F459631

General Info

Members Datasets Scaffolds Average Seq Length
528 242 527 145

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_101272700|Ga0070671_1012727001
Length 174
Sequence MERVILTKLVTRAVAYTGILFYLAAMSQFTRYPELRWSDIDPNLHLRHSVYYDLGAWCRIEFLNEHQITAEFMHRHRFGPILFREECVFKKEIRLGDKLSVDLRLLKSYKDFSRWTMQHQIFKDGEILAAVITLDGAWIDTVQRKLAVPPRGVCDTFENMPRSEAFEWIEKKTV

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
171 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
172 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
173 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
176 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
177 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
180 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
181 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
200 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
211 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
212 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
213 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
235 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
239 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 0.95
Rhizosphere 91.67
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013453 3300001979 Bacteria 3051
2 JGI24751J29686_10030150 3300002459 Bacteria 1125
3 rootH2_10189197 3300003320 Bacteria 4384
4 rootL2_10155484 3300003322 Bacteria 2617
5 rootL2_10167564 3300003322 Bacteria 3094
6 rootH1_10170087 3300003323 Bacteria 6558
7 Ga0065712_10003463 3300005290 Bacteria 4883
8 Ga0065712_10515896 3300005290 Unclassified 594
9 Ga0065707_10315537 3300005295 Unclassified 976
10 Ga0070658_11002739 3300005327 Bacteria 726
11 Ga0070658_11391461 3300005327 Bacteria 609
12 Ga0070676_10027613 3300005328 Bacteria 3220
13 Ga0070676_10126186 3300005328 Bacteria 1613
14 Ga0070676_11123342 3300005328 Bacteria 595
15 Ga0070683_100000822 3300005329 Bacteria 22987
16 Ga0070690_100338380 3300005330 Unclassified 1089
17 Ga0070670_100030765 3300005331 Unclassified 4623
18 Ga0070670_100137536 3300005331 Bacteria 2111
19 Ga0070670_100206288 3300005331 Bacteria 1708
20 Ga0070670_100207497 3300005331 Unclassified 1703
21 Ga0070670_100990624 3300005331 Bacteria 764
22 Ga0068869_100019296 3300005334 Bacteria 4656
23 Ga0068869_100257968 3300005334 Bacteria 1395
24 Ga0070666_10000140 3300005335 Bacteria 50189
25 Ga0070666_11207430 3300005335 Bacteria 563
26 Ga0070680_100079386 3300005336 Bacteria 2705
27 Ga0070682_100078431 3300005337 Bacteria 2130
28 Ga0070682_100596573 3300005337 Unclassified 871
29 Ga0068868_100014125 3300005338 Bacteria 5879
30 Ga0068868_100144899 3300005338 Bacteria 1952
31 Ga0068868_100148887 3300005338 Bacteria 1926
32 Ga0068868_100391578 3300005338 Bacteria 1197
33 Ga0068868_100800692 3300005338 Bacteria 850
34 Ga0070660_100020174 3300005339 Bacteria 4894
35 Ga0070660_100839865 3300005339 Bacteria 773
36 Ga0070689_100003147 3300005340 Bacteria 10917
37 Ga0070661_100070471 3300005344 Bacteria 2571
38 Ga0070661_100076266 3300005344 Bacteria 2470
39 Ga0070661_100706694 3300005344 Bacteria 822
40 Ga0070668_100440007 3300005347 Bacteria 1119
41 Ga0070668_101376336 3300005347 Bacteria 643
42 Ga0070669_100005206 3300005353 Bacteria 9401
43 Ga0070669_100552296 3300005353 Bacteria 960
44 Ga0070669_100561349 3300005353 Bacteria 953
45 Ga0070669_101686261 3300005353 Unclassified 552
46 Ga0070675_100006515 3300005354 Bacteria 8969
47 Ga0070675_100090498 3300005354 Bacteria 2563
48 Ga0070675_100171509 3300005354 Bacteria 1871
49 Ga0070675_100213277 3300005354 Unclassified 1679
50 Ga0070675_100447089 3300005354 Bacteria 1159
51 Ga0070671_100136869 3300005355 Bacteria 2065
52 Ga0070671_100212005 3300005355 Bacteria 1643
53 Ga0070671_100247226 3300005355 Bacteria 1515
54 Ga0070671_101272700 3300005355 Unclassified 648
55 Ga0070671_102026107 3300005355 Unclassified 512
56 Ga0070674_100411237 3300005356 Bacteria 1108
57 Ga0070673_100046844 3300005364 Bacteria 3360
58 Ga0070673_100073354 3300005364 Unclassified 2754
59 Ga0070673_100834321 3300005364 Bacteria 852
60 Ga0070688_100005114 3300005365 Bacteria 6876
61 Ga0070688_100092091 3300005365 Unclassified 1982
62 Ga0070688_100170222 3300005365 Bacteria 1503
63 Ga0070688_100476672 3300005365 Bacteria 937
64 Ga0070659_100008294 3300005366 Bacteria 7586
65 Ga0070659_100013275 3300005366 Bacteria 6126
66 Ga0070667_100026703 3300005367 Bacteria 4803
67 Ga0070667_100186230 3300005367 Bacteria 1837
68 Ga0070667_100192372 3300005367 Bacteria 1808
69 Ga0070667_100248550 3300005367 Bacteria 1590
70 Ga0070701_10107444 3300005438 Bacteria 1554
71 Ga0070700_100366869 3300005441 Bacteria 1072
72 Ga0070700_100923252 3300005441 Bacteria 712
73 Ga0070694_100761277 3300005444 Unclassified 791
74 Ga0070678_100479702 3300005456 Unclassified 1094
75 Ga0070678_101222598 3300005456 Bacteria 697
76 Ga0070662_100020763 3300005457 Bacteria 4479
77 Ga0070681_10170611 3300005458 Bacteria 2097
78 Ga0068867_100015718 3300005459 Bacteria 5371
79 Ga0068867_100085605 3300005459 Bacteria 2383
80 Ga0068867_100087841 3300005459 Bacteria 2355
81 Ga0068867_100100112 3300005459 Bacteria 2212
82 Ga0068867_100317122 3300005459 Bacteria 1290
83 Ga0068867_100330554 3300005459 Bacteria 1266
84 Ga0068867_101052751 3300005459 Bacteria 740
85 Ga0070685_10030944 3300005466 Unclassified 2986
86 Ga0070685_10740851 3300005466 Bacteria 720
87 Ga0070698_100576503 3300005471 Bacteria 1065
88 Ga0070679_100104036 3300005530 Bacteria 2826
89 Ga0070684_100018970 3300005535 Bacteria 5680
90 Ga0070684_100113251 3300005535 Bacteria 2434
91 Ga0068853_100286295 3300005539 Bacteria 1520
92 Ga0068853_100743505 3300005539 Bacteria 937
93 Ga0068853_101390633 3300005539 Bacteria 679
94 Ga0068853_101802988 3300005539 Bacteria 593
95 Ga0070672_100084867 3300005543 Bacteria 2544
96 Ga0070672_100085447 3300005543 Bacteria 2536
97 Ga0070672_100173317 3300005543 Unclassified 1795
98 Ga0070672_100994424 3300005543 Bacteria 743
99 Ga0070672_101322113 3300005543 Bacteria 644
100 Ga0070696_100515474 3300005546 Bacteria 953
101 Ga0070693_100084072 3300005547 Bacteria 1904
102 Ga0070665_100185952 3300005548 Bacteria 2078
103 Ga0070665_100405617 3300005548 Bacteria 1371
104 Ga0070665_100654916 3300005548 Unclassified 1063
105 Ga0070704_100080162 3300005549 Unclassified 2400
106 Ga0068855_100010513 3300005563 Bacteria 11166
107 Ga0068855_100274563 3300005563 Bacteria 1873
108 Ga0070664_100013343 3300005564 Bacteria 6691
109 Ga0070664_100172494 3300005564 Bacteria 1919
110 Ga0070664_100245150 3300005564 Bacteria 1609
111 Ga0070664_100376965 3300005564 Bacteria 1294
112 Ga0068857_100037614 3300005577 Bacteria 4288
113 Ga0068857_100048236 3300005577 Bacteria 3781
114 Ga0068857_100169625 3300005577 Bacteria 1983
115 Ga0068857_100283276 3300005577 Bacteria 1525
116 Ga0068854_100183835 3300005578 Bacteria 1634
117 Ga0068854_100215664 3300005578 Bacteria 1516
118 Ga0068854_100250084 3300005578 Bacteria 1415
119 Ga0068856_100008955 3300005614 Bacteria 9737
120 Ga0068856_100123326 3300005614 Bacteria 2593
121 Ga0068852_100004038 3300005616 Bacteria 10316
122 Ga0068852_100042142 3300005616 Bacteria 3863
123 Ga0068852_100915131 3300005616 Unclassified 894
124 Ga0068852_101115495 3300005616 Bacteria 809
125 Ga0068852_101510072 3300005616 Bacteria 694
126 Ga0068852_101757418 3300005616 Bacteria 643
127 Ga0068859_100005301 3300005617 Bacteria 13110
128 Ga0068859_100007673 3300005617 Bacteria 10961
129 Ga0068859_100011225 3300005617 Bacteria 9009
130 Ga0068859_100632863 3300005617 Unclassified 1162
131 Ga0068859_101280206 3300005617 Unclassified 808
132 Ga0068864_100074141 3300005618 Unclassified 2969
133 Ga0068864_100123126 3300005618 Bacteria 2321
134 Ga0068864_100280321 3300005618 Bacteria 1555
135 Ga0068864_100882849 3300005618 Bacteria 882
136 Ga0068866_10051005 3300005718 Bacteria 2104
137 Ga0068866_10478532 3300005718 Bacteria 820
138 Ga0068866_10948566 3300005718 Bacteria 608
139 Ga0068861_100009719 3300005719 Bacteria 6650
140 Ga0068861_100302254 3300005719 Bacteria 1387
141 Ga0068861_100449385 3300005719 Bacteria 1154
142 Ga0068851_10013184 3300005834 Bacteria 3910
143 Ga0068851_10056186 3300005834 Bacteria 2007
144 Ga0068851_10276249 3300005834 Bacteria 959
145 Ga0068870_10448192 3300005840 Bacteria 850
146 Ga0068863_100019417 3300005841 Bacteria 6500
147 Ga0068858_100008890 3300005842 Bacteria 9631
148 Ga0068860_100003714 3300005843 Bacteria 15692
149 Ga0068860_100013131 3300005843 Bacteria 8128
150 Ga0068860_100038579 3300005843 Bacteria 4570
151 Ga0068860_100444800 3300005843 Bacteria 1288
152 Ga0068860_101006091 3300005843 Bacteria 852
153 Ga0068862_100004753 3300005844 Bacteria 11433
154 Ga0068862_100979476 3300005844 Bacteria 835
155 Ga0075366_10014202 3300006195 Bacteria 4547
156 Ga0075366_10022539 3300006195 Bacteria 3664
157 Ga0097621_100007974 3300006237 Bacteria 7601
158 Ga0097621_100057470 3300006237 Bacteria 3182
159 Ga0097621_100977693 3300006237 Bacteria 791
160 Ga0068871_100007675 3300006358 Bacteria 7716
161 Ga0068871_100227397 3300006358 Bacteria 1618
162 Ga0068871_100299234 3300006358 Bacteria 1412
163 Ga0068871_101358826 3300006358 Bacteria 669
164 Ga0075433_10664481 3300006852 Unclassified 913
165 Ga0068865_100049998 3300006881 Bacteria 2886
166 Ga0068865_100074845 3300006881 Bacteria 2413
167 Ga0068865_100424104 3300006881 Bacteria 1094
168 Ga0068865_100683255 3300006881 Bacteria 875
169 Ga0097620_100005301 3300006931 Bacteria 13110
170 Ga0097620_100007673 3300006931 Bacteria 10961
171 Ga0097620_100011225 3300006931 Bacteria 9009
172 Ga0097620_100632759 3300006931 Unclassified 1162
173 Ga0097620_101280174 3300006931 Unclassified 808
174 Ga0105240_10438934 3300009093 Bacteria 1463
175 Ga0111539_10011963 3300009094 Bacteria 10882
176 Ga0111539_10499309 3300009094 Bacteria 1417
177 Ga0105245_10132240 3300009098 Bacteria 2341
178 Ga0105247_10022954 3300009101 Bacteria 3757
179 Ga0105243_10428563 3300009148 Bacteria 1236
180 Ga0105241_10006156 3300009174 Bacteria 8846
181 Ga0105241_10071986 3300009174 Unclassified 2685
182 Ga0105241_12201295 3300009174 Bacteria 547
183 Ga0105242_10929172 3300009176 Bacteria 872
184 Ga0105242_12061045 3300009176 Bacteria 614
185 Ga0105242_12069389 3300009176 Unclassified 613
186 Ga0105237_10001055 3300009545 Bacteria 37018
187 Ga0105237_10003256 3300009545 Bacteria 19411
188 Ga0105237_10072570 3300009545 Bacteria 3436
189 Ga0105249_10008383 3300009553 Bacteria 9002
190 Ga0105249_10017922 3300009553 Bacteria 6293
191 Ga0105239_10004772 3300010375 Bacteria 16091
192 Ga0105239_10016641 3300010375 Bacteria 8128
193 Ga0105239_10240926 3300010375 Bacteria 2030
194 Ga0105246_10434917 3300011119 Unclassified 1099
195 Ga0105246_10540779 3300011119 Bacteria 996
196 Ga0157373_10004590 3300013100 Bacteria 10395
197 Ga0157373_10064970 3300013100 Bacteria 2582
198 Ga0157373_10183097 3300013100 Bacteria 1475
199 Ga0157371_10052352 3300013102 Bacteria 2900
200 Ga0157371_10074953 3300013102 Bacteria 2396
201 Ga0157371_10109916 3300013102 Bacteria 1957
202 Ga0157371_10523898 3300013102 Bacteria 877
203 Ga0157371_10747653 3300013102 Unclassified 734
204 Ga0157371_10823664 3300013102 Bacteria 700
205 Ga0157370_10061444 3300013104 Bacteria 3566
206 Ga0157370_10187187 3300013104 Bacteria 1922
207 Ga0157370_10544904 3300013104 Bacteria 1064
208 Ga0157370_10561249 3300013104 Bacteria 1046
209 Ga0157369_10133552 3300013105 Bacteria 2629
210 Ga0157369_10515962 3300013105 Bacteria 1236
211 Ga0157369_12176537 3300013105 Unclassified 562
212 Ga0157374_10033679 3300013296 Bacteria 4676
213 Ga0157374_10242852 3300013296 Bacteria 1771
214 Ga0157374_10248237 3300013296 Bacteria 1751
215 Ga0157374_10478547 3300013296 Bacteria 1248
216 Ga0157374_10490102 3300013296 Bacteria 1233
217 Ga0157374_11568559 3300013296 Unclassified 682
218 Ga0157378_10013830 3300013297 Bacteria 7057
219 Ga0157378_10089299 3300013297 Bacteria 2798
220 Ga0157378_10139864 3300013297 Bacteria 2247
221 Ga0157378_10227989 3300013297 Bacteria 1774
222 Ga0157378_10379640 3300013297 Unclassified 1388
223 Ga0157378_10427485 3300013297 Unclassified 1310
224 Ga0157378_10950960 3300013297 Unclassified 892
225 Ga0163162_10004419 3300013306 Bacteria 13535
226 Ga0163162_10044565 3300013306 Bacteria 4443
227 Ga0163162_10052533 3300013306 Bacteria 4093
228 Ga0163162_10067985 3300013306 Bacteria 3614
229 Ga0163162_10274546 3300013306 Bacteria 1818
230 Ga0163162_10299278 3300013306 Bacteria 1741
231 Ga0163162_10367200 3300013306 Unclassified 1572
232 Ga0157372_10036086 3300013307 Bacteria 5447
233 Ga0157372_10087593 3300013307 Bacteria 3533
234 Ga0157372_10094426 3300013307 Bacteria 3406
235 Ga0157372_10110799 3300013307 Bacteria 3144
236 Ga0157372_10119439 3300013307 Bacteria 3026
237 Ga0157372_10122315 3300013307 Unclassified 2991
238 Ga0157372_10150716 3300013307 Bacteria 2684
239 Ga0157372_10495282 3300013307 Bacteria 1425
240 Ga0157372_10841871 3300013307 Unclassified 1065
241 Ga0157372_11269734 3300013307 Bacteria 850
242 Ga0157375_10009168 3300013308 Bacteria 8673
243 Ga0157375_10042711 3300013308 Bacteria 4390
244 Ga0157375_10355178 3300013308 Bacteria 1632
245 Ga0157375_10393902 3300013308 Bacteria 1552
246 Ga0157375_10419389 3300013308 Bacteria 1504
247 Ga0157375_12924997 3300013308 Bacteria 571
248 Ga0163163_10000616 3300014325 Bacteria 30789
249 Ga0163163_10013193 3300014325 Bacteria 7552
250 Ga0163163_10793468 3300014325 Bacteria 1010
251 Ga0157380_10003256 3300014326 Bacteria 11119
252 Ga0157380_10390316 3300014326 Unclassified 1317
253 Ga0157380_10807154 3300014326 Bacteria 956
254 Ga0157377_10003394 3300014745 Bacteria 7204
255 Ga0157377_10027446 3300014745 Bacteria 3057
256 Ga0157377_10037095 3300014745 Bacteria 2685
257 Ga0157377_10131035 3300014745 Bacteria 1531
258 Ga0157379_10107487 3300014968 Bacteria 2505
259 Ga0157379_10137286 3300014968 Unclassified 2203
260 Ga0157376_10006093 3300014969 Bacteria 8483
261 Ga0157376_10059314 3300014969 Bacteria 3209
262 Ga0157376_10213719 3300014969 Bacteria 1782
263 Ga0157376_10392749 3300014969 Bacteria 1339
264 Ga0157376_11566372 3300014969 Bacteria 693
265 Ga0157376_11743401 3300014969 Unclassified 658
266 Ga0163161_10091561 3300017792 Bacteria 2251
267 Ga0163161_10145618 3300017792 Bacteria 1797
268 Ga0163161_10322569 3300017792 Bacteria 1221
269 Ga0163161_10894894 3300017792 Bacteria 752
270 Ga0163161_12041748 3300017792 Unclassified 510
271 Ga0213876_10009856 3300021384 Bacteria 5141
272 Ga0207656_10016904 3300025321 Bacteria 2848
273 Ga0207656_10038311 3300025321 Bacteria 2022
274 Ga0207656_10048182 3300025321 Bacteria 1834
275 Ga0207656_10089357 3300025321 Bacteria 1396
276 Ga0207682_10034810 3300025893 Bacteria 2032
277 Ga0207642_10042933 3300025899 Bacteria 1991
278 Ga0207642_10351088 3300025899 Bacteria 870
279 Ga0207642_10509008 3300025899 Bacteria 738
280 Ga0207688_10113975 3300025901 Bacteria 1572
281 Ga0207680_10000140 3300025903 Bacteria 34445
282 Ga0207680_10293364 3300025903 Unclassified 1132
283 Ga0207647_10000110 3300025904 Bacteria 62980
284 Ga0207647_10049005 3300025904 Bacteria 2622
285 Ga0207647_10153056 3300025904 Unclassified 1347
286 Ga0207647_10204376 3300025904 Bacteria 1142
287 Ga0207645_10000885 3300025907 Bacteria 24873
288 Ga0207645_10056234 3300025907 Unclassified 2512
289 Ga0207645_10086812 3300025907 Bacteria 2010
290 Ga0207643_10004003 3300025908 Bacteria 7927
291 Ga0207705_10094318 3300025909 Bacteria 2195
292 Ga0207705_11085444 3300025909 Bacteria 617
293 Ga0207654_10016349 3300025911 Bacteria 3862
294 Ga0207654_10096423 3300025911 Bacteria 1814
295 Ga0207707_10273100 3300025912 Bacteria 1465
296 Ga0207695_10363740 3300025913 Bacteria 1333
297 Ga0207671_10004643 3300025914 Bacteria 13008
298 Ga0207660_10862180 3300025917 Bacteria 739
299 Ga0207662_10049337 3300025918 Bacteria 2497
300 Ga0207657_10008412 3300025919 Bacteria 10474
301 Ga0207657_10181553 3300025919 Unclassified 1701
302 Ga0207657_10700100 3300025919 Bacteria 787
303 Ga0207649_10043018 3300025920 Bacteria 2759
304 Ga0207649_10136439 3300025920 Bacteria 1673
305 Ga0207652_10593978 3300025921 Bacteria 993
306 Ga0207681_10016733 3300025923 Bacteria 4594
307 Ga0207681_11458256 3300025923 Unclassified 574
308 Ga0207650_10026300 3300025925 Bacteria 4149
309 Ga0207650_10031426 3300025925 Unclassified 3834
310 Ga0207650_10222019 3300025925 Unclassified 1521
311 Ga0207650_10491483 3300025925 Unclassified 1025
312 Ga0207650_11907200 3300025925 Bacteria 502
313 Ga0207659_10073065 3300025926 Bacteria 2510
314 Ga0207659_10129216 3300025926 Bacteria 1947
315 Ga0207659_10146696 3300025926 Bacteria 1838
316 Ga0207659_10553787 3300025926 Bacteria 978
317 Ga0207644_10077382 3300025931 Bacteria 2450
318 Ga0207644_10122298 3300025931 Bacteria 1983
319 Ga0207644_10224171 3300025931 Bacteria 1491
320 Ga0207644_10456996 3300025931 Bacteria 1050
321 Ga0207644_10592195 3300025931 Bacteria 920
322 Ga0207690_10011551 3300025932 Bacteria 5274
323 Ga0207690_10269362 3300025932 Bacteria 1322
324 Ga0207690_11347762 3300025932 Bacteria 596
325 Ga0207706_10003522 3300025933 Bacteria 14949
326 Ga0207706_10027363 3300025933 Bacteria 5098
327 Ga0207706_10281818 3300025933 Unclassified 1449
328 Ga0207686_10386877 3300025934 Bacteria 1062
329 Ga0207709_10172544 3300025935 Bacteria 1519
330 Ga0207670_10019033 3300025936 Bacteria 4185
331 Ga0207669_10020127 3300025937 Bacteria 3491
332 Ga0207704_10046872 3300025938 Bacteria 2579
333 Ga0207704_10110381 3300025938 Bacteria 1858
334 Ga0207691_10038025 3300025940 Bacteria 4453
335 Ga0207691_10126362 3300025940 Bacteria 2262
336 Ga0207691_10164983 3300025940 Bacteria 1942
337 Ga0207691_10180081 3300025940 Bacteria 1847
338 Ga0207711_11455462 3300025941 Unclassified 628
339 Ga0207689_10000857 3300025942 Bacteria 29330
340 Ga0207689_10013159 3300025942 Bacteria 7060
341 Ga0207689_10021062 3300025942 Bacteria 5480
342 Ga0207689_10116323 3300025942 Bacteria 2198
343 Ga0207661_10007166 3300025944 Bacteria 7922
344 Ga0207661_11131040 3300025944 Unclassified 721
345 Ga0207679_10641664 3300025945 Bacteria 960
346 Ga0207679_10824473 3300025945 Unclassified 846
347 Ga0207651_10120767 3300025960 Bacteria 1987
348 Ga0207651_10151482 3300025960 Bacteria 1806
349 Ga0207651_10159173 3300025960 Bacteria 1768
350 Ga0207712_10012455 3300025961 Bacteria 5433
351 Ga0207712_10465887 3300025961 Bacteria 1074
352 Ga0207712_10851210 3300025961 Unclassified 804
353 Ga0207668_10199495 3300025972 Bacteria 1592
354 Ga0207668_10287843 3300025972 Bacteria 1350
355 Ga0207640_10028788 3300025981 Unclassified 3401
356 Ga0207640_10116280 3300025981 Bacteria 1906
357 Ga0207640_10693275 3300025981 Unclassified 872
358 Ga0207658_10063060 3300025986 Bacteria 2776
359 Ga0207658_10160970 3300025986 Bacteria 1839
360 Ga0207658_10440584 3300025986 Bacteria 1152
361 Ga0207677_10004532 3300026023 Bacteria 7474
362 Ga0207677_10024508 3300026023 Bacteria 3750
363 Ga0207677_10211063 3300026023 Bacteria 1551
364 Ga0207677_10828482 3300026023 Bacteria 830
365 Ga0207703_10005628 3300026035 Bacteria 10060
366 Ga0207639_10169330 3300026041 Bacteria 1848
367 Ga0207708_10399854 3300026075 Bacteria 1136
368 Ga0207702_10092075 3300026078 Bacteria 2656
369 Ga0207641_10000082 3300026088 Bacteria 138385
370 Ga0207641_10014637 3300026088 Bacteria 6432
371 Ga0207648_10000510 3300026089 Bacteria 43437
372 Ga0207648_10001518 3300026089 Bacteria 25557
373 Ga0207648_10015903 3300026089 Bacteria 6896
374 Ga0207648_10025914 3300026089 Bacteria 5215
375 Ga0207648_10037174 3300026089 Bacteria 4288
376 Ga0207648_10075631 3300026089 Bacteria 2935
377 Ga0207648_10106303 3300026089 Bacteria 2462
378 Ga0207676_10070512 3300026095 Unclassified 2803
379 Ga0207676_10252952 3300026095 Bacteria 1587
380 Ga0207676_10804230 3300026095 Unclassified 917
381 Ga0207674_10041481 3300026116 Bacteria 4760
382 Ga0207674_10052605 3300026116 Bacteria 4153
383 Ga0207674_10189006 3300026116 Bacteria 2009
384 Ga0207674_10339666 3300026116 Bacteria 1452
385 Ga0207674_10521646 3300026116 Bacteria 1148
386 Ga0207674_10577951 3300026116 Bacteria 1085
387 Ga0207675_100008333 3300026118 Bacteria 9767
388 Ga0207675_100024542 3300026118 Bacteria 5605
389 Ga0207675_100901017 3300026118 Bacteria 901
390 Ga0207683_10003647 3300026121 Bacteria 13395
391 Ga0207683_10350538 3300026121 Bacteria 1355
392 Ga0207683_10786751 3300026121 Unclassified 883
393 Ga0207683_11476460 3300026121 Bacteria 628
394 Ga0207698_10006840 3300026142 Bacteria 7132
395 Ga0207698_10033604 3300026142 Bacteria 3729
396 Ga0207698_10164860 3300026142 Bacteria 1943
397 Ga0207698_10341067 3300026142 Bacteria 1411
398 Ga0207698_10351806 3300026142 Bacteria 1392
399 Ga0207698_11022263 3300026142 Bacteria 838
400 Ga0209995_1002856 3300027471 Bacteria 2739
401 Ga0207428_10223269 3300027907 Unclassified 1411
402 Ga0268265_10004351 3300028380 Bacteria 9846
403 Ga0268265_10133247 3300028380 Bacteria 2069
404 Ga0268265_12292410 3300028380 Unclassified 547
405 Ga0268264_10000810 3300028381 Bacteria 33689
406 Ga0268264_10095464 3300028381 Bacteria 2573
407 Ga0268264_10170682 3300028381 Bacteria 1967
408 Ga0268264_10933956 3300028381 Bacteria 872
409 Ga0268264_10941279 3300028381 Unclassified 869
410 Ga0268264_11053681 3300028381 Bacteria 821
411 Ga0268264_11425996 3300028381 Bacteria 703
412 Ga0307515_10000412 3300028794 Bacteria 103361
413 Ga0307513_10411083 3300031456 Bacteria 1085
414 Ga0307513_10602506 3300031456 Bacteria 808
415 Ga0307509_10024172 3300031507 Bacteria 6809
416 Ga0307509_10057749 3300031507 Bacteria 4113
417 Ga0307508_10000407 3300031616 Bacteria 51637
418 Ga0307413_11766337 3300031824 Unclassified 553
419 Ga0307411_11554356 3300032005 Bacteria 609
420 Ga0307415_100693367 3300032126 Bacteria 918
421 Ga0373925_0663425 3300037068 Unclassified 860
422 Ga0395900_0577540 3300037418 Unclassified 1066
423 Ga0395905_0114020 3300037471 Bacteria 2540
424 Ga0395905_0527061 3300037471 Unclassified 1082
425 Ga0436365_0716477 3300039437 Bacteria 57230
426 Ga0439436_0012351 3300041404 Bacteria 2593
427 Ga0439439_0129546 3300041406 Bacteria 708
428 Ga0439465_0117994 3300041413 Bacteria 928
429 Ga0451789_0221219 3300041443 Unclassified 912
430 Ga0451791_1109553 3300041451 Unclassified 765
431 Ga0451793_1792388 3300041452 Unclassified 1103
432 Ga0451807_0946833 3300041486 Bacteria 646
433 Ga0451841_0332562 3300041498 Bacteria 1257
434 Ga0451845_0954817 3300041501 Bacteria 679
435 Ga0439433_0058424 3300041999 Bacteria 917
436 Ga0439442_002870 3300042002 Bacteria 3395
437 Ga0439445_0002485 3300042004 Bacteria 4103
438 Ga0439445_0042647 3300042004 Bacteria 1209
439 Ga0439449_0084766 3300042007 Bacteria 1169
440 Ga0439454_038643 3300042011 Bacteria 774
441 Ga0439457_031580 3300042014 Bacteria 1174
442 Ga0439462_0018811 3300042015 Bacteria 1795
443 Ga0439462_0112472 3300042015 Bacteria 754
444 Ga0450897_001392 3300042128 Unclassified 1645
445 Ga0450894_010152 3300042131 Bacteria 1221
446 Ga0450898_007999 3300042134 Bacteria 1658
447 Ga0439446_0106402 3300042156 Bacteria 891
448 Ga0439446_0118568 3300042156 Bacteria 850
449 Ga0439434_0019877 3300042435 Bacteria 2015
450 Ga0466969_0187434 3300044656 Bacteria 946
451 Ga0466972_0000038 3300044658 Bacteria 135937
452 Ga0466966_0098836 3300044684 Bacteria 1806
453 Ga0466966_0103602 3300044684 Bacteria 1758
454 Ga0466961_0047735 3300044693 Bacteria 2738
455 Ga0466961_0330285 3300044693 Bacteria 929
456 Ga0453684_0063353 3300044712 Bacteria 4730
457 Ga0466968_0032828 3300044735 Bacteria 2161
458 Ga0466970_0131722 3300044765 Bacteria 1374
459 Ga0466957_0000186 3300044842 Bacteria 28257
460 Ga0466957_0011910 3300044842 Bacteria 5026
461 Ga0466959_0000380 3300045049 Bacteria 26260
462 Ga0466967_0304492 3300045976 Bacteria 1534
463 Ga0495643_0047658 3300046522 Bacteria 2320
464 Ga0495649_0213785 3300046694 Bacteria 999
465 Ga0495672_0009170 3300047320 Bacteria 7206
466 Ga0495672_0019406 3300047320 Bacteria 4484
467 Ga0495686_0365366 3300047472 Bacteria 781
468 Ga0496109_1579012 3300048912 Unclassified 591
469 Ga0501296_040306 3300049519 Bacteria 657
470 Ga0501300_089042 3300049523 Bacteria 515
471 Ga0501032_0376487 3300049569 Bacteria 913
472 Ga0501034_0006320 3300049571 Bacteria 12756
473 Ga0501034_0024146 3300049571 Bacteria 6184
474 Ga0501036_0214151 3300049572 Bacteria 1618
475 Ga0501036_0627095 3300049572 Bacteria 891
476 Ga0501037_0004468 3300049573 Bacteria 10161
477 Ga0501038_0033947 3300049574 Bacteria 4488
478 Ga0501038_0070245 3300049574 Bacteria 2974
479 Ga0501039_0033541 3300049575 Bacteria 3959
480 Ga0501039_0506040 3300049575 Bacteria 948
481 Ga0501043_0014820 3300049579 Bacteria 6104
482 Ga0501043_0145324 3300049579 Bacteria 1857
483 Ga0501046_0021115 3300049580 Bacteria 5376
484 Ga0501047_0254834 3300049581 Unclassified 1603
485 Ga0501047_0604590 3300049581 Unclassified 918
486 Ga0501198_143414 3300049649 Bacteria 521
487 Ga0501242_003483 3300049674 Bacteria 1706
488 Ga0501247_050242 3300049677 Bacteria 617
489 Ga0501250_004671 3300049680 Bacteria 1375
490 Ga0501257_111806 3300049686 Unclassified 725
491 Ga0501257_186728 3300049686 Unclassified 589
492 Ga0501225_0198782 3300049705 Bacteria 635
493 Ga0501245_026926 3300049708 Bacteria 931
494 Ga0501268_004601 3300049765 Bacteria 1950
495 Ga0501035_0018759 3300049822 Bacteria 6371
496 Ga0501035_0566459 3300049822 Unclassified 929
497 Ga0501044_0008750 3300049823 Bacteria 11075
498 Ga0501044_0050326 3300049823 Unclassified 4300
499 Ga0501044_0114455 3300049823 Bacteria 2703
500 Ga0501226_011946 3300049853 Unclassified 962
501 nmdc:mga0k408_87764_c1 3300050493 Bacteria 1827
502 nmdc:mga0k408_9500_c1 3300050493 Bacteria 5245
503 nmdc:mga05p37_97180_c1 3300050507 Bacteria 3628
504 nmdc:mga08y16_381199_c1 3300050511 Bacteria 1445
505 nmdc:mga08y16_392878_c1 3300050511 Bacteria 1421
506 Ga0500644_0004641 3300053088 Bacteria 3446
507 Ga0500583_0000147 3300053092 Bacteria 29930
508 Ga0500566_0269797 3300053094 Bacteria 817
509 Ga0500641_0004448 3300053096 Bacteria 4954
510 Ga0500650_0175127 3300053098 Bacteria 985
511 Ga0500556_0143292 3300053104 Bacteria 940
512 Ga0500642_0248079 3300053130 Bacteria 818
513 Ga0500658_0269165 3300053134 Bacteria 783
514 Ga0500658_0488950 3300053134 Bacteria 558
515 Ga0500568_0000416 3300053139 Bacteria 32392
516 Ga0500588_0045031 3300053146 Bacteria 1349
517 Ga0500589_131872 3300053147 Bacteria 1042
518 Ga0500603_111241 3300053150 Bacteria 823
519 Ga0500616_0020037 3300053153 Unclassified 3761
520 Ga0500616_0030699 3300053153 Unclassified 2949
521 Ga0500622_0396846 3300053156 Bacteria 561
522 Ga0500633_0070148 3300053160 Bacteria 1250
523 Ga0500639_167585 3300053163 Bacteria 990
524 Ga0500636_0118991 3300053177 Bacteria 1484
525 Ga0500611_000074 3300053727 Bacteria 39951
526 Ga0466962_0174904 3300061719 Bacteria 1046
527 Ga0466962_0321861 3300061719 Bacteria 767

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100257968 Ga0068869_1002579682 140
2 3300005347 Ga0070668_101376336 Ga0070668_1013763361 140
3 3300005459 Ga0068867_100087841 Ga0068867_1000878413 140
4 3300005719 Ga0068861_100302254 Ga0068861_1003022542 140
5 3300009148 Ga0105243_10428563 Ga0105243_104285632 140
6 3300025934 Ga0207686_10386877 Ga0207686_103868771 140
7 3300025938 Ga0207704_10110381 Ga0207704_101103811 140
8 3300025942 Ga0207689_10013159 Ga0207689_100131597 140
9 3300025961 Ga0207712_10465887 Ga0207712_104658872 140
10 3300026089 Ga0207648_10075631 Ga0207648_100756313 140
11 3300026118 Ga0207675_100901017 Ga0207675_1009010172 140
12 3300053098 Ga0500650_0175127 Ga0500650_0175127_89_511 140
13 iso_pu_bacteria 2738541278 2738726518 140
14 3300014969 Ga0157376_10392749 Ga0157376_103927491 141
15 3300005459 Ga0068867_100330554 Ga0068867_1003305542 142
16 3300005543 Ga0070672_100994424 Ga0070672_1009944241 142
17 3300006237 Ga0097621_100977693 Ga0097621_1009776931 142
18 3300013306 Ga0163162_10052533 Ga0163162_100525333 142
19 3300013308 Ga0157375_10419389 Ga0157375_104193892 142
20 3300014325 Ga0163163_10793468 Ga0163163_107934682 142
21 3300017792 Ga0163161_10145618 Ga0163161_101456183 142
22 3300017792 Ga0163161_10894894 Ga0163161_108948941 142
23 3300028381 Ga0268264_11053681 Ga0268264_110536812 142
24 3300005330 Ga0070690_100338380 Ga0070690_1003383802 143
25 3300005337 Ga0070682_100596573 Ga0070682_1005965732 143
26 3300005353 Ga0070669_100561349 Ga0070669_1005613492 143
27 3300005354 Ga0070675_100171509 Ga0070675_1001715093 143
28 3300005355 Ga0070671_102026107 Ga0070671_1020261071 143
29 3300005364 Ga0070673_100834321 Ga0070673_1008343212 143
30 3300005365 Ga0070688_100170222 Ga0070688_1001702222 143
31 3300013307 Ga0157372_11269734 Ga0157372_112697342 143
32 3300025931 Ga0207644_10456996 Ga0207644_104569962 143
33 3300025944 Ga0207661_11131040 Ga0207661_111310402 143
34 3300041443 Ga0451789_0221219 Ga0451789_0221219_337_768 143
35 3300041452 Ga0451793_1792388 Ga0451793_1792388_207_638 143
36 3300047320 Ga0495672_0009170 Ga0495672_0009170_3431_3862 143
37 3300005290 Ga0065712_10515896 Ga0065712_105158961 144
38 3300005327 Ga0070658_11002739 Ga0070658_110027391 144
39 3300005339 Ga0070660_100839865 Ga0070660_1008398651 144
40 3300005344 Ga0070661_100706694 Ga0070661_1007066942 144
41 3300005366 Ga0070659_100008294 Ga0070659_1000082945 144
42 3300005539 Ga0068853_101390633 Ga0068853_1013906332 144
43 3300005548 Ga0070665_100185952 Ga0070665_1001859522 144
44 3300005548 Ga0070665_100654916 Ga0070665_1006549162 144
45 3300005564 Ga0070664_100376965 Ga0070664_1003769652 144
46 3300005577 Ga0068857_100037614 Ga0068857_1000376142 144
47 3300005616 Ga0068852_100004038 Ga0068852_1000040383 144
48 3300005616 Ga0068852_101510072 Ga0068852_1015100722 144
49 3300005616 Ga0068852_101757418 Ga0068852_1017574182 144
50 3300005617 Ga0068859_101280206 Ga0068859_1012802062 144
51 3300005618 Ga0068864_100123126 Ga0068864_1001231262 144
52 3300006931 Ga0097620_101280174 Ga0097620_1012801742 144
53 3300009553 Ga0105249_10017922 Ga0105249_100179224 144
54 3300013100 Ga0157373_10004590 Ga0157373_100045906 144
55 3300013100 Ga0157373_10183097 Ga0157373_101830972 144
56 3300013102 Ga0157371_10052352 Ga0157371_100523521 144
57 3300013105 Ga0157369_10133552 Ga0157369_101335522 144
58 3300013296 Ga0157374_11568559 Ga0157374_115685592 144
59 3300013306 Ga0163162_10004419 Ga0163162_1000441912 144
60 3300013306 Ga0163162_10299278 Ga0163162_102992782 144
61 3300013307 Ga0157372_10087593 Ga0157372_100875932 144
62 3300013307 Ga0157372_10122315 Ga0157372_101223153 144
63 3300013307 Ga0157372_10150716 Ga0157372_101507163 144
64 3300013307 Ga0157372_10841871 Ga0157372_108418711 144
65 3300013308 Ga0157375_10042711 Ga0157375_100427112 144
66 3300014325 Ga0163163_10000616 Ga0163163_1000061624 144
67 3300014968 Ga0157379_10107487 Ga0157379_101074872 144
68 3300014969 Ga0157376_11743401 Ga0157376_117434012 144
69 3300017792 Ga0163161_10091561 Ga0163161_100915612 144
70 3300025904 Ga0207647_10000110 Ga0207647_100001103 144
71 3300025919 Ga0207657_10700100 Ga0207657_107001001 144
72 3300025923 Ga0207681_11458256 Ga0207681_114582561 144
73 3300025932 Ga0207690_10011551 Ga0207690_100115515 144
74 3300025932 Ga0207690_11347762 Ga0207690_113477621 144
75 3300025945 Ga0207679_10641664 Ga0207679_106416641 144
76 3300025961 Ga0207712_10851210 Ga0207712_108512102 144
77 3300026095 Ga0207676_10804230 Ga0207676_108042302 144
78 3300026116 Ga0207674_10339666 Ga0207674_103396662 144
79 3300026142 Ga0207698_10006840 Ga0207698_100068405 144
80 3300027471 Ga0209995_1002856 Ga0209995_10028562 144
81 3300028381 Ga0268264_11425996 Ga0268264_114259962 144
82 3300031824 Ga0307413_11766337 Ga0307413_117663371 144
83 3300032005 Ga0307411_11554356 Ga0307411_115543561 144
84 3300032126 Ga0307415_100693367 Ga0307415_1006933672 144
85 3300037418 Ga0395900_0577540 Ga0395900_0577540_50_484 144
86 3300041486 Ga0451807_0946833 Ga0451807_0946833_171_605 144
87 3300042007 Ga0439449_0084766 Ga0439449_0084766_459_893 144
88 3300042156 Ga0439446_0106402 Ga0439446_0106402_89_523 144
89 3300049519 Ga0501296_040306 Ga0501296_040306_139_573 144
90 3300049523 Ga0501300_089042 Ga0501300_089042_53_487 144
91 3300049571 Ga0501034_0006320 Ga0501034_0006320_1323_1760 144
92 3300049572 Ga0501036_0214151 Ga0501036_0214151_16_453 144
93 3300049573 Ga0501037_0004468 Ga0501037_0004468_1354_1791 144
94 3300049574 Ga0501038_0033947 Ga0501038_0033947_3315_3752 144
95 3300049575 Ga0501039_0033541 Ga0501039_0033541_1470_1907 144
96 3300049579 Ga0501043_0014820 Ga0501043_0014820_1654_2091 144
97 3300049579 Ga0501043_0145324 Ga0501043_0145324_68_505 144
98 3300049581 Ga0501047_0604590 Ga0501047_0604590_58_495 144
99 3300049649 Ga0501198_143414 Ga0501198_143414_49_483 144
100 3300049674 Ga0501242_003483 Ga0501242_003483_871_1305 144
101 3300049677 Ga0501247_050242 Ga0501247_050242_85_519 144
102 3300049680 Ga0501250_004671 Ga0501250_004671_741_1175 144
103 3300049686 Ga0501257_111806 Ga0501257_111806_194_628 144
104 3300049686 Ga0501257_186728 Ga0501257_186728_20_454 144
105 3300049705 Ga0501225_0198782 Ga0501225_0198782_111_545 144
106 3300049708 Ga0501245_026926 Ga0501245_026926_432_866 144
107 3300049765 Ga0501268_004601 Ga0501268_004601_531_965 144
108 3300049822 Ga0501035_0018759 Ga0501035_0018759_1916_2353 144
109 3300049823 Ga0501044_0008750 Ga0501044_0008750_2251_2688 144
110 3300053088 Ga0500644_0004641 Ga0500644_0004641_1306_1740 144
111 3300053104 Ga0500556_0143292 Ga0500556_0143292_319_753 144
112 3300053134 Ga0500658_0269165 Ga0500658_0269165_67_501 144
113 3300053153 Ga0500616_0030699 Ga0500616_0030699_1307_1741 144
114 3300002459 JGI24751J29686_10030150 JGI24751J29686_100301502 145
115 3300003320 rootH2_10189197 rootH2_101891972 145
116 3300003322 rootL2_10155484 rootL2_101554843 145
117 3300003322 rootL2_10167564 rootL2_101675642 145
118 3300003323 rootH1_10170087 rootH1_101700872 145
119 3300005290 Ga0065712_10003463 Ga0065712_100034633 145
120 3300005295 Ga0065707_10315537 Ga0065707_103155372 145
121 3300005328 Ga0070676_10027613 Ga0070676_100276132 145
122 3300005328 Ga0070676_10126186 Ga0070676_101261862 145
123 3300005328 Ga0070676_11123342 Ga0070676_111233421 145
124 3300005329 Ga0070683_100000822 Ga0070683_1000008221 145
125 3300005331 Ga0070670_100030765 Ga0070670_1000307654 145
126 3300005331 Ga0070670_100137536 Ga0070670_1001375361 145
127 3300005331 Ga0070670_100206288 Ga0070670_1002062882 145
128 3300005331 Ga0070670_100207497 Ga0070670_1002074972 145
129 3300005331 Ga0070670_100990624 Ga0070670_1009906242 145
130 3300005334 Ga0068869_100019296 Ga0068869_1000192965 145
131 3300005335 Ga0070666_10000140 Ga0070666_1000014022 145
132 3300005336 Ga0070680_100079386 Ga0070680_1000793861 145
133 3300005337 Ga0070682_100078431 Ga0070682_1000784312 145
134 3300005338 Ga0068868_100014125 Ga0068868_1000141253 145
135 3300005338 Ga0068868_100144899 Ga0068868_1001448992 145
136 3300005338 Ga0068868_100148887 Ga0068868_1001488872 145
137 3300005338 Ga0068868_100391578 Ga0068868_1003915782 145
138 3300005338 Ga0068868_100800692 Ga0068868_1008006922 145
139 3300005339 Ga0070660_100020174 Ga0070660_1000201744 145
140 3300005340 Ga0070689_100003147 Ga0070689_1000031473 145
141 3300005344 Ga0070661_100070471 Ga0070661_1000704712 145
142 3300005344 Ga0070661_100076266 Ga0070661_1000762661 145
143 3300005347 Ga0070668_100440007 Ga0070668_1004400072 145
144 3300005353 Ga0070669_100005206 Ga0070669_1000052064 145
145 3300005353 Ga0070669_101686261 Ga0070669_1016862611 145
146 3300005354 Ga0070675_100006515 Ga0070675_1000065153 145
147 3300005354 Ga0070675_100090498 Ga0070675_1000904981 145
148 3300005354 Ga0070675_100213277 Ga0070675_1002132772 145
149 3300005354 Ga0070675_100447089 Ga0070675_1004470892 145
150 3300005355 Ga0070671_100136869 Ga0070671_1001368693 145
151 3300005355 Ga0070671_100212005 Ga0070671_1002120052 145
152 3300005355 Ga0070671_100247226 Ga0070671_1002472262 145
153 3300005364 Ga0070673_100046844 Ga0070673_1000468442 145
154 3300005364 Ga0070673_100073354 Ga0070673_1000733542 145
155 3300005365 Ga0070688_100005114 Ga0070688_1000051144 145
156 3300005365 Ga0070688_100092091 Ga0070688_1000920912 145
157 3300005365 Ga0070688_100476672 Ga0070688_1004766721 145
158 3300005366 Ga0070659_100013275 Ga0070659_1000132754 145
159 3300005367 Ga0070667_100026703 Ga0070667_1000267032 145
160 3300005367 Ga0070667_100186230 Ga0070667_1001862303 145
161 3300005367 Ga0070667_100192372 Ga0070667_1001923722 145
162 3300005438 Ga0070701_10107444 Ga0070701_101074442 145
163 3300005441 Ga0070700_100366869 Ga0070700_1003668691 145
164 3300005441 Ga0070700_100923252 Ga0070700_1009232521 145
165 3300005444 Ga0070694_100761277 Ga0070694_1007612771 145
166 3300005456 Ga0070678_100479702 Ga0070678_1004797022 145
167 3300005456 Ga0070678_101222598 Ga0070678_1012225981 145
168 3300005457 Ga0070662_100020763 Ga0070662_1000207634 145
169 3300005458 Ga0070681_10170611 Ga0070681_101706112 145
170 3300005459 Ga0068867_100015718 Ga0068867_1000157182 145
171 3300005459 Ga0068867_101052751 Ga0068867_1010527512 145
172 3300005466 Ga0070685_10030944 Ga0070685_100309442 145
173 3300005466 Ga0070685_10740851 Ga0070685_107408511 145
174 3300005471 Ga0070698_100576503 Ga0070698_1005765032 145
175 3300005530 Ga0070679_100104036 Ga0070679_1001040362 145
176 3300005535 Ga0070684_100018970 Ga0070684_1000189703 145
177 3300005535 Ga0070684_100113251 Ga0070684_1001132513 145
178 3300005539 Ga0068853_100743505 Ga0068853_1007435051 145
179 3300005539 Ga0068853_101802988 Ga0068853_1018029881 145
180 3300005543 Ga0070672_100084867 Ga0070672_1000848672 145
181 3300005543 Ga0070672_100085447 Ga0070672_1000854473 145
182 3300005543 Ga0070672_100173317 Ga0070672_1001733172 145
183 3300005543 Ga0070672_101322113 Ga0070672_1013221131 145
184 3300005546 Ga0070696_100515474 Ga0070696_1005154742 145
185 3300005547 Ga0070693_100084072 Ga0070693_1000840722 145
186 3300005548 Ga0070665_100405617 Ga0070665_1004056172 145
187 3300005549 Ga0070704_100080162 Ga0070704_1000801622 145
188 3300005563 Ga0068855_100010513 Ga0068855_1000105137 145
189 3300005563 Ga0068855_100274563 Ga0068855_1002745634 145
190 3300005564 Ga0070664_100013343 Ga0070664_1000133437 145
191 3300005564 Ga0070664_100245150 Ga0070664_1002451502 145
192 3300005577 Ga0068857_100048236 Ga0068857_1000482362 145
193 3300005577 Ga0068857_100169625 Ga0068857_1001696252 145
194 3300005577 Ga0068857_100283276 Ga0068857_1002832762 145
195 3300005578 Ga0068854_100183835 Ga0068854_1001838352 145
196 3300005578 Ga0068854_100250084 Ga0068854_1002500841 145
197 3300005614 Ga0068856_100008955 Ga0068856_10000895512 145
198 3300005614 Ga0068856_100123326 Ga0068856_1001233262 145
199 3300005616 Ga0068852_100042142 Ga0068852_1000421422 145
200 3300005616 Ga0068852_100915131 Ga0068852_1009151312 145
201 3300005617 Ga0068859_100005301 Ga0068859_1000053013 145
202 3300005617 Ga0068859_100007673 Ga0068859_1000076738 145
203 3300005617 Ga0068859_100011225 Ga0068859_1000112258 145
204 3300005617 Ga0068859_100632863 Ga0068859_1006328632 145
205 3300005618 Ga0068864_100074141 Ga0068864_1000741414 145
206 3300005618 Ga0068864_100280321 Ga0068864_1002803212 145
207 3300005618 Ga0068864_100882849 Ga0068864_1008828492 145
208 3300005718 Ga0068866_10051005 Ga0068866_100510052 145
209 3300005718 Ga0068866_10478532 Ga0068866_104785321 145
210 3300005719 Ga0068861_100009719 Ga0068861_1000097196 145
211 3300005719 Ga0068861_100449385 Ga0068861_1004493852 145
212 3300005834 Ga0068851_10013184 Ga0068851_100131845 145
213 3300005834 Ga0068851_10056186 Ga0068851_100561863 145
214 3300005834 Ga0068851_10276249 Ga0068851_102762491 145
215 3300005840 Ga0068870_10448192 Ga0068870_104481921 145
216 3300005841 Ga0068863_100019417 Ga0068863_1000194176 145
217 3300005842 Ga0068858_100008890 Ga0068858_1000088903 145
218 3300005843 Ga0068860_100003714 Ga0068860_1000037145 145
219 3300005843 Ga0068860_100013131 Ga0068860_1000131318 145
220 3300005843 Ga0068860_100038579 Ga0068860_1000385795 145
221 3300005843 Ga0068860_100444800 Ga0068860_1004448002 145
222 3300005844 Ga0068862_100004753 Ga0068862_1000047532 145
223 3300005844 Ga0068862_100979476 Ga0068862_1009794762 145
224 3300006195 Ga0075366_10014202 Ga0075366_100142023 145
225 3300006195 Ga0075366_10022539 Ga0075366_100225392 145
226 3300006237 Ga0097621_100007974 Ga0097621_1000079743 145
227 3300006358 Ga0068871_100007675 Ga0068871_1000076752 145
228 3300006358 Ga0068871_100227397 Ga0068871_1002273972 145
229 3300006358 Ga0068871_100299234 Ga0068871_1002992342 145
230 3300006852 Ga0075433_10664481 Ga0075433_106644812 145
231 3300006881 Ga0068865_100049998 Ga0068865_1000499984 145
232 3300006881 Ga0068865_100074845 Ga0068865_1000748452 145
233 3300006931 Ga0097620_100005301 Ga0097620_10000530112 145
234 3300006931 Ga0097620_100007673 Ga0097620_1000076734 145
235 3300006931 Ga0097620_100011225 Ga0097620_1000112258 145
236 3300006931 Ga0097620_100632759 Ga0097620_1006327592 145
237 3300009093 Ga0105240_10438934 Ga0105240_104389341 145
238 3300009094 Ga0111539_10011963 Ga0111539_1001196310 145
239 3300009098 Ga0105245_10132240 Ga0105245_101322403 145
240 3300009101 Ga0105247_10022954 Ga0105247_100229545 145
241 3300009174 Ga0105241_10006156 Ga0105241_100061562 145
242 3300009174 Ga0105241_12201295 Ga0105241_122012951 145
243 3300009176 Ga0105242_10929172 Ga0105242_109291721 145
244 3300009176 Ga0105242_12061045 Ga0105242_120610451 145
245 3300009176 Ga0105242_12069389 Ga0105242_120693891 145
246 3300009545 Ga0105237_10003256 Ga0105237_1000325613 145
247 3300009545 Ga0105237_10072570 Ga0105237_100725703 145
248 3300009553 Ga0105249_10008383 Ga0105249_100083834 145
249 3300010375 Ga0105239_10016641 Ga0105239_100166417 145
250 3300010375 Ga0105239_10240926 Ga0105239_102409263 145
251 3300011119 Ga0105246_10434917 Ga0105246_104349172 145
252 3300013100 Ga0157373_10064970 Ga0157373_100649702 145
253 3300013102 Ga0157371_10109916 Ga0157371_101099162 145
254 3300013102 Ga0157371_10523898 Ga0157371_105238981 145
255 3300013102 Ga0157371_10747653 Ga0157371_107476531 145
256 3300013104 Ga0157370_10061444 Ga0157370_100614442 145
257 3300013104 Ga0157370_10544904 Ga0157370_105449042 145
258 3300013105 Ga0157369_10515962 Ga0157369_105159622 145
259 3300013105 Ga0157369_12176537 Ga0157369_121765371 145
260 3300013296 Ga0157374_10033679 Ga0157374_100336796 145
261 3300013296 Ga0157374_10242852 Ga0157374_102428522 145
262 3300013296 Ga0157374_10248237 Ga0157374_102482372 145
263 3300013296 Ga0157374_10478547 Ga0157374_104785472 145
264 3300013296 Ga0157374_10490102 Ga0157374_104901022 145
265 3300013297 Ga0157378_10013830 Ga0157378_100138308 145
266 3300013297 Ga0157378_10089299 Ga0157378_100892993 145
267 3300013297 Ga0157378_10139864 Ga0157378_101398643 145
268 3300013297 Ga0157378_10227989 Ga0157378_102279891 145
269 3300013297 Ga0157378_10379640 Ga0157378_103796402 145
270 3300013297 Ga0157378_10427485 Ga0157378_104274852 145
271 3300013297 Ga0157378_10950960 Ga0157378_109509602 145
272 3300013306 Ga0163162_10044565 Ga0163162_100445655 145
273 3300013306 Ga0163162_10067985 Ga0163162_100679852 145
274 3300013306 Ga0163162_10367200 Ga0163162_103672001 145
275 3300013307 Ga0157372_10036086 Ga0157372_100360865 145
276 3300013307 Ga0157372_10094426 Ga0157372_100944262 145
277 3300013307 Ga0157372_10495282 Ga0157372_104952821 145
278 3300013308 Ga0157375_10009168 Ga0157375_100091685 145
279 3300013308 Ga0157375_10355178 Ga0157375_103551782 145
280 3300013308 Ga0157375_10393902 Ga0157375_103939022 145
281 3300013308 Ga0157375_12924997 Ga0157375_129249971 145
282 3300014325 Ga0163163_10013193 Ga0163163_100131933 145
283 3300014326 Ga0157380_10003256 Ga0157380_100032563 145
284 3300014326 Ga0157380_10390316 Ga0157380_103903162 145
285 3300014745 Ga0157377_10003394 Ga0157377_100033944 145
286 3300014745 Ga0157377_10027446 Ga0157377_100274464 145
287 3300014745 Ga0157377_10037095 Ga0157377_100370952 145
288 3300014745 Ga0157377_10131035 Ga0157377_101310352 145
289 3300014968 Ga0157379_10137286 Ga0157379_101372863 145
290 3300014969 Ga0157376_10006093 Ga0157376_100060939 145
291 3300014969 Ga0157376_10059314 Ga0157376_100593142 145
292 3300014969 Ga0157376_10213719 Ga0157376_102137192 145
293 3300017792 Ga0163161_10322569 Ga0163161_103225691 145
294 3300017792 Ga0163161_12041748 Ga0163161_120417481 145
295 3300025321 Ga0207656_10016904 Ga0207656_100169044 145
296 3300025321 Ga0207656_10038311 Ga0207656_100383111 145
297 3300025321 Ga0207656_10048182 Ga0207656_100481822 145
298 3300025321 Ga0207656_10089357 Ga0207656_100893572 145
299 3300025893 Ga0207682_10034810 Ga0207682_100348102 145
300 3300025899 Ga0207642_10042933 Ga0207642_100429331 145
301 3300025899 Ga0207642_10351088 Ga0207642_103510882 145
302 3300025901 Ga0207688_10113975 Ga0207688_101139752 145
303 3300025903 Ga0207680_10000140 Ga0207680_1000014016 145
304 3300025903 Ga0207680_10293364 Ga0207680_102933641 145
305 3300025904 Ga0207647_10049005 Ga0207647_100490051 145
306 3300025904 Ga0207647_10153056 Ga0207647_101530562 145
307 3300025907 Ga0207645_10000885 Ga0207645_1000088519 145
308 3300025907 Ga0207645_10056234 Ga0207645_100562342 145
309 3300025907 Ga0207645_10086812 Ga0207645_100868122 145
310 3300025908 Ga0207643_10004003 Ga0207643_100040034 145
311 3300025909 Ga0207705_10094318 Ga0207705_100943182 145
312 3300025911 Ga0207654_10016349 Ga0207654_100163493 145
313 3300025911 Ga0207654_10096423 Ga0207654_100964232 145
314 3300025913 Ga0207695_10363740 Ga0207695_103637401 145
315 3300025914 Ga0207671_10004643 Ga0207671_1000464310 145
316 3300025917 Ga0207660_10862180 Ga0207660_108621801 145
317 3300025918 Ga0207662_10049337 Ga0207662_100493373 145
318 3300025919 Ga0207657_10008412 Ga0207657_100084127 145
319 3300025919 Ga0207657_10181553 Ga0207657_101815532 145
320 3300025920 Ga0207649_10043018 Ga0207649_100430183 145
321 3300025920 Ga0207649_10136439 Ga0207649_101364392 145
322 3300025921 Ga0207652_10593978 Ga0207652_105939782 145
323 3300025923 Ga0207681_10016733 Ga0207681_100167334 145
324 3300025925 Ga0207650_10026300 Ga0207650_100263004 145
325 3300025925 Ga0207650_10031426 Ga0207650_100314264 145
326 3300025925 Ga0207650_10222019 Ga0207650_102220192 145
327 3300025925 Ga0207650_10491483 Ga0207650_104914832 145
328 3300025926 Ga0207659_10073065 Ga0207659_100730653 145
329 3300025926 Ga0207659_10129216 Ga0207659_101292162 145
330 3300025926 Ga0207659_10146696 Ga0207659_101466963 145
331 3300025926 Ga0207659_10553787 Ga0207659_105537872 145
332 3300025931 Ga0207644_10077382 Ga0207644_100773823 145
333 3300025931 Ga0207644_10122298 Ga0207644_101222982 145
334 3300025931 Ga0207644_10224171 Ga0207644_102241712 145
335 3300025931 Ga0207644_10592195 Ga0207644_105921952 145
336 3300025932 Ga0207690_10269362 Ga0207690_102693622 145
337 3300025933 Ga0207706_10003522 Ga0207706_1000352210 145
338 3300025933 Ga0207706_10027363 Ga0207706_100273632 145
339 3300025933 Ga0207706_10281818 Ga0207706_102818182 145
340 3300025935 Ga0207709_10172544 Ga0207709_101725442 145
341 3300025936 Ga0207670_10019033 Ga0207670_100190334 145
342 3300025937 Ga0207669_10020127 Ga0207669_100201273 145
343 3300025938 Ga0207704_10046872 Ga0207704_100468722 145
344 3300025940 Ga0207691_10038025 Ga0207691_100380256 145
345 3300025940 Ga0207691_10126362 Ga0207691_101263623 145
346 3300025940 Ga0207691_10164983 Ga0207691_101649832 145
347 3300025940 Ga0207691_10180081 Ga0207691_101800813 145
348 3300025941 Ga0207711_11455462 Ga0207711_114554621 145
349 3300025942 Ga0207689_10000857 Ga0207689_100008572 145
350 3300025942 Ga0207689_10021062 Ga0207689_100210625 145
351 3300025942 Ga0207689_10116323 Ga0207689_101163232 145
352 3300025944 Ga0207661_10007166 Ga0207661_100071661 145
353 3300025945 Ga0207679_10824473 Ga0207679_108244731 145
354 3300025960 Ga0207651_10120767 Ga0207651_101207671 145
355 3300025960 Ga0207651_10151482 Ga0207651_101514823 145
356 3300025960 Ga0207651_10159173 Ga0207651_101591732 145
357 3300025961 Ga0207712_10012455 Ga0207712_100124557 145
358 3300025972 Ga0207668_10199495 Ga0207668_101994952 145
359 3300025972 Ga0207668_10287843 Ga0207668_102878432 145
360 3300025981 Ga0207640_10028788 Ga0207640_100287884 145
361 3300025981 Ga0207640_10116280 Ga0207640_101162802 145
362 3300025981 Ga0207640_10693275 Ga0207640_106932752 145
363 3300025986 Ga0207658_10063060 Ga0207658_100630603 145
364 3300025986 Ga0207658_10160970 Ga0207658_101609703 145
365 3300025986 Ga0207658_10440584 Ga0207658_104405842 145
366 3300026023 Ga0207677_10004532 Ga0207677_100045325 145
367 3300026023 Ga0207677_10024508 Ga0207677_100245083 145
368 3300026023 Ga0207677_10211063 Ga0207677_102110632 145
369 3300026023 Ga0207677_10828482 Ga0207677_108284822 145
370 3300026035 Ga0207703_10005628 Ga0207703_100056285 145
371 3300026041 Ga0207639_10169330 Ga0207639_101693302 145
372 3300026075 Ga0207708_10399854 Ga0207708_103998542 145
373 3300026078 Ga0207702_10092075 Ga0207702_100920754 145
374 3300026088 Ga0207641_10000082 Ga0207641_1000008245 145
375 3300026088 Ga0207641_10014637 Ga0207641_100146374 145
376 3300026089 Ga0207648_10000510 Ga0207648_1000051022 145
377 3300026089 Ga0207648_10001518 Ga0207648_100015188 145
378 3300026089 Ga0207648_10037174 Ga0207648_100371743 145
379 3300026095 Ga0207676_10070512 Ga0207676_100705123 145
380 3300026095 Ga0207676_10252952 Ga0207676_102529522 145
381 3300026116 Ga0207674_10041481 Ga0207674_100414814 145
382 3300026116 Ga0207674_10189006 Ga0207674_101890062 145
383 3300026116 Ga0207674_10521646 Ga0207674_105216462 145
384 3300026116 Ga0207674_10577951 Ga0207674_105779512 145
385 3300026118 Ga0207675_100008333 Ga0207675_1000083333 145
386 3300026118 Ga0207675_100024542 Ga0207675_1000245422 145
387 3300026121 Ga0207683_10003647 Ga0207683_100036475 145
388 3300026121 Ga0207683_10786751 Ga0207683_107867512 145
389 3300026121 Ga0207683_11476460 Ga0207683_114764601 145
390 3300026142 Ga0207698_10033604 Ga0207698_100336045 145
391 3300026142 Ga0207698_10164860 Ga0207698_101648602 145
392 3300026142 Ga0207698_10341067 Ga0207698_103410671 145
393 3300026142 Ga0207698_10351806 Ga0207698_103518062 145
394 3300026142 Ga0207698_11022263 Ga0207698_110222632 145
395 3300027907 Ga0207428_10223269 Ga0207428_102232692 145
396 3300028380 Ga0268265_10004351 Ga0268265_100043512 145
397 3300028380 Ga0268265_10133247 Ga0268265_101332472 145
398 3300028380 Ga0268265_12292410 Ga0268265_122924102 145
399 3300028381 Ga0268264_10000810 Ga0268264_1000081012 145
400 3300028381 Ga0268264_10095464 Ga0268264_100954643 145
401 3300028381 Ga0268264_10170682 Ga0268264_101706822 145
402 3300028381 Ga0268264_10933956 Ga0268264_109339562 145
403 3300028381 Ga0268264_10941279 Ga0268264_109412792 145
404 3300028794 Ga0307515_10000412 Ga0307515_1000041227 145
405 3300031456 Ga0307513_10411083 Ga0307513_104110831 145
406 3300031456 Ga0307513_10602506 Ga0307513_106025062 145
407 3300031507 Ga0307509_10057749 Ga0307509_100577495 145
408 3300037068 Ga0373925_0663425 Ga0373925_0663425_262_699 145
409 3300037471 Ga0395905_0527061 Ga0395905_0527061_573_1010 145
410 3300041404 Ga0439436_0012351 Ga0439436_0012351_1536_1973 145
411 3300041406 Ga0439439_0129546 Ga0439439_0129546_30_467 145
412 3300041413 Ga0439465_0117994 Ga0439465_0117994_270_707 145
413 3300041498 Ga0451841_0332562 Ga0451841_0332562_104_541 145
414 3300041999 Ga0439433_0058424 Ga0439433_0058424_257_694 145
415 3300042002 Ga0439442_002870 Ga0439442_002870_217_654 145
416 3300042004 Ga0439445_0002485 Ga0439445_0002485_2113_2550 145
417 3300042004 Ga0439445_0042647 Ga0439445_0042647_363_800 145
418 3300042011 Ga0439454_038643 Ga0439454_038643_82_519 145
419 3300042014 Ga0439457_031580 Ga0439457_031580_42_479 145
420 3300042015 Ga0439462_0018811 Ga0439462_0018811_1103_1540 145
421 3300042015 Ga0439462_0112472 Ga0439462_0112472_267_704 145
422 3300042128 Ga0450897_001392 Ga0450897_001392_40_477 145
423 3300042131 Ga0450894_010152 Ga0450894_010152_568_1005 145
424 3300042134 Ga0450898_007999 Ga0450898_007999_156_593 145
425 3300042156 Ga0439446_0118568 Ga0439446_0118568_182_619 145
426 3300042435 Ga0439434_0019877 Ga0439434_0019877_1529_1966 145
427 3300044656 Ga0466969_0187434 Ga0466969_0187434_475_912 145
428 3300044658 Ga0466972_0000038 Ga0466972_0000038_75442_75879 145
429 3300044684 Ga0466966_0098836 Ga0466966_0098836_1256_1693 145
430 3300044684 Ga0466966_0103602 Ga0466966_0103602_1208_1645 145
431 3300044693 Ga0466961_0047735 Ga0466961_0047735_1562_1999 145
432 3300044693 Ga0466961_0330285 Ga0466961_0330285_370_807 145
433 3300044712 Ga0453684_0063353 Ga0453684_0063353_4247_4684 145
434 3300044735 Ga0466968_0032828 Ga0466968_0032828_251_688 145
435 3300044765 Ga0466970_0131722 Ga0466970_0131722_777_1214 145
436 3300044842 Ga0466957_0000186 Ga0466957_0000186_27040_27477 145
437 3300044842 Ga0466957_0011910 Ga0466957_0011910_402_839 145
438 3300045049 Ga0466959_0000380 Ga0466959_0000380_18031_18468 145
439 3300046522 Ga0495643_0047658 Ga0495643_0047658_774_1211 145
440 3300047320 Ga0495672_0019406 Ga0495672_0019406_2207_2644 145
441 3300047472 Ga0495686_0365366 Ga0495686_0365366_321_758 145
442 3300048912 Ga0496109_1579012 Ga0496109_1579012_37_474 145
443 3300049569 Ga0501032_0376487 Ga0501032_0376487_105_575 145
444 3300049571 Ga0501034_0024146 Ga0501034_0024146_4173_4613 145
445 3300049572 Ga0501036_0627095 Ga0501036_0627095_272_742 145
446 3300049574 Ga0501038_0070245 Ga0501038_0070245_2445_2885 145
447 3300049575 Ga0501039_0506040 Ga0501039_0506040_441_881 145
448 3300049580 Ga0501046_0021115 Ga0501046_0021115_830_1270 145
449 3300049581 Ga0501047_0254834 Ga0501047_0254834_550_987 145
450 3300049823 Ga0501044_0050326 Ga0501044_0050326_347_784 145
451 3300049853 Ga0501226_011946 Ga0501226_011946_105_542 145
452 3300050493 nmdc:mga0k408_87764_c1 nmdc:mga0k408_87764_c1_777_1214 145
453 3300050493 nmdc:mga0k408_9500_c1 nmdc:mga0k408_9500_c1_4388_4825 145
454 3300050507 nmdc:mga05p37_97180_c1 nmdc:mga05p37_97180_c1_2707_3144 145
455 3300050511 nmdc:mga08y16_392878_c1 nmdc:mga08y16_392878_c1_134_571 145
456 3300053092 Ga0500583_0000147 Ga0500583_0000147_25928_26365 145
457 3300053094 Ga0500566_0269797 Ga0500566_0269797_202_639 145
458 3300053130 Ga0500642_0248079 Ga0500642_0248079_236_673 145
459 3300053134 Ga0500658_0488950 Ga0500658_0488950_38_475 145
460 3300053139 Ga0500568_0000416 Ga0500568_0000416_16908_17345 145
461 3300053147 Ga0500589_131872 Ga0500589_131872_158_595 145
462 3300053150 Ga0500603_111241 Ga0500603_111241_102_539 145
463 3300053160 Ga0500633_0070148 Ga0500633_0070148_238_675 145
464 3300053163 Ga0500639_167585 Ga0500639_167585_235_672 145
465 3300053177 Ga0500636_0118991 Ga0500636_0118991_915_1352 145
466 3300053727 Ga0500611_000074 Ga0500611_000074_97_534 145
467 3300061719 Ga0466962_0174904 Ga0466962_0174904_46_483 145
468 3300061719 Ga0466962_0321861 Ga0466962_0321861_149_586 145
469 3300005335 Ga0070666_11207430 Ga0070666_112074301 146
470 3300005353 Ga0070669_100552296 Ga0070669_1005522961 146
471 3300005356 Ga0070674_100411237 Ga0070674_1004112372 146
472 3300005459 Ga0068867_100317122 Ga0068867_1003171222 146
473 3300005564 Ga0070664_100172494 Ga0070664_1001724942 146
474 3300005578 Ga0068854_100215664 Ga0068854_1002156642 146
475 3300005616 Ga0068852_101115495 Ga0068852_1011154952 146
476 3300005718 Ga0068866_10948566 Ga0068866_109485661 146
477 3300006237 Ga0097621_100057470 Ga0097621_1000574701 146
478 3300006881 Ga0068865_100683255 Ga0068865_1006832551 146
479 3300009094 Ga0111539_10499309 Ga0111539_104993092 146
480 3300013102 Ga0157371_10074953 Ga0157371_100749533 146
481 3300013102 Ga0157371_10823664 Ga0157371_108236641 146
482 3300013104 Ga0157370_10561249 Ga0157370_105612492 146
483 3300013307 Ga0157372_10119439 Ga0157372_101194393 146
484 3300014326 Ga0157380_10807154 Ga0157380_108071542 146
485 3300014969 Ga0157376_11566372 Ga0157376_115663721 146
486 3300021384 Ga0213876_10009856 Ga0213876_100098565 146
487 3300025899 Ga0207642_10509008 Ga0207642_105090081 146
488 3300025912 Ga0207707_10273100 Ga0207707_102731002 146
489 3300026089 Ga0207648_10015903 Ga0207648_100159035 146
490 3300026121 Ga0207683_10350538 Ga0207683_103505382 146
491 3300039437 Ga0436365_0716477 Ga0436365_0716477_23332_23772 146
492 3300050511 nmdc:mga08y16_381199_c1 nmdc:mga08y16_381199_c1_46_486 146
493 3300053096 Ga0500641_0004448 Ga0500641_0004448_1725_2165 146
494 3300053153 Ga0500616_0020037 Ga0500616_0020037_2465_2905 146
495 3300053156 Ga0500622_0396846 Ga0500622_0396846_100_540 146
496 3300001979 JGI24740J21852_10013453 JGI24740J21852_100134532 147
497 3300005327 Ga0070658_11391461 Ga0070658_113914612 147
498 3300005355 Ga0070671_101272700 Ga0070671_1012727001 147
499 3300005367 Ga0070667_100248550 Ga0070667_1002485502 147
500 3300005459 Ga0068867_100085605 Ga0068867_1000856052 147
501 3300005459 Ga0068867_100100112 Ga0068867_1001001123 147
502 3300005539 Ga0068853_100286295 Ga0068853_1002862952 147
503 3300005843 Ga0068860_101006091 Ga0068860_1010060911 147
504 3300006358 Ga0068871_101358826 Ga0068871_1013588262 147
505 3300006881 Ga0068865_100424104 Ga0068865_1004241042 147
506 3300009174 Ga0105241_10071986 Ga0105241_100719862 147
507 3300009545 Ga0105237_10001055 Ga0105237_100010552 147
508 3300010375 Ga0105239_10004772 Ga0105239_100047726 147
509 3300011119 Ga0105246_10540779 Ga0105246_105407792 147
510 3300013104 Ga0157370_10187187 Ga0157370_101871873 147
511 3300013306 Ga0163162_10274546 Ga0163162_102745462 147
512 3300013307 Ga0157372_10110799 Ga0157372_101107993 147
513 3300025904 Ga0207647_10204376 Ga0207647_102043762 147
514 3300025909 Ga0207705_11085444 Ga0207705_110854442 147
515 3300025925 Ga0207650_11907200 Ga0207650_119072001 147
516 3300026089 Ga0207648_10025914 Ga0207648_100259143 147
517 3300026089 Ga0207648_10106303 Ga0207648_101063032 147
518 3300026116 Ga0207674_10052605 Ga0207674_100526054 147
519 3300031507 Ga0307509_10024172 Ga0307509_100241723 147
520 3300031616 Ga0307508_10000407 Ga0307508_1000040721 147
521 3300037471 Ga0395905_0114020 Ga0395905_0114020_1007_1450 147
522 3300041451 Ga0451791_1109553 Ga0451791_1109553_185_631 147
523 3300041501 Ga0451845_0954817 Ga0451845_0954817_100_624 147
524 3300045976 Ga0466967_0304492 Ga0466967_0304492_742_1191 147
525 3300046694 Ga0495649_0213785 Ga0495649_0213785_471_920 147
526 3300049822 Ga0501035_0566459 Ga0501035_0566459_147_590 147
527 3300049823 Ga0501044_0114455 Ga0501044_0114455_644_1087 147
528 3300053146 Ga0500588_0045031 Ga0500588_0045031_639_1088 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13279

4HBT_2

Thioesterase-like superfamily

35

157

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egi-assembly1.cif.gz_C crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9466 4 132
5byu-assembly1.cif.gz_D crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9431 5 113
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9404 4 112
5t06-assembly1.cif.gz_C crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa 0.9351 4 132
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9282 1 132
ID Description Score Start End Superfamily
5byuD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9431 5 113 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9404 4 112 3.10.129.10
5eo2C01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9351 2 133 3.10.129.10
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.935 4 132 3.10.129.10
5byuD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9256 5 113 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3S0FYZ5-F1-model_v4 Thioesterase 0.9914 2 144 GO:0047617
AF-A0A355BQP5-F1-model_v4 Thioesterase 0.9883 1 144 GO:0047617
AF-A0A3C0RCH5-F1-model_v4 Thioesterase 0.9872 1 125 GO:0047617
AF-A0A3S0FYZ5-F1-model_v4 Thioesterase 0.9846 2 144 GO:0047617
AF-A0A0H5DS85-F1-model_v4 Putative thioesterase 0.9845 1 143 GO:0047617

Feature Viewer

pLDDT pTM Quality
95.24 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map