ga0495634_0035843 3300046642 Bacteria 3395
312 Ga0495659_0081006 3300046664 Bacteria 1232
313 Ga0495657_0150695 3300046675 Bacteria 1444
314 Ga0495657_0316916 3300046675 Bacteria 927
315 Ga0495647_0173653 3300046681 Bacteria 934
316 Ga0495658_0202135 3300046683 Bacteria 1239
317 Ga0495613_0258227 3300046689 Bacteria 1215
318 Ga0495600_0115131 3300046809 Bacteria 1751
319 Ga0495581_0102194 3300047315 Bacteria 1666
320 Ga0495581_0370555 3300047315 Bacteria 836
321 Ga0495674_0047327 3300047319 Bacteria 3814
322 Ga0495674_0420237 3300047319 Bacteria 1077
323 Ga0495674_0517941 3300047319 Bacteria 952
324 Ga0495676_0270203 3300047321 Bacteria 1154
325 Ga0495680_0076064 3300047322 Bacteria 2546
326 Ga0495684_0283825 3300047471 Bacteria 1194
327 Ga0495602_0179263 3300048088 Bacteria 1636
328 Ga0496101_0182201 3300048904 Bacteria 1618
329 Ga0496101_0215889 3300048904 Bacteria 1487
330 Ga0496102_0017689 3300048905 Bacteria 6248
331 Ga0496102_0121144 3300048905 Bacteria 2443
332 Ga0496102_0171092 3300048905 Bacteria 2045
333 Ga0496102_0405809 3300048905 Bacteria 1281
334 Ga0496102_0438996 3300048905 Bacteria 1225
335 Ga0496102_0550211 3300048905 Bacteria 1077
336 Ga0496103_0004315 3300048906 Bacteria 8640
337 Ga0496104_0040088 3300048907 Bacteria 4388
338 Ga0496104_0041044 3300048907 Bacteria 4338
339 Ga0496104_0159610 3300048907 Bacteria 2163
340 Ga0496104_0379838 3300048907 Bacteria 1325
341 Ga0496105_0039248 3300048908 Bacteria 3902
342 Ga0496105_0044291 3300048908 Bacteria 3670
343 Ga0496105_0129274 3300048908 Bacteria 2083
344 Ga0496105_0528846 3300048908 Bacteria 923
345 Ga0496106_0125097 3300048909 Bacteria 2012
346 Ga0496106_0148766 3300048909 Bacteria 1846
347 Ga0496106_0181323 3300048909 Bacteria 1672
348 Ga0496106_0274117 3300048909 Bacteria 1351
349 Ga0496106_0285426 3300048909 Bacteria 1323
350 Ga0496106_0346820 3300048909 Bacteria 1193
351 Ga0496107_0139466 3300048910 Bacteria 1792
352 Ga0496107_0211599 3300048910 Bacteria 1442
353 Ga0496107_0266705 3300048910 Bacteria 1274
354 Ga0496107_0347279 3300048910 Bacteria 1104
355 Ga0496108_0013593 3300048911 Bacteria 6644
356 Ga0496108_0019610 3300048911 Bacteria 5555
357 Ga0496108_0047955 3300048911 Bacteria 3571
358 Ga0496108_0233529 3300048911 Bacteria 1599
359 Ga0496108_0258932 3300048911 Bacteria 1514
360 Ga0496108_0330625 3300048911 Bacteria 1329
361 Ga0496109_0006101 3300048912 Bacteria 10124
362 Ga0496109_0034715 3300048912 Bacteria 4545
363 Ga0496109_0065470 3300048912 Bacteria 3327
364 Ga0496109_0107892 3300048912 Bacteria 2587
365 Ga0496109_0117430 3300048912 Bacteria 2476
366 Ga0496109_0128781 3300048912 Bacteria 2361
367 Ga0496109_0224984 3300048912 Bacteria 1765
368 Ga0496109_0234230 3300048912 Bacteria 1728
369 Ga0496109_0500897 3300048912 Bacteria 1146
370 Ga0496110_0175009 3300048913 Bacteria 1948
371 Ga0496110_0207198 3300048913 Bacteria 1782
372 Ga0496110_0359102 3300048913 Bacteria 1327
373 Ga0496111_0050686 3300048914 Bacteria 2996
374 Ga0496111_0146928 3300048914 Bacteria 1748
375 Ga0496111_0168104 3300048914 Bacteria 1629
376 Ga0496111_0212383 3300048914 Bacteria 1437
377 Ga0496112_0000005 3300048915 Bacteria 525541
378 Ga0496112_0046518 3300048915 Bacteria 4256
379 Ga0496112_0072896 3300048915 Bacteria 3395
380 Ga0496112_0269960 3300048915 Bacteria 1649
381 Ga0496112_0416431 3300048915 Bacteria 1283
382 Ga0496112_0586342 3300048915 Bacteria 1047
383 Ga0496113_0013089 3300048916 Bacteria 5603
384 Ga0496113_0260526 3300048916 Bacteria 1385
385 Ga0496113_0314273 3300048916 Bacteria 1255
386 Ga0496113_0445484 3300048916 Bacteria 1040
387 Ga0496114_0015659 3300048917 Bacteria 6101
388 Ga0496114_0133463 3300048917 Bacteria 2146
389 Ga0496114_0256822 3300048917 Bacteria 1538
390 Ga0496114_0281860 3300048917 Bacteria 1465
391 Ga0496114_0331666 3300048917 Bacteria 1345
392 Ga0496114_0340999 3300048917 Bacteria 1325
393 Ga0496114_0382625 3300048917 Bacteria 1246
394 Ga0501031_0053428 3300049568 Bacteria 2632
395 Ga0501031_0531518 3300049568 Bacteria 758
396 Ga0501033_0095133 3300049570 Bacteria 2177
397 Ga0501033_0414534 3300049570 Bacteria 938
398 Ga0501034_0295356 3300049571 Bacteria 1558
399 Ga0501036_0023106 3300049572 Bacteria 5234
400 Ga0501036_0095903 3300049572 Bacteria 2507
401 Ga0501036_0218388 3300049572 Bacteria 1601
402 Ga0501036_0236583 3300049572 Bacteria 1532
403 Ga0501036_0401142 3300049572 Bacteria 1144
404 Ga0501037_0052726 3300049573 Bacteria 2974
405 Ga0501038_0080136 3300049574 Bacteria 2752
406 Ga0501038_0158187 3300049574 Bacteria 1843
407 Ga0501039_0064750 3300049575 Bacteria 2834
408 Ga0501039_0399044 3300049575 Bacteria 1080
409 Ga0501040_0008798 3300049576 Bacteria 6559
410 Ga0501040_0072430 3300049576 Bacteria 2380
411 Ga0501040_0129111 3300049576 Bacteria 1776
412 Ga0501040_0365006 3300049576 Bacteria 1035
413 Ga0501041_0044239 3300049577 Bacteria 2707
414 Ga0501041_0074691 3300049577 Bacteria 2083
415 Ga0501041_0150803 3300049577 Bacteria 1451
416 Ga0501041_0222229 3300049577 Bacteria 1185
417 Ga0501042_0036977 3300049578 Bacteria 3464
418 Ga0501042_0061778 3300049578 Bacteria 2676
419 Ga0501042_0138714 3300049578 Bacteria 1753
420 Ga0501043_0527885 3300049579 Bacteria 879
421 Ga0501046_0077808 3300049580 Bacteria 2567
422 Ga0501046_0154837 3300049580 Bacteria 1728
423 Ga0501048_0021779 3300049582 Bacteria 4691
424 Ga0501048_0042886 3300049582 Bacteria 3238
425 Ga0501048_0125830 3300049582 Bacteria 1812
426 Ga0501048_0258571 3300049582 Bacteria 1237
427 Ga0501048_0312805 3300049582 Bacteria 1118
428 Ga0501067_0036786 3300049583 Bacteria 2718
429 Ga0501067_0051741 3300049583 Bacteria 2276
430 Ga0501067_0071262 3300049583 Bacteria 1925
431 Ga0501067_0139018 3300049583 Bacteria 1352
432 Ga0501068_0040275 3300049584 Bacteria 2804
433 Ga0501068_0068240 3300049584 Bacteria 2167
434 Ga0501068_0109944 3300049584 Bacteria 1713
435 Ga0501068_0200654 3300049584 Bacteria 1265
436 Ga0501069_0019597 3300049585 Bacteria 3660
437 Ga0501069_0043165 3300049585 Bacteria 2495
438 Ga0501069_0048463 3300049585 Bacteria 2359
439 Ga0501070_0062599 3300049586 Bacteria 3082
440 Ga0501071_0097848 3300049587 Bacteria 2161
441 Ga0501071_0198063 3300049587 Bacteria 1508
442 Ga0501071_0285115 3300049587 Bacteria 1250
443 Ga0501072_0032634 3300049588 Bacteria 4078
444 Ga0501072_0039753 3300049588 Bacteria 3693
445 Ga0501073_0069949 3300049589 Bacteria 2445
446 Ga0501073_0131923 3300049589 Bacteria 1732
447 Ga0501074_0035149 3300049590 Bacteria 3631
448 Ga0501074_0232884 3300049590 Bacteria 1311
449 Ga0501074_0275796 3300049590 Bacteria 1195
450 Ga0501074_0276603 3300049590 Bacteria 1194
451 Ga0501074_0594066 3300049590 Bacteria 783
452 Ga0501075_0008458 3300049591 Bacteria 7180
453 Ga0501075_0009473 3300049591 Bacteria 6815
454 Ga0501075_0017386 3300049591 Bacteria 5195
455 Ga0501075_0023538 3300049591 Bacteria 4511
456 Ga0501075_0063042 3300049591 Bacteria 2795
457 Ga0501075_0249856 3300049591 Bacteria 1352
458 Ga0501075_0545378 3300049591 Bacteria 885
459 Ga0501075_0618571 3300049591 Bacteria 826
460 Ga0501076_0012082 3300049592 Bacteria 6453
461 Ga0501076_0030297 3300049592 Bacteria 4214
462 Ga0501076_0082594 3300049592 Bacteria 2579
463 Ga0501076_0100623 3300049592 Bacteria 2329
464 Ga0501076_0157780 3300049592 Bacteria 1847
465 Ga0501076_0226862 3300049592 Bacteria 1527
466 Ga0501076_0271222 3300049592 Bacteria 1389
467 Ga0501076_0324727 3300049592 Bacteria 1262
468 Ga0501077_0061325 3300049593 Bacteria 2386
469 Ga0501077_0064502 3300049593 Bacteria 2323
470 Ga0501079_0042146 3300049741 Bacteria 3526
471 Ga0501079_0045276 3300049741 Bacteria 3396
472 Ga0501079_0059150 3300049741 Bacteria 2956
473 Ga0501079_0217660 3300049741 Bacteria 1492
474 Ga0501079_0238906 3300049741 Bacteria 1419
475 Ga0501079_0648336 3300049741 Bacteria 831
476 Ga0501080_0097415 3300049742 Bacteria 2731
477 Ga0501080_0421890 3300049742 Bacteria 1198
478 Ga0501081_0005509 3300049743 Bacteria 8174
479 Ga0501081_0058968 3300049743 Bacteria 2656
480 Ga0501081_0090262 3300049743 Bacteria 2154
481 Ga0501081_0568927 3300049743 Bacteria 847
482 Ga0501083_0139714 3300049744 Bacteria 1586
483 Ga0501035_0081578 3300049822 Bacteria 2854
484 Ga0501035_0381854 3300049822 Bacteria 1175
485 Ga0501035_0616064 3300049822 Bacteria 883
486 Ga0501044_0348695 3300049823 Bacteria 1400
487 Ga0501045_0134782 3300049824 Bacteria 1836
488 Ga0501045_0145892 3300049824 Bacteria 1760
489 Ga0501045_0355312 3300049824 Bacteria 1090
490 nmdc:mga0yw44_183061_c1 3300050492 Bacteria 1379
491 nmdc:mga0yw44_70535_c1 3300050492 Bacteria 2167
492 nmdc:mga05p37_198539_c1 3300050507 Bacteria 2431
493 nmdc:mga05p37_232117_c1 3300050507 Bacteria 2222
494 nmdc:mga05p37_269141_c1 3300050507 Bacteria 2036
495 nmdc:mga05p37_590053_c1 3300050507 Bacteria 1256
496 nmdc:mga05p37_637_c1 3300050507 Bacteria 38821
497 nmdc:mga06r32_51506_c1 3300050510 Bacteria 3940
498 nmdc:mga08y16_129514_c1 3300050511 Bacteria 2625
499 nmdc:mga0n895_149586_c1 3300050512 Bacteria 2364
500 nmdc:mga0n895_27764_c1 3300050512 Bacteria 5380
501 nmdc:mga0rr50_47554_c1 3300050513 Bacteria 3165
502 nmdc:mga0rr50_54420_c1 3300050513 Bacteria 2981
503 nmdc:mga0a205_15148_c1 3300050515 Bacteria 7203
504 nmdc:mga0a205_21369_c1 3300050515 Bacteria 6123
505 nmdc:mga0a205_6996_c1 3300050515 Bacteria 10192
506 Ga0495601_0029259 3300053077 Bacteria 3415
507 Ga0495601_0257717 3300053077 Bacteria 1139
508 Ga0495612_0000194 3300053078 Bacteria 25906
509 Ga0495595_0057018 3300053084 Bacteria 1821
510 Ga0495595_0057691 3300053084 Bacteria 1811
511 Ga0501084_0037972 3300054114 Bacteria 4025
512 Ga0501084_0110663 3300054114 Bacteria 2308
513 Ga0501084_0242128 3300054114 Bacteria 1522
514 Ga0501084_0289147 3300054114 Bacteria 1384
515 Ga0590074_010089 3300059423 Bacteria 1578
516 Ga0590077_004830 3300059426 Bacteria 2756
517 Ga0501082_0083982 3300060353 Bacteria 2747
518 Ga0501082_0116487 3300060353 Bacteria 2314
519 Ga0501082_0340071 3300060353 Bacteria 1308
520 Ga0501082_0443802 3300060353 Bacteria 1134
521 Ga0501082_0579351 3300060353 Bacteria 982
522 Ga0501082_0614495 3300060353 Bacteria 951
523 Ga0530510_0003060 3300061734 Bacteria 11485
524 Ga0530510_0027895 3300061734 Bacteria 4047
525 Ga0530510_0239223 3300061734 Bacteria 1351
526 Ga0530510_0336183 3300061734 Bacteria 1133
527 Ga0530510_0434534 3300061734 Bacteria 991
528 Ga0530510_0566451 3300061734 Bacteria 863
529 Ga0070707_100263387
530 rootH1_10132324
531 Ga0070683_100217489
532 Ga0070690_100020286
533 Ga0070670_100046550
534 Ga0068869_100075202
535 Ga0068869_100434361
536 Ga0070680_100000001
537 Ga0068868_100105425
538 Ga0068868_100311720
539 Ga0070660_100178292
540 Ga0070675_100070336
541 Ga0070671_100211087
542 Ga0070671_100471735
543 Ga0070674_100309189
544 Ga0070673_100275180
545 Ga0070673_100504471
546 Ga0070659_100310584
547 Ga0070703_10147242
548 Ga0070701_10031896
549 Ga0070701_10217538
550 Ga0070711_100482017
551 Ga0070705_100029423
552 Ga0070705_100092672
553 Ga0070705_100123483
554 Ga0070705_100124733
555 Ga0070705_100523029
556 Ga0070694_100037169
557 Ga0070694_100210837
558 Ga0070708_100000821
559 Ga0070708_100014098
560 Ga0070708_100060539
561 Ga0070708_100175285
562 Ga0070678_100092746
563 Ga0070681_10221296
564 Ga0070685_10016992
565 Ga0070706_100002583
566 Ga0070706_100022733
567 Ga0070706_100106390
568 Ga0070706_100469554
569 Ga0070707_100000163
570 Ga0070707_100038400
571 Ga0070707_100162019
572 Ga0070698_100016770
573 Ga0070698_100030465
574 Ga0070698_100056405
575 Ga0070698_100295203
576 Ga0070698_100374614
577 Ga0070699_100001296
578 Ga0070699_100006966
579 Ga0070699_100008469
580 Ga0070699_100147870
581 Ga0070699_100188661
582 Ga0070684_100135795
583 Ga0070697_100020155
584 Ga0070697_100100936
585 Ga0070697_100315874
586 Ga0070697_100336715
587 Ga0070686_100046074
588 Ga0070686_100103887
589 Ga0070686_100119015
590 Ga0070686_100282115
591 Ga0070686_100416115
592 Ga0070695_100005199
593 Ga0070695_100175311
594 Ga0070695_100310671
595 Ga0070696_100017275
596 Ga0070696_100043198
597 Ga0070696_100061240
598 Ga0070696_100062353
599 Ga0070696_100085580
600 Ga0070696_100340052
601 Ga0070665_100481556
602 Ga0070704_100233124
603 Ga0070704_100464315
604 Ga0068855_100474259
605 Ga0068857_100597736
606 Ga0068856_100254759
607 Ga0070702_100036169
608 Ga0068852_100033278
609 Ga0068859_101383905
610 Ga0068864_100016751
611 Ga0068864_100231117
612 Ga0068864_100804160
613 Ga0068861_100044817
614 Ga0068858_100071346
615 Ga0068858_100315767
616 Ga0068858_100826190
617 Ga0068860_100021677
618 Ga0068860_100404018
619 Ga0081455_10058099
620 Ga0081538_10115030
621 Ga0081539_10004486
622 Ga0081539_10004682
623 Ga0081539_10224244
624 Ga0075365_10100702
625 Ga0075365_10123070
626 Ga0068871_100263570
627 Ga0075428_100006306
628 Ga0075428_100139365
629 Ga0075428_100401646
630 Ga0075431_100361650
631 Ga0075433_10010909
632 Ga0075433_10059339
633 Ga0075433_10448014
634 Ga0075434_100085179
635 Ga0075434_100285329
636 Ga0075434_100531196
637 Ga0068865_100115942
638 Ga0075436_100079486
639 Ga0075436_100338607
640 Ga0097620_101383649
641 Ga0075435_100218619
642 Ga0111539_10050526
643 Ga0111539_10061763
644 Ga0111539_10226672
645 Ga0111539_10779176
646 Ga0105245_10011782
647 Ga0105245_10027477
648 Ga0105245_10142338
649 Ga0105245_10343376
650 Ga0114129_10017170
651 Ga0114129_10023210
652 Ga0114129_10031372
653 Ga0114129_10078320
654 Ga0114129_10163365
655 Ga0114129_10179484
656 Ga0114129_10248139
657 Ga0114129_10632605
658 Ga0114129_10659761
659 Ga0105243_10177854
660 Ga0105243_10344277
661 Ga0105243_10784397
662 Ga0105243_10817300
663 Ga0105242_10015410
664 Ga0105242_10057001
665 Ga0105242_10408873
666 Ga0105242_10489532
667 Ga0105248_10053695
668 Ga0105248_10462505
669 Ga0105237_10290433
670 Ga0105238_10058938
671 Ga0105249_10017648
672 Ga0105249_10049105
673 Ga0105249_10099722
674 Ga0105239_10030852
675 Ga0105239_10030875
676 Ga0105239_10152943
677 Ga0105239_10500849
678 Ga0105239_10574667
679 Ga0105246_10118752
680 Ga0105246_10387068
681 Ga0157371_10420184
682 Ga0157378_10036328
683 Ga0157378_10101067
684 Ga0157378_10269438
685 Ga0157378_10525618
686 Ga0163162_10132545
687 Ga0157372_10602861
688 Ga0157375_10132318
689 Ga0157375_10165714
690 Ga0157375_10362588
691 Ga0157375_11103393
692 Ga0163163_10040014
693 Ga0163163_10047205
694 Ga0163163_10053799
695 Ga0163163_10111233
696 Ga0163163_10143296
697 Ga0157380_10109263
698 Ga0182008_10045516
699 Ga0182008_10248401
700 Ga0157377_10167358
701 Ga0157379_10097165
702 Ga0157379_10476379
703 Ga0157379_10629737
704 Ga0157376_10246182
705 Ga0157376_10629851
706 Ga0163161_10024639
707 Ga0213875_10037545
708 Ga0207688_10042154
709 Ga0207645_10087342
710 Ga0207643_10026836
711 Ga0207684_10004490
712 Ga0207684_10020103
713 Ga0207684_10065472
714 Ga0207654_10359516
715 Ga0207707_10271369
716 Ga0207707_10299902
717 Ga0207660_10000001
718 Ga0207660_10227969
719 Ga0207662_10013089
720 Ga0207662_10259675
721 Ga0207646_10024913
722 Ga0207646_10027694
723 Ga0207646_10063249
724 Ga0207646_10149853
725 Ga0207646_10201290
726 Ga0207646_10229683
727 Ga0207646_10716099
728 Ga0207694_10042763
729 Ga0207659_10316623
730 Ga0207687_10030545
731 Ga0207687_10083898
732 Ga0207690_10313882
733 Ga0207706_10197276
734 Ga0207709_10105765
735 Ga0207709_10573319
736 Ga0207669_10091358
737 Ga0207669_10147345
738 Ga0207704_10341086
739 Ga0207689_10253336
740 Ga0207661_10110268
741 Ga0207651_10293039
742 Ga0207712_10026386
743 Ga0207668_10188619
744 Ga0207640_10604732
745 Ga0207677_10129034
746 Ga0207677_10211134
747 Ga0207677_10422074
748 Ga0207677_10540084
749 Ga0207703_10379353
750 Ga0207678_10029229
751 Ga0207678_10579863
752 Ga0207641_10359712
753 Ga0207648_10005758
754 Ga0207676_10036764
755 Ga0207676_10077572
756 Ga0207676_10436196
757 Ga0207676_10621375
758 Ga0207674_10007027
759 Ga0207675_100031518
760 Ga0207675_100199946
761 Ga0207675_100461633
762 Ga0207675_100567278
763 Ga0207683_10019227
764 Ga0207683_10162205
765 Ga0207683_10585366
766 Ga0207428_10182096
767 Ga0268264_10303073
768 Ga0268264_11004635
769 Ga0265319_1017322
770 Ga0265334_10016828
771 Ga0265318_10011380
772 Ga0265336_10021994
773 Ga0265324_10013719
774 Ga0265325_10088202
775 Ga0265325_10140426
776 Ga0265329_10006016
777 Ga0265340_10047916
778 Ga0265339_10111577
779 Ga0265331_10068999
780 Ga0265316_10094337
781 Ga0265316_10314759
782 Ga0307408_100052251
783 Ga0265313_10081082
784 Ga0265314_10007700
785 Ga0265314_10025249
786 Ga0265342_10095601
787 Ga0265342_10273362
788 Ga0316577_10176096
789 Ga0307406_10052370
790 Ga0307407_10121315
791 Ga0307407_10187122
792 Ga0307407_10307437
793 Ga0307407_10329237
794 Ga0307409_100119016
795 Ga0307409_100173093
796 Ga0307409_100554412
797 Ga0307416_100001078
798 Ga0307416_100360052
799 Ga0307415_100017280
800 Ga0307415_100029246
801 Ga0307415_100192450
802 Ga0316596_1056142
803 Ga0373932_0013873
804 Ga0373931_0364167
805 Ga0373937_0287334
806 Ga0373937_0354700
807 Ga0373937_0613016
808 Ga0436364_1141177
809 Ga0436365_0436981
810 Ga0439466_0075890
811 Ga0439465_0068609
812 Ga0439465_0084158
813 Ga0451800_1543090
814 Ga0451845_0804036
815 Ga0451577_0363193
816 Ga0451577_0430704
817 Ga0466972_0015333
818 Ga0466965_0002780
819 Ga0453684_0352095
820 Ga0466968_0007567
821 Ga0466960_0004790
822 Ga0466960_0130455
823 Ga0451576_0180712
824 Ga0451576_1090473
825 Ga0495592_0273486
826 Ga0495603_0106824
827 Ga0495629_0165705
828 Ga0495641_0062364
829 Ga0495651_0029801
830 Ga0495618_0156353
831 Ga0495628_0095484
832 Ga0495628_0131263
833 Ga0495630_0318814
834 Ga0495644_0123725
835 Ga0495652_0091843
836 Ga0495640_0076817
837 Ga0495645_0054379
838 Ga0495667_0081332
839 Ga0495634_0035843
840 Ga0495659_0081006
841 Ga0495657_0150695
842 Ga0495657_0316916
843 Ga0495647_0173653
844 Ga0495658_0202135
845 Ga0495613_0258227
846 Ga0495600_0115131
847 Ga0495581_0102194
848 Ga0495581_0370555
849 Ga0495674_0047327
850 Ga0495674_0420237
851 Ga0495674_0517941
852 Ga0495676_0270203
853 Ga0495680_0076064
854 Ga0495684_0283825
855 Ga0495602_0179263
856 Ga0496101_0182201
857 Ga0496101_0215889
858 Ga0496102_0017689
859 Ga0496102_0121144
860 Ga0496102_0171092
861 Ga0496102_0405809
862 Ga0496102_0438996
863 Ga0496102_0550211
864 Ga0496103_0004315
865 Ga0496104_0040088
866 Ga0496104_0041044
867 Ga0496104_0159610
868 Ga0496104_0379838
869 Ga0496105_0039248
870 Ga0496105_0044291
871 Ga0496105_0129274
872 Ga0496105_0528846
873 Ga0496106_0125097
874 Ga0496106_0148766
875 Ga0496106_0181323
876 Ga0496106_0274117
877 Ga0496106_0285426
878 Ga0496106_0346820
879 Ga0496107_0139466
880 Ga0496107_0211599
881 Ga0496107_0266705
882 Ga0496107_0347279
883 Ga0496108_0013593
884 Ga0496108_0019610
885 Ga0496108_0047955
886 Ga0496108_0233529
887 Ga0496108_0258932
888 Ga0496108_0330625
889 Ga0496109_0006101
890 Ga0496109_0034715
891 Ga0496109_0065470
892 Ga0496109_0107892
893 Ga0496109_0117430
894 Ga0496109_0128781
895 Ga0496109_0224984
896 Ga0496109_0234230
897 Ga0496109_0500897
898 Ga0496110_0175009
899 Ga0496110_0207198
900 Ga0496110_0359102
901 Ga0496111_0050686
902 Ga0496111_0146928
903 Ga0496111_0168104
904 Ga0496111_0212383
905 Ga0496112_0000005
906 Ga0496112_0046518
907 Ga0496112_0072896
908 Ga0496112_0269960
909 Ga0496112_0416431
910 Ga0496112_0586342
911 Ga0496113_0013089
912 Ga0496113_0260526
913 Ga0496113_0314273
914 Ga0496113_0445484
915 Ga0496114_0015659
916 Ga0496114_0133463
917 Ga0496114_0256822
918 Ga0496114_0281860
919 Ga0496114_0331666
920 Ga0496114_0340999
921 Ga0496114_0382625
922 Ga0501031_0053428
923 Ga0501031_0531518
924 Ga0501033_0095133
925 Ga0501033_0414534
926 Ga0501034_0295356
927 Ga0501036_0023106
928 Ga0501036_0095903
929 Ga0501036_0218388
930 Ga0501036_0236583
931 Ga0501036_0401142
932 Ga0501037_0052726
933 Ga0501038_0080136
934 Ga0501038_0158187
935 Ga0501039_0064750
936 Ga0501039_0399044
937 Ga0501040_0008798
938 Ga0501040_0072430
939 Ga0501040_0129111
940 Ga0501040_0365006
941 Ga0501041_0044239
942 Ga0501041_0074691
943 Ga0501041_0150803
944 Ga0501041_0222229
945 Ga0501042_0036977
946 Ga0501042_0061778
947 Ga0501042_0138714
948 Ga0501043_0527885
949 Ga0501046_0077808
950 Ga0501046_0154837
951 Ga0501048_0021779
952 Ga0501048_0042886
953 Ga0501048_0125830
954 Ga0501048_0258571
955 Ga0501048_0312805
956 Ga0501067_0036786
957 Ga0501067_0051741
958 Ga0501067_0071262
959 Ga0501067_0139018
960 Ga0501068_0040275
961 Ga0501068_0068240
962 Ga0501068_0109944
963 Ga0501068_0200654
964 Ga0501069_0019597
965 Ga0501069_0043165
966 Ga0501069_0048463
967 Ga0501070_0062599
968 Ga0501071_0097848
969 Ga0501071_0198063
970 Ga0501071_0285115
971 Ga0501072_0032634
972 Ga0501072_0039753
973 Ga0501073_0069949
974 Ga0501073_0131923
975 Ga0501074_0035149
976 Ga0501074_0232884
977 Ga0501074_0275796
978 Ga0501074_0276603
979 Ga0501074_0594066
980 Ga0501075_0008458
981 Ga0501075_0009473
982 Ga0501075_0017386
983 Ga0501075_0023538
984 Ga0501075_0063042
985 Ga0501075_0249856
986 Ga0501075_0545378
987 Ga0501075_0618571
988 Ga0501076_0012082
989 Ga0501076_0030297
990 Ga0501076_0082594
991 Ga0501076_0100623
992 Ga0501076_0157780
993 Ga0501076_0226862
994 Ga0501076_0271222
995 Ga0501076_0324727
996 Ga0501077_0061325
997 Ga0501077_0064502
998 Ga0501079_0042146
999 Ga0501079_0045276
1000 Ga0501079_0059150
1001 Ga0501079_0217660
1002 Ga0501079_0238906
1003 Ga0501079_0648336
1004 Ga0501080_0097415
1005 Ga0501080_0421890
1006 Ga0501081_0005509
1007 Ga0501081_0058968
1008 Ga0501081_0090262
1009 Ga0501081_0568927
1010 Ga0501083_0139714
1011 Ga0501035_0081578
1012 Ga0501035_0381854
1013 Ga0501035_0616064
1014 Ga0501044_0348695
1015 Ga0501045_0134782
1016 Ga0501045_0145892
1017 Ga0501045_0355312
1018 nmdc:mga0yw44_183061_c1
1019 nmdc:mga0yw44_70535_c1
1020 nmdc:mga05p37_198539_c1
1021 nmdc:mga05p37_232117_c1
1022 nmdc:mga05p37_269141_c1
1023 nmdc:mga05p37_590053_c1
1024 nmdc:mga05p37_637_c1
1025 nmdc:mga06r32_51506_c1
1026 nmdc:mga08y16_129514_c1
1027 nmdc:mga0n895_149586_c1
1028 nmdc:mga0n895_27764_c1
1029 nmdc:mga0rr50_47554_c1
1030 nmdc:mga0rr50_54420_c1
1031 nmdc:mga0a205_15148_c1
1032 nmdc:mga0a205_21369_c1
1033 nmdc:mga0a205_6996_c1
1034 Ga0495601_0029259
1035 Ga0495601_0257717
1036 Ga0495612_0000194
1037 Ga0495595_0057018
1038 Ga0495595_0057691
1039 Ga0501084_0037972
1040 Ga0501084_0110663
1041 Ga0501084_0242128
1042 Ga0501084_0289147
1043 Ga0590074_010089
1044 Ga0590077_004830
1045 Ga0501082_0083982
1046 Ga0501082_0116487
1047 Ga0501082_0340071
1048 Ga0501082_0443802
1049 Ga0501082_0579351
1050 Ga0501082_0614495
1051 Ga0530510_0003060
1052 Ga0530510_0027895
1053 Ga0530510_0239223
1054 Ga0530510_0336183
1055 Ga0530510_0434534
1056 Ga0530510_0566451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

69

247

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9708 101 229
7alc-assembly1.cif.gz_D-2 human gch-gfrp stimulatory complex 0.9664 52 229
7alb-assembly1.cif.gz_G human gch-gfrp stimulatory complex 7-deaza-gtp bound 0.9645 52 229
7alc-assembly1.cif.gz_E-2 human gch-gfrp stimulatory complex 0.9635 52 229
6z89-assembly1.cif.gz_D-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9621 52 229
ID Description Score Start End Superfamily
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.949 102 213 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9409 102 226 3.30.1130.10
1is8A01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9396 52 95 1.10.286.10
1is7A01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9372 52 95 1.10.286.10
1is8H01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9361 52 95 1.10.286.10
ID Description Score Start End GO Terms
AF-X1MIN2-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9998 103 193 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A284QYY9-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9763 50 190 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
GO:0046656
AF-A0A7W1EP47-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9736 52 193 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A6I1Z709-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9728 52 178 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A7V0M1S9-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9722 52 143 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654

Map