F459631
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 528 | 242 | 527 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_101272700|Ga0070671_1012727001 |
| Length | 174 |
| Sequence | MERVILTKLVTRAVAYTGILFYLAAMSQFTRYPELRWSDIDPNLHLRHSVYYDLGAWCRIEFLNEHQITAEFMHRHRFGPILFREECVFKKEIRLGDKLSVDLRLLKSYKDFSRWTMQHQIFKDGEILAAVITLDGAWIDTVQRKLAVPPRGVCDTFENMPRSEAFEWIEKKTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 155 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 164 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 165 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 166 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 171 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 172 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 173 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 174 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 175 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 176 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 177 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 178 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 179 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 180 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 181 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 182 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 183 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 190 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 194 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 200 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 201 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 211 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 213 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 214 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 215 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 217 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 218 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 222 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 226 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 227 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 228 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 229 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 230 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 231 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 234 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 235 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 236 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 237 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 238 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 239 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 240 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 241 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 242 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.55 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 91.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013453 | 3300001979 | Bacteria | 3051 |
| 2 | JGI24751J29686_10030150 | 3300002459 | Bacteria | 1125 |
| 3 | rootH2_10189197 | 3300003320 | Bacteria | 4384 |
| 4 | rootL2_10155484 | 3300003322 | Bacteria | 2617 |
| 5 | rootL2_10167564 | 3300003322 | Bacteria | 3094 |
| 6 | rootH1_10170087 | 3300003323 | Bacteria | 6558 |
| 7 | Ga0065712_10003463 | 3300005290 | Bacteria | 4883 |
| 8 | Ga0065712_10515896 | 3300005290 | Unclassified | 594 |
| 9 | Ga0065707_10315537 | 3300005295 | Unclassified | 976 |
| 10 | Ga0070658_11002739 | 3300005327 | Bacteria | 726 |
| 11 | Ga0070658_11391461 | 3300005327 | Bacteria | 609 |
| 12 | Ga0070676_10027613 | 3300005328 | Bacteria | 3220 |
| 13 | Ga0070676_10126186 | 3300005328 | Bacteria | 1613 |
| 14 | Ga0070676_11123342 | 3300005328 | Bacteria | 595 |
| 15 | Ga0070683_100000822 | 3300005329 | Bacteria | 22987 |
| 16 | Ga0070690_100338380 | 3300005330 | Unclassified | 1089 |
| 17 | Ga0070670_100030765 | 3300005331 | Unclassified | 4623 |
| 18 | Ga0070670_100137536 | 3300005331 | Bacteria | 2111 |
| 19 | Ga0070670_100206288 | 3300005331 | Bacteria | 1708 |
| 20 | Ga0070670_100207497 | 3300005331 | Unclassified | 1703 |
| 21 | Ga0070670_100990624 | 3300005331 | Bacteria | 764 |
| 22 | Ga0068869_100019296 | 3300005334 | Bacteria | 4656 |
| 23 | Ga0068869_100257968 | 3300005334 | Bacteria | 1395 |
| 24 | Ga0070666_10000140 | 3300005335 | Bacteria | 50189 |
| 25 | Ga0070666_11207430 | 3300005335 | Bacteria | 563 |
| 26 | Ga0070680_100079386 | 3300005336 | Bacteria | 2705 |
| 27 | Ga0070682_100078431 | 3300005337 | Bacteria | 2130 |
| 28 | Ga0070682_100596573 | 3300005337 | Unclassified | 871 |
| 29 | Ga0068868_100014125 | 3300005338 | Bacteria | 5879 |
| 30 | Ga0068868_100144899 | 3300005338 | Bacteria | 1952 |
| 31 | Ga0068868_100148887 | 3300005338 | Bacteria | 1926 |
| 32 | Ga0068868_100391578 | 3300005338 | Bacteria | 1197 |
| 33 | Ga0068868_100800692 | 3300005338 | Bacteria | 850 |
| 34 | Ga0070660_100020174 | 3300005339 | Bacteria | 4894 |
| 35 | Ga0070660_100839865 | 3300005339 | Bacteria | 773 |
| 36 | Ga0070689_100003147 | 3300005340 | Bacteria | 10917 |
| 37 | Ga0070661_100070471 | 3300005344 | Bacteria | 2571 |
| 38 | Ga0070661_100076266 | 3300005344 | Bacteria | 2470 |
| 39 | Ga0070661_100706694 | 3300005344 | Bacteria | 822 |
| 40 | Ga0070668_100440007 | 3300005347 | Bacteria | 1119 |
| 41 | Ga0070668_101376336 | 3300005347 | Bacteria | 643 |
| 42 | Ga0070669_100005206 | 3300005353 | Bacteria | 9401 |
| 43 | Ga0070669_100552296 | 3300005353 | Bacteria | 960 |
| 44 | Ga0070669_100561349 | 3300005353 | Bacteria | 953 |
| 45 | Ga0070669_101686261 | 3300005353 | Unclassified | 552 |
| 46 | Ga0070675_100006515 | 3300005354 | Bacteria | 8969 |
| 47 | Ga0070675_100090498 | 3300005354 | Bacteria | 2563 |
| 48 | Ga0070675_100171509 | 3300005354 | Bacteria | 1871 |
| 49 | Ga0070675_100213277 | 3300005354 | Unclassified | 1679 |
| 50 | Ga0070675_100447089 | 3300005354 | Bacteria | 1159 |
| 51 | Ga0070671_100136869 | 3300005355 | Bacteria | 2065 |
| 52 | Ga0070671_100212005 | 3300005355 | Bacteria | 1643 |
| 53 | Ga0070671_100247226 | 3300005355 | Bacteria | 1515 |
| 54 | Ga0070671_101272700 | 3300005355 | Unclassified | 648 |
| 55 | Ga0070671_102026107 | 3300005355 | Unclassified | 512 |
| 56 | Ga0070674_100411237 | 3300005356 | Bacteria | 1108 |
| 57 | Ga0070673_100046844 | 3300005364 | Bacteria | 3360 |
| 58 | Ga0070673_100073354 | 3300005364 | Unclassified | 2754 |
| 59 | Ga0070673_100834321 | 3300005364 | Bacteria | 852 |
| 60 | Ga0070688_100005114 | 3300005365 | Bacteria | 6876 |
| 61 | Ga0070688_100092091 | 3300005365 | Unclassified | 1982 |
| 62 | Ga0070688_100170222 | 3300005365 | Bacteria | 1503 |
| 63 | Ga0070688_100476672 | 3300005365 | Bacteria | 937 |
| 64 | Ga0070659_100008294 | 3300005366 | Bacteria | 7586 |
| 65 | Ga0070659_100013275 | 3300005366 | Bacteria | 6126 |
| 66 | Ga0070667_100026703 | 3300005367 | Bacteria | 4803 |
| 67 | Ga0070667_100186230 | 3300005367 | Bacteria | 1837 |
| 68 | Ga0070667_100192372 | 3300005367 | Bacteria | 1808 |
| 69 | Ga0070667_100248550 | 3300005367 | Bacteria | 1590 |
| 70 | Ga0070701_10107444 | 3300005438 | Bacteria | 1554 |
| 71 | Ga0070700_100366869 | 3300005441 | Bacteria | 1072 |
| 72 | Ga0070700_100923252 | 3300005441 | Bacteria | 712 |
| 73 | Ga0070694_100761277 | 3300005444 | Unclassified | 791 |
| 74 | Ga0070678_100479702 | 3300005456 | Unclassified | 1094 |
| 75 | Ga0070678_101222598 | 3300005456 | Bacteria | 697 |
| 76 | Ga0070662_100020763 | 3300005457 | Bacteria | 4479 |
| 77 | Ga0070681_10170611 | 3300005458 | Bacteria | 2097 |
| 78 | Ga0068867_100015718 | 3300005459 | Bacteria | 5371 |
| 79 | Ga0068867_100085605 | 3300005459 | Bacteria | 2383 |
| 80 | Ga0068867_100087841 | 3300005459 | Bacteria | 2355 |
| 81 | Ga0068867_100100112 | 3300005459 | Bacteria | 2212 |
| 82 | Ga0068867_100317122 | 3300005459 | Bacteria | 1290 |
| 83 | Ga0068867_100330554 | 3300005459 | Bacteria | 1266 |
| 84 | Ga0068867_101052751 | 3300005459 | Bacteria | 740 |
| 85 | Ga0070685_10030944 | 3300005466 | Unclassified | 2986 |
| 86 | Ga0070685_10740851 | 3300005466 | Bacteria | 720 |
| 87 | Ga0070698_100576503 | 3300005471 | Bacteria | 1065 |
| 88 | Ga0070679_100104036 | 3300005530 | Bacteria | 2826 |
| 89 | Ga0070684_100018970 | 3300005535 | Bacteria | 5680 |
| 90 | Ga0070684_100113251 | 3300005535 | Bacteria | 2434 |
| 91 | Ga0068853_100286295 | 3300005539 | Bacteria | 1520 |
| 92 | Ga0068853_100743505 | 3300005539 | Bacteria | 937 |
| 93 | Ga0068853_101390633 | 3300005539 | Bacteria | 679 |
| 94 | Ga0068853_101802988 | 3300005539 | Bacteria | 593 |
| 95 | Ga0070672_100084867 | 3300005543 | Bacteria | 2544 |
| 96 | Ga0070672_100085447 | 3300005543 | Bacteria | 2536 |
| 97 | Ga0070672_100173317 | 3300005543 | Unclassified | 1795 |
| 98 | Ga0070672_100994424 | 3300005543 | Bacteria | 743 |
| 99 | Ga0070672_101322113 | 3300005543 | Bacteria | 644 |
| 100 | Ga0070696_100515474 | 3300005546 | Bacteria | 953 |
| 101 | Ga0070693_100084072 | 3300005547 | Bacteria | 1904 |
| 102 | Ga0070665_100185952 | 3300005548 | Bacteria | 2078 |
| 103 | Ga0070665_100405617 | 3300005548 | Bacteria | 1371 |
| 104 | Ga0070665_100654916 | 3300005548 | Unclassified | 1063 |
| 105 | Ga0070704_100080162 | 3300005549 | Unclassified | 2400 |
| 106 | Ga0068855_100010513 | 3300005563 | Bacteria | 11166 |
| 107 | Ga0068855_100274563 | 3300005563 | Bacteria | 1873 |
| 108 | Ga0070664_100013343 | 3300005564 | Bacteria | 6691 |
| 109 | Ga0070664_100172494 | 3300005564 | Bacteria | 1919 |
| 110 | Ga0070664_100245150 | 3300005564 | Bacteria | 1609 |
| 111 | Ga0070664_100376965 | 3300005564 | Bacteria | 1294 |
| 112 | Ga0068857_100037614 | 3300005577 | Bacteria | 4288 |
| 113 | Ga0068857_100048236 | 3300005577 | Bacteria | 3781 |
| 114 | Ga0068857_100169625 | 3300005577 | Bacteria | 1983 |
| 115 | Ga0068857_100283276 | 3300005577 | Bacteria | 1525 |
| 116 | Ga0068854_100183835 | 3300005578 | Bacteria | 1634 |
| 117 | Ga0068854_100215664 | 3300005578 | Bacteria | 1516 |
| 118 | Ga0068854_100250084 | 3300005578 | Bacteria | 1415 |
| 119 | Ga0068856_100008955 | 3300005614 | Bacteria | 9737 |
| 120 | Ga0068856_100123326 | 3300005614 | Bacteria | 2593 |
| 121 | Ga0068852_100004038 | 3300005616 | Bacteria | 10316 |
| 122 | Ga0068852_100042142 | 3300005616 | Bacteria | 3863 |
| 123 | Ga0068852_100915131 | 3300005616 | Unclassified | 894 |
| 124 | Ga0068852_101115495 | 3300005616 | Bacteria | 809 |
| 125 | Ga0068852_101510072 | 3300005616 | Bacteria | 694 |
| 126 | Ga0068852_101757418 | 3300005616 | Bacteria | 643 |
| 127 | Ga0068859_100005301 | 3300005617 | Bacteria | 13110 |
| 128 | Ga0068859_100007673 | 3300005617 | Bacteria | 10961 |
| 129 | Ga0068859_100011225 | 3300005617 | Bacteria | 9009 |
| 130 | Ga0068859_100632863 | 3300005617 | Unclassified | 1162 |
| 131 | Ga0068859_101280206 | 3300005617 | Unclassified | 808 |
| 132 | Ga0068864_100074141 | 3300005618 | Unclassified | 2969 |
| 133 | Ga0068864_100123126 | 3300005618 | Bacteria | 2321 |
| 134 | Ga0068864_100280321 | 3300005618 | Bacteria | 1555 |
| 135 | Ga0068864_100882849 | 3300005618 | Bacteria | 882 |
| 136 | Ga0068866_10051005 | 3300005718 | Bacteria | 2104 |
| 137 | Ga0068866_10478532 | 3300005718 | Bacteria | 820 |
| 138 | Ga0068866_10948566 | 3300005718 | Bacteria | 608 |
| 139 | Ga0068861_100009719 | 3300005719 | Bacteria | 6650 |
| 140 | Ga0068861_100302254 | 3300005719 | Bacteria | 1387 |
| 141 | Ga0068861_100449385 | 3300005719 | Bacteria | 1154 |
| 142 | Ga0068851_10013184 | 3300005834 | Bacteria | 3910 |
| 143 | Ga0068851_10056186 | 3300005834 | Bacteria | 2007 |
| 144 | Ga0068851_10276249 | 3300005834 | Bacteria | 959 |
| 145 | Ga0068870_10448192 | 3300005840 | Bacteria | 850 |
| 146 | Ga0068863_100019417 | 3300005841 | Bacteria | 6500 |
| 147 | Ga0068858_100008890 | 3300005842 | Bacteria | 9631 |
| 148 | Ga0068860_100003714 | 3300005843 | Bacteria | 15692 |
| 149 | Ga0068860_100013131 | 3300005843 | Bacteria | 8128 |
| 150 | Ga0068860_100038579 | 3300005843 | Bacteria | 4570 |
| 151 | Ga0068860_100444800 | 3300005843 | Bacteria | 1288 |
| 152 | Ga0068860_101006091 | 3300005843 | Bacteria | 852 |
| 153 | Ga0068862_100004753 | 3300005844 | Bacteria | 11433 |
| 154 | Ga0068862_100979476 | 3300005844 | Bacteria | 835 |
| 155 | Ga0075366_10014202 | 3300006195 | Bacteria | 4547 |
| 156 | Ga0075366_10022539 | 3300006195 | Bacteria | 3664 |
| 157 | Ga0097621_100007974 | 3300006237 | Bacteria | 7601 |
| 158 | Ga0097621_100057470 | 3300006237 | Bacteria | 3182 |
| 159 | Ga0097621_100977693 | 3300006237 | Bacteria | 791 |
| 160 | Ga0068871_100007675 | 3300006358 | Bacteria | 7716 |
| 161 | Ga0068871_100227397 | 3300006358 | Bacteria | 1618 |
| 162 | Ga0068871_100299234 | 3300006358 | Bacteria | 1412 |
| 163 | Ga0068871_101358826 | 3300006358 | Bacteria | 669 |
| 164 | Ga0075433_10664481 | 3300006852 | Unclassified | 913 |
| 165 | Ga0068865_100049998 | 3300006881 | Bacteria | 2886 |
| 166 | Ga0068865_100074845 | 3300006881 | Bacteria | 2413 |
| 167 | Ga0068865_100424104 | 3300006881 | Bacteria | 1094 |
| 168 | Ga0068865_100683255 | 3300006881 | Bacteria | 875 |
| 169 | Ga0097620_100005301 | 3300006931 | Bacteria | 13110 |
| 170 | Ga0097620_100007673 | 3300006931 | Bacteria | 10961 |
| 171 | Ga0097620_100011225 | 3300006931 | Bacteria | 9009 |
| 172 | Ga0097620_100632759 | 3300006931 | Unclassified | 1162 |
| 173 | Ga0097620_101280174 | 3300006931 | Unclassified | 808 |
| 174 | Ga0105240_10438934 | 3300009093 | Bacteria | 1463 |
| 175 | Ga0111539_10011963 | 3300009094 | Bacteria | 10882 |
| 176 | Ga0111539_10499309 | 3300009094 | Bacteria | 1417 |
| 177 | Ga0105245_10132240 | 3300009098 | Bacteria | 2341 |
| 178 | Ga0105247_10022954 | 3300009101 | Bacteria | 3757 |
| 179 | Ga0105243_10428563 | 3300009148 | Bacteria | 1236 |
| 180 | Ga0105241_10006156 | 3300009174 | Bacteria | 8846 |
| 181 | Ga0105241_10071986 | 3300009174 | Unclassified | 2685 |
| 182 | Ga0105241_12201295 | 3300009174 | Bacteria | 547 |
| 183 | Ga0105242_10929172 | 3300009176 | Bacteria | 872 |
| 184 | Ga0105242_12061045 | 3300009176 | Bacteria | 614 |
| 185 | Ga0105242_12069389 | 3300009176 | Unclassified | 613 |
| 186 | Ga0105237_10001055 | 3300009545 | Bacteria | 37018 |
| 187 | Ga0105237_10003256 | 3300009545 | Bacteria | 19411 |
| 188 | Ga0105237_10072570 | 3300009545 | Bacteria | 3436 |
| 189 | Ga0105249_10008383 | 3300009553 | Bacteria | 9002 |
| 190 | Ga0105249_10017922 | 3300009553 | Bacteria | 6293 |
| 191 | Ga0105239_10004772 | 3300010375 | Bacteria | 16091 |
| 192 | Ga0105239_10016641 | 3300010375 | Bacteria | 8128 |
| 193 | Ga0105239_10240926 | 3300010375 | Bacteria | 2030 |
| 194 | Ga0105246_10434917 | 3300011119 | Unclassified | 1099 |
| 195 | Ga0105246_10540779 | 3300011119 | Bacteria | 996 |
| 196 | Ga0157373_10004590 | 3300013100 | Bacteria | 10395 |
| 197 | Ga0157373_10064970 | 3300013100 | Bacteria | 2582 |
| 198 | Ga0157373_10183097 | 3300013100 | Bacteria | 1475 |
| 199 | Ga0157371_10052352 | 3300013102 | Bacteria | 2900 |
| 200 | Ga0157371_10074953 | 3300013102 | Bacteria | 2396 |
| 201 | Ga0157371_10109916 | 3300013102 | Bacteria | 1957 |
| 202 | Ga0157371_10523898 | 3300013102 | Bacteria | 877 |
| 203 | Ga0157371_10747653 | 3300013102 | Unclassified | 734 |
| 204 | Ga0157371_10823664 | 3300013102 | Bacteria | 700 |
| 205 | Ga0157370_10061444 | 3300013104 | Bacteria | 3566 |
| 206 | Ga0157370_10187187 | 3300013104 | Bacteria | 1922 |
| 207 | Ga0157370_10544904 | 3300013104 | Bacteria | 1064 |
| 208 | Ga0157370_10561249 | 3300013104 | Bacteria | 1046 |
| 209 | Ga0157369_10133552 | 3300013105 | Bacteria | 2629 |
| 210 | Ga0157369_10515962 | 3300013105 | Bacteria | 1236 |
| 211 | Ga0157369_12176537 | 3300013105 | Unclassified | 562 |
| 212 | Ga0157374_10033679 | 3300013296 | Bacteria | 4676 |
| 213 | Ga0157374_10242852 | 3300013296 | Bacteria | 1771 |
| 214 | Ga0157374_10248237 | 3300013296 | Bacteria | 1751 |
| 215 | Ga0157374_10478547 | 3300013296 | Bacteria | 1248 |
| 216 | Ga0157374_10490102 | 3300013296 | Bacteria | 1233 |
| 217 | Ga0157374_11568559 | 3300013296 | Unclassified | 682 |
| 218 | Ga0157378_10013830 | 3300013297 | Bacteria | 7057 |
| 219 | Ga0157378_10089299 | 3300013297 | Bacteria | 2798 |
| 220 | Ga0157378_10139864 | 3300013297 | Bacteria | 2247 |
| 221 | Ga0157378_10227989 | 3300013297 | Bacteria | 1774 |
| 222 | Ga0157378_10379640 | 3300013297 | Unclassified | 1388 |
| 223 | Ga0157378_10427485 | 3300013297 | Unclassified | 1310 |
| 224 | Ga0157378_10950960 | 3300013297 | Unclassified | 892 |
| 225 | Ga0163162_10004419 | 3300013306 | Bacteria | 13535 |
| 226 | Ga0163162_10044565 | 3300013306 | Bacteria | 4443 |
| 227 | Ga0163162_10052533 | 3300013306 | Bacteria | 4093 |
| 228 | Ga0163162_10067985 | 3300013306 | Bacteria | 3614 |
| 229 | Ga0163162_10274546 | 3300013306 | Bacteria | 1818 |
| 230 | Ga0163162_10299278 | 3300013306 | Bacteria | 1741 |
| 231 | Ga0163162_10367200 | 3300013306 | Unclassified | 1572 |
| 232 | Ga0157372_10036086 | 3300013307 | Bacteria | 5447 |
| 233 | Ga0157372_10087593 | 3300013307 | Bacteria | 3533 |
| 234 | Ga0157372_10094426 | 3300013307 | Bacteria | 3406 |
| 235 | Ga0157372_10110799 | 3300013307 | Bacteria | 3144 |
| 236 | Ga0157372_10119439 | 3300013307 | Bacteria | 3026 |
| 237 | Ga0157372_10122315 | 3300013307 | Unclassified | 2991 |
| 238 | Ga0157372_10150716 | 3300013307 | Bacteria | 2684 |
| 239 | Ga0157372_10495282 | 3300013307 | Bacteria | 1425 |
| 240 | Ga0157372_10841871 | 3300013307 | Unclassified | 1065 |
| 241 | Ga0157372_11269734 | 3300013307 | Bacteria | 850 |
| 242 | Ga0157375_10009168 | 3300013308 | Bacteria | 8673 |
| 243 | Ga0157375_10042711 | 3300013308 | Bacteria | 4390 |
| 244 | Ga0157375_10355178 | 3300013308 | Bacteria | 1632 |
| 245 | Ga0157375_10393902 | 3300013308 | Bacteria | 1552 |
| 246 | Ga0157375_10419389 | 3300013308 | Bacteria | 1504 |
| 247 | Ga0157375_12924997 | 3300013308 | Bacteria | 571 |
| 248 | Ga0163163_10000616 | 3300014325 | Bacteria | 30789 |
| 249 | Ga0163163_10013193 | 3300014325 | Bacteria | 7552 |
| 250 | Ga0163163_10793468 | 3300014325 | Bacteria | 1010 |
| 251 | Ga0157380_10003256 | 3300014326 | Bacteria | 11119 |
| 252 | Ga0157380_10390316 | 3300014326 | Unclassified | 1317 |
| 253 | Ga0157380_10807154 | 3300014326 | Bacteria | 956 |
| 254 | Ga0157377_10003394 | 3300014745 | Bacteria | 7204 |
| 255 | Ga0157377_10027446 | 3300014745 | Bacteria | 3057 |
| 256 | Ga0157377_10037095 | 3300014745 | Bacteria | 2685 |
| 257 | Ga0157377_10131035 | 3300014745 | Bacteria | 1531 |
| 258 | Ga0157379_10107487 | 3300014968 | Bacteria | 2505 |
| 259 | Ga0157379_10137286 | 3300014968 | Unclassified | 2203 |
| 260 | Ga0157376_10006093 | 3300014969 | Bacteria | 8483 |
| 261 | Ga0157376_10059314 | 3300014969 | Bacteria | 3209 |
| 262 | Ga0157376_10213719 | 3300014969 | Bacteria | 1782 |
| 263 | Ga0157376_10392749 | 3300014969 | Bacteria | 1339 |
| 264 | Ga0157376_11566372 | 3300014969 | Bacteria | 693 |
| 265 | Ga0157376_11743401 | 3300014969 | Unclassified | 658 |
| 266 | Ga0163161_10091561 | 3300017792 | Bacteria | 2251 |
| 267 | Ga0163161_10145618 | 3300017792 | Bacteria | 1797 |
| 268 | Ga0163161_10322569 | 3300017792 | Bacteria | 1221 |
| 269 | Ga0163161_10894894 | 3300017792 | Bacteria | 752 |
| 270 | Ga0163161_12041748 | 3300017792 | Unclassified | 510 |
| 271 | Ga0213876_10009856 | 3300021384 | Bacteria | 5141 |
| 272 | Ga0207656_10016904 | 3300025321 | Bacteria | 2848 |
| 273 | Ga0207656_10038311 | 3300025321 | Bacteria | 2022 |
| 274 | Ga0207656_10048182 | 3300025321 | Bacteria | 1834 |
| 275 | Ga0207656_10089357 | 3300025321 | Bacteria | 1396 |
| 276 | Ga0207682_10034810 | 3300025893 | Bacteria | 2032 |
| 277 | Ga0207642_10042933 | 3300025899 | Bacteria | 1991 |
| 278 | Ga0207642_10351088 | 3300025899 | Bacteria | 870 |
| 279 | Ga0207642_10509008 | 3300025899 | Bacteria | 738 |
| 280 | Ga0207688_10113975 | 3300025901 | Bacteria | 1572 |
| 281 | Ga0207680_10000140 | 3300025903 | Bacteria | 34445 |
| 282 | Ga0207680_10293364 | 3300025903 | Unclassified | 1132 |
| 283 | Ga0207647_10000110 | 3300025904 | Bacteria | 62980 |
| 284 | Ga0207647_10049005 | 3300025904 | Bacteria | 2622 |
| 285 | Ga0207647_10153056 | 3300025904 | Unclassified | 1347 |
| 286 | Ga0207647_10204376 | 3300025904 | Bacteria | 1142 |
| 287 | Ga0207645_10000885 | 3300025907 | Bacteria | 24873 |
| 288 | Ga0207645_10056234 | 3300025907 | Unclassified | 2512 |
| 289 | Ga0207645_10086812 | 3300025907 | Bacteria | 2010 |
| 290 | Ga0207643_10004003 | 3300025908 | Bacteria | 7927 |
| 291 | Ga0207705_10094318 | 3300025909 | Bacteria | 2195 |
| 292 | Ga0207705_11085444 | 3300025909 | Bacteria | 617 |
| 293 | Ga0207654_10016349 | 3300025911 | Bacteria | 3862 |
| 294 | Ga0207654_10096423 | 3300025911 | Bacteria | 1814 |
| 295 | Ga0207707_10273100 | 3300025912 | Bacteria | 1465 |
| 296 | Ga0207695_10363740 | 3300025913 | Bacteria | 1333 |
| 297 | Ga0207671_10004643 | 3300025914 | Bacteria | 13008 |
| 298 | Ga0207660_10862180 | 3300025917 | Bacteria | 739 |
| 299 | Ga0207662_10049337 | 3300025918 | Bacteria | 2497 |
| 300 | Ga0207657_10008412 | 3300025919 | Bacteria | 10474 |
| 301 | Ga0207657_10181553 | 3300025919 | Unclassified | 1701 |
| 302 | Ga0207657_10700100 | 3300025919 | Bacteria | 787 |
| 303 | Ga0207649_10043018 | 3300025920 | Bacteria | 2759 |
| 304 | Ga0207649_10136439 | 3300025920 | Bacteria | 1673 |
| 305 | Ga0207652_10593978 | 3300025921 | Bacteria | 993 |
| 306 | Ga0207681_10016733 | 3300025923 | Bacteria | 4594 |
| 307 | Ga0207681_11458256 | 3300025923 | Unclassified | 574 |
| 308 | Ga0207650_10026300 | 3300025925 | Bacteria | 4149 |
| 309 | Ga0207650_10031426 | 3300025925 | Unclassified | 3834 |
| 310 | Ga0207650_10222019 | 3300025925 | Unclassified | 1521 |
| 311 | Ga0207650_10491483 | 3300025925 | Unclassified | 1025 |
| 312 | Ga0207650_11907200 | 3300025925 | Bacteria | 502 |
| 313 | Ga0207659_10073065 | 3300025926 | Bacteria | 2510 |
| 314 | Ga0207659_10129216 | 3300025926 | Bacteria | 1947 |
| 315 | Ga0207659_10146696 | 3300025926 | Bacteria | 1838 |
| 316 | Ga0207659_10553787 | 3300025926 | Bacteria | 978 |
| 317 | Ga0207644_10077382 | 3300025931 | Bacteria | 2450 |
| 318 | Ga0207644_10122298 | 3300025931 | Bacteria | 1983 |
| 319 | Ga0207644_10224171 | 3300025931 | Bacteria | 1491 |
| 320 | Ga0207644_10456996 | 3300025931 | Bacteria | 1050 |
| 321 | Ga0207644_10592195 | 3300025931 | Bacteria | 920 |
| 322 | Ga0207690_10011551 | 3300025932 | Bacteria | 5274 |
| 323 | Ga0207690_10269362 | 3300025932 | Bacteria | 1322 |
| 324 | Ga0207690_11347762 | 3300025932 | Bacteria | 596 |
| 325 | Ga0207706_10003522 | 3300025933 | Bacteria | 14949 |
| 326 | Ga0207706_10027363 | 3300025933 | Bacteria | 5098 |
| 327 | Ga0207706_10281818 | 3300025933 | Unclassified | 1449 |
| 328 | Ga0207686_10386877 | 3300025934 | Bacteria | 1062 |
| 329 | Ga0207709_10172544 | 3300025935 | Bacteria | 1519 |
| 330 | Ga0207670_10019033 | 3300025936 | Bacteria | 4185 |
| 331 | Ga0207669_10020127 | 3300025937 | Bacteria | 3491 |
| 332 | Ga0207704_10046872 | 3300025938 | Bacteria | 2579 |
| 333 | Ga0207704_10110381 | 3300025938 | Bacteria | 1858 |
| 334 | Ga0207691_10038025 | 3300025940 | Bacteria | 4453 |
| 335 | Ga0207691_10126362 | 3300025940 | Bacteria | 2262 |
| 336 | Ga0207691_10164983 | 3300025940 | Bacteria | 1942 |
| 337 | Ga0207691_10180081 | 3300025940 | Bacteria | 1847 |
| 338 | Ga0207711_11455462 | 3300025941 | Unclassified | 628 |
| 339 | Ga0207689_10000857 | 3300025942 | Bacteria | 29330 |
| 340 | Ga0207689_10013159 | 3300025942 | Bacteria | 7060 |
| 341 | Ga0207689_10021062 | 3300025942 | Bacteria | 5480 |
| 342 | Ga0207689_10116323 | 3300025942 | Bacteria | 2198 |
| 343 | Ga0207661_10007166 | 3300025944 | Bacteria | 7922 |
| 344 | Ga0207661_11131040 | 3300025944 | Unclassified | 721 |
| 345 | Ga0207679_10641664 | 3300025945 | Bacteria | 960 |
| 346 | Ga0207679_10824473 | 3300025945 | Unclassified | 846 |
| 347 | Ga0207651_10120767 | 3300025960 | Bacteria | 1987 |
| 348 | Ga0207651_10151482 | 3300025960 | Bacteria | 1806 |
| 349 | Ga0207651_10159173 | 3300025960 | Bacteria | 1768 |
| 350 | Ga0207712_10012455 | 3300025961 | Bacteria | 5433 |
| 351 | Ga0207712_10465887 | 3300025961 | Bacteria | 1074 |
| 352 | Ga0207712_10851210 | 3300025961 | Unclassified | 804 |
| 353 | Ga0207668_10199495 | 3300025972 | Bacteria | 1592 |
| 354 | Ga0207668_10287843 | 3300025972 | Bacteria | 1350 |
| 355 | Ga0207640_10028788 | 3300025981 | Unclassified | 3401 |
| 356 | Ga0207640_10116280 | 3300025981 | Bacteria | 1906 |
| 357 | Ga0207640_10693275 | 3300025981 | Unclassified | 872 |
| 358 | Ga0207658_10063060 | 3300025986 | Bacteria | 2776 |
| 359 | Ga0207658_10160970 | 3300025986 | Bacteria | 1839 |
| 360 | Ga0207658_10440584 | 3300025986 | Bacteria | 1152 |
| 361 | Ga0207677_10004532 | 3300026023 | Bacteria | 7474 |
| 362 | Ga0207677_10024508 | 3300026023 | Bacteria | 3750 |
| 363 | Ga0207677_10211063 | 3300026023 | Bacteria | 1551 |
| 364 | Ga0207677_10828482 | 3300026023 | Bacteria | 830 |
| 365 | Ga0207703_10005628 | 3300026035 | Bacteria | 10060 |
| 366 | Ga0207639_10169330 | 3300026041 | Bacteria | 1848 |
| 367 | Ga0207708_10399854 | 3300026075 | Bacteria | 1136 |
| 368 | Ga0207702_10092075 | 3300026078 | Bacteria | 2656 |
| 369 | Ga0207641_10000082 | 3300026088 | Bacteria | 138385 |
| 370 | Ga0207641_10014637 | 3300026088 | Bacteria | 6432 |
| 371 | Ga0207648_10000510 | 3300026089 | Bacteria | 43437 |
| 372 | Ga0207648_10001518 | 3300026089 | Bacteria | 25557 |
| 373 | Ga0207648_10015903 | 3300026089 | Bacteria | 6896 |
| 374 | Ga0207648_10025914 | 3300026089 | Bacteria | 5215 |
| 375 | Ga0207648_10037174 | 3300026089 | Bacteria | 4288 |
| 376 | Ga0207648_10075631 | 3300026089 | Bacteria | 2935 |
| 377 | Ga0207648_10106303 | 3300026089 | Bacteria | 2462 |
| 378 | Ga0207676_10070512 | 3300026095 | Unclassified | 2803 |
| 379 | Ga0207676_10252952 | 3300026095 | Bacteria | 1587 |
| 380 | Ga0207676_10804230 | 3300026095 | Unclassified | 917 |
| 381 | Ga0207674_10041481 | 3300026116 | Bacteria | 4760 |
| 382 | Ga0207674_10052605 | 3300026116 | Bacteria | 4153 |
| 383 | Ga0207674_10189006 | 3300026116 | Bacteria | 2009 |
| 384 | Ga0207674_10339666 | 3300026116 | Bacteria | 1452 |
| 385 | Ga0207674_10521646 | 3300026116 | Bacteria | 1148 |
| 386 | Ga0207674_10577951 | 3300026116 | Bacteria | 1085 |
| 387 | Ga0207675_100008333 | 3300026118 | Bacteria | 9767 |
| 388 | Ga0207675_100024542 | 3300026118 | Bacteria | 5605 |
| 389 | Ga0207675_100901017 | 3300026118 | Bacteria | 901 |
| 390 | Ga0207683_10003647 | 3300026121 | Bacteria | 13395 |
| 391 | Ga0207683_10350538 | 3300026121 | Bacteria | 1355 |
| 392 | Ga0207683_10786751 | 3300026121 | Unclassified | 883 |
| 393 | Ga0207683_11476460 | 3300026121 | Bacteria | 628 |
| 394 | Ga0207698_10006840 | 3300026142 | Bacteria | 7132 |
| 395 | Ga0207698_10033604 | 3300026142 | Bacteria | 3729 |
| 396 | Ga0207698_10164860 | 3300026142 | Bacteria | 1943 |
| 397 | Ga0207698_10341067 | 3300026142 | Bacteria | 1411 |
| 398 | Ga0207698_10351806 | 3300026142 | Bacteria | 1392 |
| 399 | Ga0207698_11022263 | 3300026142 | Bacteria | 838 |
| 400 | Ga0209995_1002856 | 3300027471 | Bacteria | 2739 |
| 401 | Ga0207428_10223269 | 3300027907 | Unclassified | 1411 |
| 402 | Ga0268265_10004351 | 3300028380 | Bacteria | 9846 |
| 403 | Ga0268265_10133247 | 3300028380 | Bacteria | 2069 |
| 404 | Ga0268265_12292410 | 3300028380 | Unclassified | 547 |
| 405 | Ga0268264_10000810 | 3300028381 | Bacteria | 33689 |
| 406 | Ga0268264_10095464 | 3300028381 | Bacteria | 2573 |
| 407 | Ga0268264_10170682 | 3300028381 | Bacteria | 1967 |
| 408 | Ga0268264_10933956 | 3300028381 | Bacteria | 872 |
| 409 | Ga0268264_10941279 | 3300028381 | Unclassified | 869 |
| 410 | Ga0268264_11053681 | 3300028381 | Bacteria | 821 |
| 411 | Ga0268264_11425996 | 3300028381 | Bacteria | 703 |
| 412 | Ga0307515_10000412 | 3300028794 | Bacteria | 103361 |
| 413 | Ga0307513_10411083 | 3300031456 | Bacteria | 1085 |
| 414 | Ga0307513_10602506 | 3300031456 | Bacteria | 808 |
| 415 | Ga0307509_10024172 | 3300031507 | Bacteria | 6809 |
| 416 | Ga0307509_10057749 | 3300031507 | Bacteria | 4113 |
| 417 | Ga0307508_10000407 | 3300031616 | Bacteria | 51637 |
| 418 | Ga0307413_11766337 | 3300031824 | Unclassified | 553 |
| 419 | Ga0307411_11554356 | 3300032005 | Bacteria | 609 |
| 420 | Ga0307415_100693367 | 3300032126 | Bacteria | 918 |
| 421 | Ga0373925_0663425 | 3300037068 | Unclassified | 860 |
| 422 | Ga0395900_0577540 | 3300037418 | Unclassified | 1066 |
| 423 | Ga0395905_0114020 | 3300037471 | Bacteria | 2540 |
| 424 | Ga0395905_0527061 | 3300037471 | Unclassified | 1082 |
| 425 | Ga0436365_0716477 | 3300039437 | Bacteria | 57230 |
| 426 | Ga0439436_0012351 | 3300041404 | Bacteria | 2593 |
| 427 | Ga0439439_0129546 | 3300041406 | Bacteria | 708 |
| 428 | Ga0439465_0117994 | 3300041413 | Bacteria | 928 |
| 429 | Ga0451789_0221219 | 3300041443 | Unclassified | 912 |
| 430 | Ga0451791_1109553 | 3300041451 | Unclassified | 765 |
| 431 | Ga0451793_1792388 | 3300041452 | Unclassified | 1103 |
| 432 | Ga0451807_0946833 | 3300041486 | Bacteria | 646 |
| 433 | Ga0451841_0332562 | 3300041498 | Bacteria | 1257 |
| 434 | Ga0451845_0954817 | 3300041501 | Bacteria | 679 |
| 435 | Ga0439433_0058424 | 3300041999 | Bacteria | 917 |
| 436 | Ga0439442_002870 | 3300042002 | Bacteria | 3395 |
| 437 | Ga0439445_0002485 | 3300042004 | Bacteria | 4103 |
| 438 | Ga0439445_0042647 | 3300042004 | Bacteria | 1209 |
| 439 | Ga0439449_0084766 | 3300042007 | Bacteria | 1169 |
| 440 | Ga0439454_038643 | 3300042011 | Bacteria | 774 |
| 441 | Ga0439457_031580 | 3300042014 | Bacteria | 1174 |
| 442 | Ga0439462_0018811 | 3300042015 | Bacteria | 1795 |
| 443 | Ga0439462_0112472 | 3300042015 | Bacteria | 754 |
| 444 | Ga0450897_001392 | 3300042128 | Unclassified | 1645 |
| 445 | Ga0450894_010152 | 3300042131 | Bacteria | 1221 |
| 446 | Ga0450898_007999 | 3300042134 | Bacteria | 1658 |
| 447 | Ga0439446_0106402 | 3300042156 | Bacteria | 891 |
| 448 | Ga0439446_0118568 | 3300042156 | Bacteria | 850 |
| 449 | Ga0439434_0019877 | 3300042435 | Bacteria | 2015 |
| 450 | Ga0466969_0187434 | 3300044656 | Bacteria | 946 |
| 451 | Ga0466972_0000038 | 3300044658 | Bacteria | 135937 |
| 452 | Ga0466966_0098836 | 3300044684 | Bacteria | 1806 |
| 453 | Ga0466966_0103602 | 3300044684 | Bacteria | 1758 |
| 454 | Ga0466961_0047735 | 3300044693 | Bacteria | 2738 |
| 455 | Ga0466961_0330285 | 3300044693 | Bacteria | 929 |
| 456 | Ga0453684_0063353 | 3300044712 | Bacteria | 4730 |
| 457 | Ga0466968_0032828 | 3300044735 | Bacteria | 2161 |
| 458 | Ga0466970_0131722 | 3300044765 | Bacteria | 1374 |
| 459 | Ga0466957_0000186 | 3300044842 | Bacteria | 28257 |
| 460 | Ga0466957_0011910 | 3300044842 | Bacteria | 5026 |
| 461 | Ga0466959_0000380 | 3300045049 | Bacteria | 26260 |
| 462 | Ga0466967_0304492 | 3300045976 | Bacteria | 1534 |
| 463 | Ga0495643_0047658 | 3300046522 | Bacteria | 2320 |
| 464 | Ga0495649_0213785 | 3300046694 | Bacteria | 999 |
| 465 | Ga0495672_0009170 | 3300047320 | Bacteria | 7206 |
| 466 | Ga0495672_0019406 | 3300047320 | Bacteria | 4484 |
| 467 | Ga0495686_0365366 | 3300047472 | Bacteria | 781 |
| 468 | Ga0496109_1579012 | 3300048912 | Unclassified | 591 |
| 469 | Ga0501296_040306 | 3300049519 | Bacteria | 657 |
| 470 | Ga0501300_089042 | 3300049523 | Bacteria | 515 |
| 471 | Ga0501032_0376487 | 3300049569 | Bacteria | 913 |
| 472 | Ga0501034_0006320 | 3300049571 | Bacteria | 12756 |
| 473 | Ga0501034_0024146 | 3300049571 | Bacteria | 6184 |
| 474 | Ga0501036_0214151 | 3300049572 | Bacteria | 1618 |
| 475 | Ga0501036_0627095 | 3300049572 | Bacteria | 891 |
| 476 | Ga0501037_0004468 | 3300049573 | Bacteria | 10161 |
| 477 | Ga0501038_0033947 | 3300049574 | Bacteria | 4488 |
| 478 | Ga0501038_0070245 | 3300049574 | Bacteria | 2974 |
| 479 | Ga0501039_0033541 | 3300049575 | Bacteria | 3959 |
| 480 | Ga0501039_0506040 | 3300049575 | Bacteria | 948 |
| 481 | Ga0501043_0014820 | 3300049579 | Bacteria | 6104 |
| 482 | Ga0501043_0145324 | 3300049579 | Bacteria | 1857 |
| 483 | Ga0501046_0021115 | 3300049580 | Bacteria | 5376 |
| 484 | Ga0501047_0254834 | 3300049581 | Unclassified | 1603 |
| 485 | Ga0501047_0604590 | 3300049581 | Unclassified | 918 |
| 486 | Ga0501198_143414 | 3300049649 | Bacteria | 521 |
| 487 | Ga0501242_003483 | 3300049674 | Bacteria | 1706 |
| 488 | Ga0501247_050242 | 3300049677 | Bacteria | 617 |
| 489 | Ga0501250_004671 | 3300049680 | Bacteria | 1375 |
| 490 | Ga0501257_111806 | 3300049686 | Unclassified | 725 |
| 491 | Ga0501257_186728 | 3300049686 | Unclassified | 589 |
| 492 | Ga0501225_0198782 | 3300049705 | Bacteria | 635 |
| 493 | Ga0501245_026926 | 3300049708 | Bacteria | 931 |
| 494 | Ga0501268_004601 | 3300049765 | Bacteria | 1950 |
| 495 | Ga0501035_0018759 | 3300049822 | Bacteria | 6371 |
| 496 | Ga0501035_0566459 | 3300049822 | Unclassified | 929 |
| 497 | Ga0501044_0008750 | 3300049823 | Bacteria | 11075 |
| 498 | Ga0501044_0050326 | 3300049823 | Unclassified | 4300 |
| 499 | Ga0501044_0114455 | 3300049823 | Bacteria | 2703 |
| 500 | Ga0501226_011946 | 3300049853 | Unclassified | 962 |
| 501 | nmdc:mga0k408_87764_c1 | 3300050493 | Bacteria | 1827 |
| 502 | nmdc:mga0k408_9500_c1 | 3300050493 | Bacteria | 5245 |
| 503 | nmdc:mga05p37_97180_c1 | 3300050507 | Bacteria | 3628 |
| 504 | nmdc:mga08y16_381199_c1 | 3300050511 | Bacteria | 1445 |
| 505 | nmdc:mga08y16_392878_c1 | 3300050511 | Bacteria | 1421 |
| 506 | Ga0500644_0004641 | 3300053088 | Bacteria | 3446 |
| 507 | Ga0500583_0000147 | 3300053092 | Bacteria | 29930 |
| 508 | Ga0500566_0269797 | 3300053094 | Bacteria | 817 |
| 509 | Ga0500641_0004448 | 3300053096 | Bacteria | 4954 |
| 510 | Ga0500650_0175127 | 3300053098 | Bacteria | 985 |
| 511 | Ga0500556_0143292 | 3300053104 | Bacteria | 940 |
| 512 | Ga0500642_0248079 | 3300053130 | Bacteria | 818 |
| 513 | Ga0500658_0269165 | 3300053134 | Bacteria | 783 |
| 514 | Ga0500658_0488950 | 3300053134 | Bacteria | 558 |
| 515 | Ga0500568_0000416 | 3300053139 | Bacteria | 32392 |
| 516 | Ga0500588_0045031 | 3300053146 | Bacteria | 1349 |
| 517 | Ga0500589_131872 | 3300053147 | Bacteria | 1042 |
| 518 | Ga0500603_111241 | 3300053150 | Bacteria | 823 |
| 519 | Ga0500616_0020037 | 3300053153 | Unclassified | 3761 |
| 520 | Ga0500616_0030699 | 3300053153 | Unclassified | 2949 |
| 521 | Ga0500622_0396846 | 3300053156 | Bacteria | 561 |
| 522 | Ga0500633_0070148 | 3300053160 | Bacteria | 1250 |
| 523 | Ga0500639_167585 | 3300053163 | Bacteria | 990 |
| 524 | Ga0500636_0118991 | 3300053177 | Bacteria | 1484 |
| 525 | Ga0500611_000074 | 3300053727 | Bacteria | 39951 |
| 526 | Ga0466962_0174904 | 3300061719 | Bacteria | 1046 |
| 527 | Ga0466962_0321861 | 3300061719 | Bacteria | 767 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100257968 | Ga0068869_1002579682 | 140 |
| 2 | 3300005347 | Ga0070668_101376336 | Ga0070668_1013763361 | 140 |
| 3 | 3300005459 | Ga0068867_100087841 | Ga0068867_1000878413 | 140 |
| 4 | 3300005719 | Ga0068861_100302254 | Ga0068861_1003022542 | 140 |
| 5 | 3300009148 | Ga0105243_10428563 | Ga0105243_104285632 | 140 |
| 6 | 3300025934 | Ga0207686_10386877 | Ga0207686_103868771 | 140 |
| 7 | 3300025938 | Ga0207704_10110381 | Ga0207704_101103811 | 140 |
| 8 | 3300025942 | Ga0207689_10013159 | Ga0207689_100131597 | 140 |
| 9 | 3300025961 | Ga0207712_10465887 | Ga0207712_104658872 | 140 |
| 10 | 3300026089 | Ga0207648_10075631 | Ga0207648_100756313 | 140 |
| 11 | 3300026118 | Ga0207675_100901017 | Ga0207675_1009010172 | 140 |
| 12 | 3300053098 | Ga0500650_0175127 | Ga0500650_0175127_89_511 | 140 |
| 13 | iso_pu_bacteria | 2738541278 | 2738726518 | 140 |
| 14 | 3300014969 | Ga0157376_10392749 | Ga0157376_103927491 | 141 |
| 15 | 3300005459 | Ga0068867_100330554 | Ga0068867_1003305542 | 142 |
| 16 | 3300005543 | Ga0070672_100994424 | Ga0070672_1009944241 | 142 |
| 17 | 3300006237 | Ga0097621_100977693 | Ga0097621_1009776931 | 142 |
| 18 | 3300013306 | Ga0163162_10052533 | Ga0163162_100525333 | 142 |
| 19 | 3300013308 | Ga0157375_10419389 | Ga0157375_104193892 | 142 |
| 20 | 3300014325 | Ga0163163_10793468 | Ga0163163_107934682 | 142 |
| 21 | 3300017792 | Ga0163161_10145618 | Ga0163161_101456183 | 142 |
| 22 | 3300017792 | Ga0163161_10894894 | Ga0163161_108948941 | 142 |
| 23 | 3300028381 | Ga0268264_11053681 | Ga0268264_110536812 | 142 |
| 24 | 3300005330 | Ga0070690_100338380 | Ga0070690_1003383802 | 143 |
| 25 | 3300005337 | Ga0070682_100596573 | Ga0070682_1005965732 | 143 |
| 26 | 3300005353 | Ga0070669_100561349 | Ga0070669_1005613492 | 143 |
| 27 | 3300005354 | Ga0070675_100171509 | Ga0070675_1001715093 | 143 |
| 28 | 3300005355 | Ga0070671_102026107 | Ga0070671_1020261071 | 143 |
| 29 | 3300005364 | Ga0070673_100834321 | Ga0070673_1008343212 | 143 |
| 30 | 3300005365 | Ga0070688_100170222 | Ga0070688_1001702222 | 143 |
| 31 | 3300013307 | Ga0157372_11269734 | Ga0157372_112697342 | 143 |
| 32 | 3300025931 | Ga0207644_10456996 | Ga0207644_104569962 | 143 |
| 33 | 3300025944 | Ga0207661_11131040 | Ga0207661_111310402 | 143 |
| 34 | 3300041443 | Ga0451789_0221219 | Ga0451789_0221219_337_768 | 143 |
| 35 | 3300041452 | Ga0451793_1792388 | Ga0451793_1792388_207_638 | 143 |
| 36 | 3300047320 | Ga0495672_0009170 | Ga0495672_0009170_3431_3862 | 143 |
| 37 | 3300005290 | Ga0065712_10515896 | Ga0065712_105158961 | 144 |
| 38 | 3300005327 | Ga0070658_11002739 | Ga0070658_110027391 | 144 |
| 39 | 3300005339 | Ga0070660_100839865 | Ga0070660_1008398651 | 144 |
| 40 | 3300005344 | Ga0070661_100706694 | Ga0070661_1007066942 | 144 |
| 41 | 3300005366 | Ga0070659_100008294 | Ga0070659_1000082945 | 144 |
| 42 | 3300005539 | Ga0068853_101390633 | Ga0068853_1013906332 | 144 |
| 43 | 3300005548 | Ga0070665_100185952 | Ga0070665_1001859522 | 144 |
| 44 | 3300005548 | Ga0070665_100654916 | Ga0070665_1006549162 | 144 |
| 45 | 3300005564 | Ga0070664_100376965 | Ga0070664_1003769652 | 144 |
| 46 | 3300005577 | Ga0068857_100037614 | Ga0068857_1000376142 | 144 |
| 47 | 3300005616 | Ga0068852_100004038 | Ga0068852_1000040383 | 144 |
| 48 | 3300005616 | Ga0068852_101510072 | Ga0068852_1015100722 | 144 |
| 49 | 3300005616 | Ga0068852_101757418 | Ga0068852_1017574182 | 144 |
| 50 | 3300005617 | Ga0068859_101280206 | Ga0068859_1012802062 | 144 |
| 51 | 3300005618 | Ga0068864_100123126 | Ga0068864_1001231262 | 144 |
| 52 | 3300006931 | Ga0097620_101280174 | Ga0097620_1012801742 | 144 |
| 53 | 3300009553 | Ga0105249_10017922 | Ga0105249_100179224 | 144 |
| 54 | 3300013100 | Ga0157373_10004590 | Ga0157373_100045906 | 144 |
| 55 | 3300013100 | Ga0157373_10183097 | Ga0157373_101830972 | 144 |
| 56 | 3300013102 | Ga0157371_10052352 | Ga0157371_100523521 | 144 |
| 57 | 3300013105 | Ga0157369_10133552 | Ga0157369_101335522 | 144 |
| 58 | 3300013296 | Ga0157374_11568559 | Ga0157374_115685592 | 144 |
| 59 | 3300013306 | Ga0163162_10004419 | Ga0163162_1000441912 | 144 |
| 60 | 3300013306 | Ga0163162_10299278 | Ga0163162_102992782 | 144 |
| 61 | 3300013307 | Ga0157372_10087593 | Ga0157372_100875932 | 144 |
| 62 | 3300013307 | Ga0157372_10122315 | Ga0157372_101223153 | 144 |
| 63 | 3300013307 | Ga0157372_10150716 | Ga0157372_101507163 | 144 |
| 64 | 3300013307 | Ga0157372_10841871 | Ga0157372_108418711 | 144 |
| 65 | 3300013308 | Ga0157375_10042711 | Ga0157375_100427112 | 144 |
| 66 | 3300014325 | Ga0163163_10000616 | Ga0163163_1000061624 | 144 |
| 67 | 3300014968 | Ga0157379_10107487 | Ga0157379_101074872 | 144 |
| 68 | 3300014969 | Ga0157376_11743401 | Ga0157376_117434012 | 144 |
| 69 | 3300017792 | Ga0163161_10091561 | Ga0163161_100915612 | 144 |
| 70 | 3300025904 | Ga0207647_10000110 | Ga0207647_100001103 | 144 |
| 71 | 3300025919 | Ga0207657_10700100 | Ga0207657_107001001 | 144 |
| 72 | 3300025923 | Ga0207681_11458256 | Ga0207681_114582561 | 144 |
| 73 | 3300025932 | Ga0207690_10011551 | Ga0207690_100115515 | 144 |
| 74 | 3300025932 | Ga0207690_11347762 | Ga0207690_113477621 | 144 |
| 75 | 3300025945 | Ga0207679_10641664 | Ga0207679_106416641 | 144 |
| 76 | 3300025961 | Ga0207712_10851210 | Ga0207712_108512102 | 144 |
| 77 | 3300026095 | Ga0207676_10804230 | Ga0207676_108042302 | 144 |
| 78 | 3300026116 | Ga0207674_10339666 | Ga0207674_103396662 | 144 |
| 79 | 3300026142 | Ga0207698_10006840 | Ga0207698_100068405 | 144 |
| 80 | 3300027471 | Ga0209995_1002856 | Ga0209995_10028562 | 144 |
| 81 | 3300028381 | Ga0268264_11425996 | Ga0268264_114259962 | 144 |
| 82 | 3300031824 | Ga0307413_11766337 | Ga0307413_117663371 | 144 |
| 83 | 3300032005 | Ga0307411_11554356 | Ga0307411_115543561 | 144 |
| 84 | 3300032126 | Ga0307415_100693367 | Ga0307415_1006933672 | 144 |
| 85 | 3300037418 | Ga0395900_0577540 | Ga0395900_0577540_50_484 | 144 |
| 86 | 3300041486 | Ga0451807_0946833 | Ga0451807_0946833_171_605 | 144 |
| 87 | 3300042007 | Ga0439449_0084766 | Ga0439449_0084766_459_893 | 144 |
| 88 | 3300042156 | Ga0439446_0106402 | Ga0439446_0106402_89_523 | 144 |
| 89 | 3300049519 | Ga0501296_040306 | Ga0501296_040306_139_573 | 144 |
| 90 | 3300049523 | Ga0501300_089042 | Ga0501300_089042_53_487 | 144 |
| 91 | 3300049571 | Ga0501034_0006320 | Ga0501034_0006320_1323_1760 | 144 |
| 92 | 3300049572 | Ga0501036_0214151 | Ga0501036_0214151_16_453 | 144 |
| 93 | 3300049573 | Ga0501037_0004468 | Ga0501037_0004468_1354_1791 | 144 |
| 94 | 3300049574 | Ga0501038_0033947 | Ga0501038_0033947_3315_3752 | 144 |
| 95 | 3300049575 | Ga0501039_0033541 | Ga0501039_0033541_1470_1907 | 144 |
| 96 | 3300049579 | Ga0501043_0014820 | Ga0501043_0014820_1654_2091 | 144 |
| 97 | 3300049579 | Ga0501043_0145324 | Ga0501043_0145324_68_505 | 144 |
| 98 | 3300049581 | Ga0501047_0604590 | Ga0501047_0604590_58_495 | 144 |
| 99 | 3300049649 | Ga0501198_143414 | Ga0501198_143414_49_483 | 144 |
| 100 | 3300049674 | Ga0501242_003483 | Ga0501242_003483_871_1305 | 144 |
| 101 | 3300049677 | Ga0501247_050242 | Ga0501247_050242_85_519 | 144 |
| 102 | 3300049680 | Ga0501250_004671 | Ga0501250_004671_741_1175 | 144 |
| 103 | 3300049686 | Ga0501257_111806 | Ga0501257_111806_194_628 | 144 |
| 104 | 3300049686 | Ga0501257_186728 | Ga0501257_186728_20_454 | 144 |
| 105 | 3300049705 | Ga0501225_0198782 | Ga0501225_0198782_111_545 | 144 |
| 106 | 3300049708 | Ga0501245_026926 | Ga0501245_026926_432_866 | 144 |
| 107 | 3300049765 | Ga0501268_004601 | Ga0501268_004601_531_965 | 144 |
| 108 | 3300049822 | Ga0501035_0018759 | Ga0501035_0018759_1916_2353 | 144 |
| 109 | 3300049823 | Ga0501044_0008750 | Ga0501044_0008750_2251_2688 | 144 |
| 110 | 3300053088 | Ga0500644_0004641 | Ga0500644_0004641_1306_1740 | 144 |
| 111 | 3300053104 | Ga0500556_0143292 | Ga0500556_0143292_319_753 | 144 |
| 112 | 3300053134 | Ga0500658_0269165 | Ga0500658_0269165_67_501 | 144 |
| 113 | 3300053153 | Ga0500616_0030699 | Ga0500616_0030699_1307_1741 | 144 |
| 114 | 3300002459 | JGI24751J29686_10030150 | JGI24751J29686_100301502 | 145 |
| 115 | 3300003320 | rootH2_10189197 | rootH2_101891972 | 145 |
| 116 | 3300003322 | rootL2_10155484 | rootL2_101554843 | 145 |
| 117 | 3300003322 | rootL2_10167564 | rootL2_101675642 | 145 |
| 118 | 3300003323 | rootH1_10170087 | rootH1_101700872 | 145 |
| 119 | 3300005290 | Ga0065712_10003463 | Ga0065712_100034633 | 145 |
| 120 | 3300005295 | Ga0065707_10315537 | Ga0065707_103155372 | 145 |
| 121 | 3300005328 | Ga0070676_10027613 | Ga0070676_100276132 | 145 |
| 122 | 3300005328 | Ga0070676_10126186 | Ga0070676_101261862 | 145 |
| 123 | 3300005328 | Ga0070676_11123342 | Ga0070676_111233421 | 145 |
| 124 | 3300005329 | Ga0070683_100000822 | Ga0070683_1000008221 | 145 |
| 125 | 3300005331 | Ga0070670_100030765 | Ga0070670_1000307654 | 145 |
| 126 | 3300005331 | Ga0070670_100137536 | Ga0070670_1001375361 | 145 |
| 127 | 3300005331 | Ga0070670_100206288 | Ga0070670_1002062882 | 145 |
| 128 | 3300005331 | Ga0070670_100207497 | Ga0070670_1002074972 | 145 |
| 129 | 3300005331 | Ga0070670_100990624 | Ga0070670_1009906242 | 145 |
| 130 | 3300005334 | Ga0068869_100019296 | Ga0068869_1000192965 | 145 |
| 131 | 3300005335 | Ga0070666_10000140 | Ga0070666_1000014022 | 145 |
| 132 | 3300005336 | Ga0070680_100079386 | Ga0070680_1000793861 | 145 |
| 133 | 3300005337 | Ga0070682_100078431 | Ga0070682_1000784312 | 145 |
| 134 | 3300005338 | Ga0068868_100014125 | Ga0068868_1000141253 | 145 |
| 135 | 3300005338 | Ga0068868_100144899 | Ga0068868_1001448992 | 145 |
| 136 | 3300005338 | Ga0068868_100148887 | Ga0068868_1001488872 | 145 |
| 137 | 3300005338 | Ga0068868_100391578 | Ga0068868_1003915782 | 145 |
| 138 | 3300005338 | Ga0068868_100800692 | Ga0068868_1008006922 | 145 |
| 139 | 3300005339 | Ga0070660_100020174 | Ga0070660_1000201744 | 145 |
| 140 | 3300005340 | Ga0070689_100003147 | Ga0070689_1000031473 | 145 |
| 141 | 3300005344 | Ga0070661_100070471 | Ga0070661_1000704712 | 145 |
| 142 | 3300005344 | Ga0070661_100076266 | Ga0070661_1000762661 | 145 |
| 143 | 3300005347 | Ga0070668_100440007 | Ga0070668_1004400072 | 145 |
| 144 | 3300005353 | Ga0070669_100005206 | Ga0070669_1000052064 | 145 |
| 145 | 3300005353 | Ga0070669_101686261 | Ga0070669_1016862611 | 145 |
| 146 | 3300005354 | Ga0070675_100006515 | Ga0070675_1000065153 | 145 |
| 147 | 3300005354 | Ga0070675_100090498 | Ga0070675_1000904981 | 145 |
| 148 | 3300005354 | Ga0070675_100213277 | Ga0070675_1002132772 | 145 |
| 149 | 3300005354 | Ga0070675_100447089 | Ga0070675_1004470892 | 145 |
| 150 | 3300005355 | Ga0070671_100136869 | Ga0070671_1001368693 | 145 |
| 151 | 3300005355 | Ga0070671_100212005 | Ga0070671_1002120052 | 145 |
| 152 | 3300005355 | Ga0070671_100247226 | Ga0070671_1002472262 | 145 |
| 153 | 3300005364 | Ga0070673_100046844 | Ga0070673_1000468442 | 145 |
| 154 | 3300005364 | Ga0070673_100073354 | Ga0070673_1000733542 | 145 |
| 155 | 3300005365 | Ga0070688_100005114 | Ga0070688_1000051144 | 145 |
| 156 | 3300005365 | Ga0070688_100092091 | Ga0070688_1000920912 | 145 |
| 157 | 3300005365 | Ga0070688_100476672 | Ga0070688_1004766721 | 145 |
| 158 | 3300005366 | Ga0070659_100013275 | Ga0070659_1000132754 | 145 |
| 159 | 3300005367 | Ga0070667_100026703 | Ga0070667_1000267032 | 145 |
| 160 | 3300005367 | Ga0070667_100186230 | Ga0070667_1001862303 | 145 |
| 161 | 3300005367 | Ga0070667_100192372 | Ga0070667_1001923722 | 145 |
| 162 | 3300005438 | Ga0070701_10107444 | Ga0070701_101074442 | 145 |
| 163 | 3300005441 | Ga0070700_100366869 | Ga0070700_1003668691 | 145 |
| 164 | 3300005441 | Ga0070700_100923252 | Ga0070700_1009232521 | 145 |
| 165 | 3300005444 | Ga0070694_100761277 | Ga0070694_1007612771 | 145 |
| 166 | 3300005456 | Ga0070678_100479702 | Ga0070678_1004797022 | 145 |
| 167 | 3300005456 | Ga0070678_101222598 | Ga0070678_1012225981 | 145 |
| 168 | 3300005457 | Ga0070662_100020763 | Ga0070662_1000207634 | 145 |
| 169 | 3300005458 | Ga0070681_10170611 | Ga0070681_101706112 | 145 |
| 170 | 3300005459 | Ga0068867_100015718 | Ga0068867_1000157182 | 145 |
| 171 | 3300005459 | Ga0068867_101052751 | Ga0068867_1010527512 | 145 |
| 172 | 3300005466 | Ga0070685_10030944 | Ga0070685_100309442 | 145 |
| 173 | 3300005466 | Ga0070685_10740851 | Ga0070685_107408511 | 145 |
| 174 | 3300005471 | Ga0070698_100576503 | Ga0070698_1005765032 | 145 |
| 175 | 3300005530 | Ga0070679_100104036 | Ga0070679_1001040362 | 145 |
| 176 | 3300005535 | Ga0070684_100018970 | Ga0070684_1000189703 | 145 |
| 177 | 3300005535 | Ga0070684_100113251 | Ga0070684_1001132513 | 145 |
| 178 | 3300005539 | Ga0068853_100743505 | Ga0068853_1007435051 | 145 |
| 179 | 3300005539 | Ga0068853_101802988 | Ga0068853_1018029881 | 145 |
| 180 | 3300005543 | Ga0070672_100084867 | Ga0070672_1000848672 | 145 |
| 181 | 3300005543 | Ga0070672_100085447 | Ga0070672_1000854473 | 145 |
| 182 | 3300005543 | Ga0070672_100173317 | Ga0070672_1001733172 | 145 |
| 183 | 3300005543 | Ga0070672_101322113 | Ga0070672_1013221131 | 145 |
| 184 | 3300005546 | Ga0070696_100515474 | Ga0070696_1005154742 | 145 |
| 185 | 3300005547 | Ga0070693_100084072 | Ga0070693_1000840722 | 145 |
| 186 | 3300005548 | Ga0070665_100405617 | Ga0070665_1004056172 | 145 |
| 187 | 3300005549 | Ga0070704_100080162 | Ga0070704_1000801622 | 145 |
| 188 | 3300005563 | Ga0068855_100010513 | Ga0068855_1000105137 | 145 |
| 189 | 3300005563 | Ga0068855_100274563 | Ga0068855_1002745634 | 145 |
| 190 | 3300005564 | Ga0070664_100013343 | Ga0070664_1000133437 | 145 |
| 191 | 3300005564 | Ga0070664_100245150 | Ga0070664_1002451502 | 145 |
| 192 | 3300005577 | Ga0068857_100048236 | Ga0068857_1000482362 | 145 |
| 193 | 3300005577 | Ga0068857_100169625 | Ga0068857_1001696252 | 145 |
| 194 | 3300005577 | Ga0068857_100283276 | Ga0068857_1002832762 | 145 |
| 195 | 3300005578 | Ga0068854_100183835 | Ga0068854_1001838352 | 145 |
| 196 | 3300005578 | Ga0068854_100250084 | Ga0068854_1002500841 | 145 |
| 197 | 3300005614 | Ga0068856_100008955 | Ga0068856_10000895512 | 145 |
| 198 | 3300005614 | Ga0068856_100123326 | Ga0068856_1001233262 | 145 |
| 199 | 3300005616 | Ga0068852_100042142 | Ga0068852_1000421422 | 145 |
| 200 | 3300005616 | Ga0068852_100915131 | Ga0068852_1009151312 | 145 |
| 201 | 3300005617 | Ga0068859_100005301 | Ga0068859_1000053013 | 145 |
| 202 | 3300005617 | Ga0068859_100007673 | Ga0068859_1000076738 | 145 |
| 203 | 3300005617 | Ga0068859_100011225 | Ga0068859_1000112258 | 145 |
| 204 | 3300005617 | Ga0068859_100632863 | Ga0068859_1006328632 | 145 |
| 205 | 3300005618 | Ga0068864_100074141 | Ga0068864_1000741414 | 145 |
| 206 | 3300005618 | Ga0068864_100280321 | Ga0068864_1002803212 | 145 |
| 207 | 3300005618 | Ga0068864_100882849 | Ga0068864_1008828492 | 145 |
| 208 | 3300005718 | Ga0068866_10051005 | Ga0068866_100510052 | 145 |
| 209 | 3300005718 | Ga0068866_10478532 | Ga0068866_104785321 | 145 |
| 210 | 3300005719 | Ga0068861_100009719 | Ga0068861_1000097196 | 145 |
| 211 | 3300005719 | Ga0068861_100449385 | Ga0068861_1004493852 | 145 |
| 212 | 3300005834 | Ga0068851_10013184 | Ga0068851_100131845 | 145 |
| 213 | 3300005834 | Ga0068851_10056186 | Ga0068851_100561863 | 145 |
| 214 | 3300005834 | Ga0068851_10276249 | Ga0068851_102762491 | 145 |
| 215 | 3300005840 | Ga0068870_10448192 | Ga0068870_104481921 | 145 |
| 216 | 3300005841 | Ga0068863_100019417 | Ga0068863_1000194176 | 145 |
| 217 | 3300005842 | Ga0068858_100008890 | Ga0068858_1000088903 | 145 |
| 218 | 3300005843 | Ga0068860_100003714 | Ga0068860_1000037145 | 145 |
| 219 | 3300005843 | Ga0068860_100013131 | Ga0068860_1000131318 | 145 |
| 220 | 3300005843 | Ga0068860_100038579 | Ga0068860_1000385795 | 145 |
| 221 | 3300005843 | Ga0068860_100444800 | Ga0068860_1004448002 | 145 |
| 222 | 3300005844 | Ga0068862_100004753 | Ga0068862_1000047532 | 145 |
| 223 | 3300005844 | Ga0068862_100979476 | Ga0068862_1009794762 | 145 |
| 224 | 3300006195 | Ga0075366_10014202 | Ga0075366_100142023 | 145 |
| 225 | 3300006195 | Ga0075366_10022539 | Ga0075366_100225392 | 145 |
| 226 | 3300006237 | Ga0097621_100007974 | Ga0097621_1000079743 | 145 |
| 227 | 3300006358 | Ga0068871_100007675 | Ga0068871_1000076752 | 145 |
| 228 | 3300006358 | Ga0068871_100227397 | Ga0068871_1002273972 | 145 |
| 229 | 3300006358 | Ga0068871_100299234 | Ga0068871_1002992342 | 145 |
| 230 | 3300006852 | Ga0075433_10664481 | Ga0075433_106644812 | 145 |
| 231 | 3300006881 | Ga0068865_100049998 | Ga0068865_1000499984 | 145 |
| 232 | 3300006881 | Ga0068865_100074845 | Ga0068865_1000748452 | 145 |
| 233 | 3300006931 | Ga0097620_100005301 | Ga0097620_10000530112 | 145 |
| 234 | 3300006931 | Ga0097620_100007673 | Ga0097620_1000076734 | 145 |
| 235 | 3300006931 | Ga0097620_100011225 | Ga0097620_1000112258 | 145 |
| 236 | 3300006931 | Ga0097620_100632759 | Ga0097620_1006327592 | 145 |
| 237 | 3300009093 | Ga0105240_10438934 | Ga0105240_104389341 | 145 |
| 238 | 3300009094 | Ga0111539_10011963 | Ga0111539_1001196310 | 145 |
| 239 | 3300009098 | Ga0105245_10132240 | Ga0105245_101322403 | 145 |
| 240 | 3300009101 | Ga0105247_10022954 | Ga0105247_100229545 | 145 |
| 241 | 3300009174 | Ga0105241_10006156 | Ga0105241_100061562 | 145 |
| 242 | 3300009174 | Ga0105241_12201295 | Ga0105241_122012951 | 145 |
| 243 | 3300009176 | Ga0105242_10929172 | Ga0105242_109291721 | 145 |
| 244 | 3300009176 | Ga0105242_12061045 | Ga0105242_120610451 | 145 |
| 245 | 3300009176 | Ga0105242_12069389 | Ga0105242_120693891 | 145 |
| 246 | 3300009545 | Ga0105237_10003256 | Ga0105237_1000325613 | 145 |
| 247 | 3300009545 | Ga0105237_10072570 | Ga0105237_100725703 | 145 |
| 248 | 3300009553 | Ga0105249_10008383 | Ga0105249_100083834 | 145 |
| 249 | 3300010375 | Ga0105239_10016641 | Ga0105239_100166417 | 145 |
| 250 | 3300010375 | Ga0105239_10240926 | Ga0105239_102409263 | 145 |
| 251 | 3300011119 | Ga0105246_10434917 | Ga0105246_104349172 | 145 |
| 252 | 3300013100 | Ga0157373_10064970 | Ga0157373_100649702 | 145 |
| 253 | 3300013102 | Ga0157371_10109916 | Ga0157371_101099162 | 145 |
| 254 | 3300013102 | Ga0157371_10523898 | Ga0157371_105238981 | 145 |
| 255 | 3300013102 | Ga0157371_10747653 | Ga0157371_107476531 | 145 |
| 256 | 3300013104 | Ga0157370_10061444 | Ga0157370_100614442 | 145 |
| 257 | 3300013104 | Ga0157370_10544904 | Ga0157370_105449042 | 145 |
| 258 | 3300013105 | Ga0157369_10515962 | Ga0157369_105159622 | 145 |
| 259 | 3300013105 | Ga0157369_12176537 | Ga0157369_121765371 | 145 |
| 260 | 3300013296 | Ga0157374_10033679 | Ga0157374_100336796 | 145 |
| 261 | 3300013296 | Ga0157374_10242852 | Ga0157374_102428522 | 145 |
| 262 | 3300013296 | Ga0157374_10248237 | Ga0157374_102482372 | 145 |
| 263 | 3300013296 | Ga0157374_10478547 | Ga0157374_104785472 | 145 |
| 264 | 3300013296 | Ga0157374_10490102 | Ga0157374_104901022 | 145 |
| 265 | 3300013297 | Ga0157378_10013830 | Ga0157378_100138308 | 145 |
| 266 | 3300013297 | Ga0157378_10089299 | Ga0157378_100892993 | 145 |
| 267 | 3300013297 | Ga0157378_10139864 | Ga0157378_101398643 | 145 |
| 268 | 3300013297 | Ga0157378_10227989 | Ga0157378_102279891 | 145 |
| 269 | 3300013297 | Ga0157378_10379640 | Ga0157378_103796402 | 145 |
| 270 | 3300013297 | Ga0157378_10427485 | Ga0157378_104274852 | 145 |
| 271 | 3300013297 | Ga0157378_10950960 | Ga0157378_109509602 | 145 |
| 272 | 3300013306 | Ga0163162_10044565 | Ga0163162_100445655 | 145 |
| 273 | 3300013306 | Ga0163162_10067985 | Ga0163162_100679852 | 145 |
| 274 | 3300013306 | Ga0163162_10367200 | Ga0163162_103672001 | 145 |
| 275 | 3300013307 | Ga0157372_10036086 | Ga0157372_100360865 | 145 |
| 276 | 3300013307 | Ga0157372_10094426 | Ga0157372_100944262 | 145 |
| 277 | 3300013307 | Ga0157372_10495282 | Ga0157372_104952821 | 145 |
| 278 | 3300013308 | Ga0157375_10009168 | Ga0157375_100091685 | 145 |
| 279 | 3300013308 | Ga0157375_10355178 | Ga0157375_103551782 | 145 |
| 280 | 3300013308 | Ga0157375_10393902 | Ga0157375_103939022 | 145 |
| 281 | 3300013308 | Ga0157375_12924997 | Ga0157375_129249971 | 145 |
| 282 | 3300014325 | Ga0163163_10013193 | Ga0163163_100131933 | 145 |
| 283 | 3300014326 | Ga0157380_10003256 | Ga0157380_100032563 | 145 |
| 284 | 3300014326 | Ga0157380_10390316 | Ga0157380_103903162 | 145 |
| 285 | 3300014745 | Ga0157377_10003394 | Ga0157377_100033944 | 145 |
| 286 | 3300014745 | Ga0157377_10027446 | Ga0157377_100274464 | 145 |
| 287 | 3300014745 | Ga0157377_10037095 | Ga0157377_100370952 | 145 |
| 288 | 3300014745 | Ga0157377_10131035 | Ga0157377_101310352 | 145 |
| 289 | 3300014968 | Ga0157379_10137286 | Ga0157379_101372863 | 145 |
| 290 | 3300014969 | Ga0157376_10006093 | Ga0157376_100060939 | 145 |
| 291 | 3300014969 | Ga0157376_10059314 | Ga0157376_100593142 | 145 |
| 292 | 3300014969 | Ga0157376_10213719 | Ga0157376_102137192 | 145 |
| 293 | 3300017792 | Ga0163161_10322569 | Ga0163161_103225691 | 145 |
| 294 | 3300017792 | Ga0163161_12041748 | Ga0163161_120417481 | 145 |
| 295 | 3300025321 | Ga0207656_10016904 | Ga0207656_100169044 | 145 |
| 296 | 3300025321 | Ga0207656_10038311 | Ga0207656_100383111 | 145 |
| 297 | 3300025321 | Ga0207656_10048182 | Ga0207656_100481822 | 145 |
| 298 | 3300025321 | Ga0207656_10089357 | Ga0207656_100893572 | 145 |
| 299 | 3300025893 | Ga0207682_10034810 | Ga0207682_100348102 | 145 |
| 300 | 3300025899 | Ga0207642_10042933 | Ga0207642_100429331 | 145 |
| 301 | 3300025899 | Ga0207642_10351088 | Ga0207642_103510882 | 145 |
| 302 | 3300025901 | Ga0207688_10113975 | Ga0207688_101139752 | 145 |
| 303 | 3300025903 | Ga0207680_10000140 | Ga0207680_1000014016 | 145 |
| 304 | 3300025903 | Ga0207680_10293364 | Ga0207680_102933641 | 145 |
| 305 | 3300025904 | Ga0207647_10049005 | Ga0207647_100490051 | 145 |
| 306 | 3300025904 | Ga0207647_10153056 | Ga0207647_101530562 | 145 |
| 307 | 3300025907 | Ga0207645_10000885 | Ga0207645_1000088519 | 145 |
| 308 | 3300025907 | Ga0207645_10056234 | Ga0207645_100562342 | 145 |
| 309 | 3300025907 | Ga0207645_10086812 | Ga0207645_100868122 | 145 |
| 310 | 3300025908 | Ga0207643_10004003 | Ga0207643_100040034 | 145 |
| 311 | 3300025909 | Ga0207705_10094318 | Ga0207705_100943182 | 145 |
| 312 | 3300025911 | Ga0207654_10016349 | Ga0207654_100163493 | 145 |
| 313 | 3300025911 | Ga0207654_10096423 | Ga0207654_100964232 | 145 |
| 314 | 3300025913 | Ga0207695_10363740 | Ga0207695_103637401 | 145 |
| 315 | 3300025914 | Ga0207671_10004643 | Ga0207671_1000464310 | 145 |
| 316 | 3300025917 | Ga0207660_10862180 | Ga0207660_108621801 | 145 |
| 317 | 3300025918 | Ga0207662_10049337 | Ga0207662_100493373 | 145 |
| 318 | 3300025919 | Ga0207657_10008412 | Ga0207657_100084127 | 145 |
| 319 | 3300025919 | Ga0207657_10181553 | Ga0207657_101815532 | 145 |
| 320 | 3300025920 | Ga0207649_10043018 | Ga0207649_100430183 | 145 |
| 321 | 3300025920 | Ga0207649_10136439 | Ga0207649_101364392 | 145 |
| 322 | 3300025921 | Ga0207652_10593978 | Ga0207652_105939782 | 145 |
| 323 | 3300025923 | Ga0207681_10016733 | Ga0207681_100167334 | 145 |
| 324 | 3300025925 | Ga0207650_10026300 | Ga0207650_100263004 | 145 |
| 325 | 3300025925 | Ga0207650_10031426 | Ga0207650_100314264 | 145 |
| 326 | 3300025925 | Ga0207650_10222019 | Ga0207650_102220192 | 145 |
| 327 | 3300025925 | Ga0207650_10491483 | Ga0207650_104914832 | 145 |
| 328 | 3300025926 | Ga0207659_10073065 | Ga0207659_100730653 | 145 |
| 329 | 3300025926 | Ga0207659_10129216 | Ga0207659_101292162 | 145 |
| 330 | 3300025926 | Ga0207659_10146696 | Ga0207659_101466963 | 145 |
| 331 | 3300025926 | Ga0207659_10553787 | Ga0207659_105537872 | 145 |
| 332 | 3300025931 | Ga0207644_10077382 | Ga0207644_100773823 | 145 |
| 333 | 3300025931 | Ga0207644_10122298 | Ga0207644_101222982 | 145 |
| 334 | 3300025931 | Ga0207644_10224171 | Ga0207644_102241712 | 145 |
| 335 | 3300025931 | Ga0207644_10592195 | Ga0207644_105921952 | 145 |
| 336 | 3300025932 | Ga0207690_10269362 | Ga0207690_102693622 | 145 |
| 337 | 3300025933 | Ga0207706_10003522 | Ga0207706_1000352210 | 145 |
| 338 | 3300025933 | Ga0207706_10027363 | Ga0207706_100273632 | 145 |
| 339 | 3300025933 | Ga0207706_10281818 | Ga0207706_102818182 | 145 |
| 340 | 3300025935 | Ga0207709_10172544 | Ga0207709_101725442 | 145 |
| 341 | 3300025936 | Ga0207670_10019033 | Ga0207670_100190334 | 145 |
| 342 | 3300025937 | Ga0207669_10020127 | Ga0207669_100201273 | 145 |
| 343 | 3300025938 | Ga0207704_10046872 | Ga0207704_100468722 | 145 |
| 344 | 3300025940 | Ga0207691_10038025 | Ga0207691_100380256 | 145 |
| 345 | 3300025940 | Ga0207691_10126362 | Ga0207691_101263623 | 145 |
| 346 | 3300025940 | Ga0207691_10164983 | Ga0207691_101649832 | 145 |
| 347 | 3300025940 | Ga0207691_10180081 | Ga0207691_101800813 | 145 |
| 348 | 3300025941 | Ga0207711_11455462 | Ga0207711_114554621 | 145 |
| 349 | 3300025942 | Ga0207689_10000857 | Ga0207689_100008572 | 145 |
| 350 | 3300025942 | Ga0207689_10021062 | Ga0207689_100210625 | 145 |
| 351 | 3300025942 | Ga0207689_10116323 | Ga0207689_101163232 | 145 |
| 352 | 3300025944 | Ga0207661_10007166 | Ga0207661_100071661 | 145 |
| 353 | 3300025945 | Ga0207679_10824473 | Ga0207679_108244731 | 145 |
| 354 | 3300025960 | Ga0207651_10120767 | Ga0207651_101207671 | 145 |
| 355 | 3300025960 | Ga0207651_10151482 | Ga0207651_101514823 | 145 |
| 356 | 3300025960 | Ga0207651_10159173 | Ga0207651_101591732 | 145 |
| 357 | 3300025961 | Ga0207712_10012455 | Ga0207712_100124557 | 145 |
| 358 | 3300025972 | Ga0207668_10199495 | Ga0207668_101994952 | 145 |
| 359 | 3300025972 | Ga0207668_10287843 | Ga0207668_102878432 | 145 |
| 360 | 3300025981 | Ga0207640_10028788 | Ga0207640_100287884 | 145 |
| 361 | 3300025981 | Ga0207640_10116280 | Ga0207640_101162802 | 145 |
| 362 | 3300025981 | Ga0207640_10693275 | Ga0207640_106932752 | 145 |
| 363 | 3300025986 | Ga0207658_10063060 | Ga0207658_100630603 | 145 |
| 364 | 3300025986 | Ga0207658_10160970 | Ga0207658_101609703 | 145 |
| 365 | 3300025986 | Ga0207658_10440584 | Ga0207658_104405842 | 145 |
| 366 | 3300026023 | Ga0207677_10004532 | Ga0207677_100045325 | 145 |
| 367 | 3300026023 | Ga0207677_10024508 | Ga0207677_100245083 | 145 |
| 368 | 3300026023 | Ga0207677_10211063 | Ga0207677_102110632 | 145 |
| 369 | 3300026023 | Ga0207677_10828482 | Ga0207677_108284822 | 145 |
| 370 | 3300026035 | Ga0207703_10005628 | Ga0207703_100056285 | 145 |
| 371 | 3300026041 | Ga0207639_10169330 | Ga0207639_101693302 | 145 |
| 372 | 3300026075 | Ga0207708_10399854 | Ga0207708_103998542 | 145 |
| 373 | 3300026078 | Ga0207702_10092075 | Ga0207702_100920754 | 145 |
| 374 | 3300026088 | Ga0207641_10000082 | Ga0207641_1000008245 | 145 |
| 375 | 3300026088 | Ga0207641_10014637 | Ga0207641_100146374 | 145 |
| 376 | 3300026089 | Ga0207648_10000510 | Ga0207648_1000051022 | 145 |
| 377 | 3300026089 | Ga0207648_10001518 | Ga0207648_100015188 | 145 |
| 378 | 3300026089 | Ga0207648_10037174 | Ga0207648_100371743 | 145 |
| 379 | 3300026095 | Ga0207676_10070512 | Ga0207676_100705123 | 145 |
| 380 | 3300026095 | Ga0207676_10252952 | Ga0207676_102529522 | 145 |
| 381 | 3300026116 | Ga0207674_10041481 | Ga0207674_100414814 | 145 |
| 382 | 3300026116 | Ga0207674_10189006 | Ga0207674_101890062 | 145 |
| 383 | 3300026116 | Ga0207674_10521646 | Ga0207674_105216462 | 145 |
| 384 | 3300026116 | Ga0207674_10577951 | Ga0207674_105779512 | 145 |
| 385 | 3300026118 | Ga0207675_100008333 | Ga0207675_1000083333 | 145 |
| 386 | 3300026118 | Ga0207675_100024542 | Ga0207675_1000245422 | 145 |
| 387 | 3300026121 | Ga0207683_10003647 | Ga0207683_100036475 | 145 |
| 388 | 3300026121 | Ga0207683_10786751 | Ga0207683_107867512 | 145 |
| 389 | 3300026121 | Ga0207683_11476460 | Ga0207683_114764601 | 145 |
| 390 | 3300026142 | Ga0207698_10033604 | Ga0207698_100336045 | 145 |
| 391 | 3300026142 | Ga0207698_10164860 | Ga0207698_101648602 | 145 |
| 392 | 3300026142 | Ga0207698_10341067 | Ga0207698_103410671 | 145 |
| 393 | 3300026142 | Ga0207698_10351806 | Ga0207698_103518062 | 145 |
| 394 | 3300026142 | Ga0207698_11022263 | Ga0207698_110222632 | 145 |
| 395 | 3300027907 | Ga0207428_10223269 | Ga0207428_102232692 | 145 |
| 396 | 3300028380 | Ga0268265_10004351 | Ga0268265_100043512 | 145 |
| 397 | 3300028380 | Ga0268265_10133247 | Ga0268265_101332472 | 145 |
| 398 | 3300028380 | Ga0268265_12292410 | Ga0268265_122924102 | 145 |
| 399 | 3300028381 | Ga0268264_10000810 | Ga0268264_1000081012 | 145 |
| 400 | 3300028381 | Ga0268264_10095464 | Ga0268264_100954643 | 145 |
| 401 | 3300028381 | Ga0268264_10170682 | Ga0268264_101706822 | 145 |
| 402 | 3300028381 | Ga0268264_10933956 | Ga0268264_109339562 | 145 |
| 403 | 3300028381 | Ga0268264_10941279 | Ga0268264_109412792 | 145 |
| 404 | 3300028794 | Ga0307515_10000412 | Ga0307515_1000041227 | 145 |
| 405 | 3300031456 | Ga0307513_10411083 | Ga0307513_104110831 | 145 |
| 406 | 3300031456 | Ga0307513_10602506 | Ga0307513_106025062 | 145 |
| 407 | 3300031507 | Ga0307509_10057749 | Ga0307509_100577495 | 145 |
| 408 | 3300037068 | Ga0373925_0663425 | Ga0373925_0663425_262_699 | 145 |
| 409 | 3300037471 | Ga0395905_0527061 | Ga0395905_0527061_573_1010 | 145 |
| 410 | 3300041404 | Ga0439436_0012351 | Ga0439436_0012351_1536_1973 | 145 |
| 411 | 3300041406 | Ga0439439_0129546 | Ga0439439_0129546_30_467 | 145 |
| 412 | 3300041413 | Ga0439465_0117994 | Ga0439465_0117994_270_707 | 145 |
| 413 | 3300041498 | Ga0451841_0332562 | Ga0451841_0332562_104_541 | 145 |
| 414 | 3300041999 | Ga0439433_0058424 | Ga0439433_0058424_257_694 | 145 |
| 415 | 3300042002 | Ga0439442_002870 | Ga0439442_002870_217_654 | 145 |
| 416 | 3300042004 | Ga0439445_0002485 | Ga0439445_0002485_2113_2550 | 145 |
| 417 | 3300042004 | Ga0439445_0042647 | Ga0439445_0042647_363_800 | 145 |
| 418 | 3300042011 | Ga0439454_038643 | Ga0439454_038643_82_519 | 145 |
| 419 | 3300042014 | Ga0439457_031580 | Ga0439457_031580_42_479 | 145 |
| 420 | 3300042015 | Ga0439462_0018811 | Ga0439462_0018811_1103_1540 | 145 |
| 421 | 3300042015 | Ga0439462_0112472 | Ga0439462_0112472_267_704 | 145 |
| 422 | 3300042128 | Ga0450897_001392 | Ga0450897_001392_40_477 | 145 |
| 423 | 3300042131 | Ga0450894_010152 | Ga0450894_010152_568_1005 | 145 |
| 424 | 3300042134 | Ga0450898_007999 | Ga0450898_007999_156_593 | 145 |
| 425 | 3300042156 | Ga0439446_0118568 | Ga0439446_0118568_182_619 | 145 |
| 426 | 3300042435 | Ga0439434_0019877 | Ga0439434_0019877_1529_1966 | 145 |
| 427 | 3300044656 | Ga0466969_0187434 | Ga0466969_0187434_475_912 | 145 |
| 428 | 3300044658 | Ga0466972_0000038 | Ga0466972_0000038_75442_75879 | 145 |
| 429 | 3300044684 | Ga0466966_0098836 | Ga0466966_0098836_1256_1693 | 145 |
| 430 | 3300044684 | Ga0466966_0103602 | Ga0466966_0103602_1208_1645 | 145 |
| 431 | 3300044693 | Ga0466961_0047735 | Ga0466961_0047735_1562_1999 | 145 |
| 432 | 3300044693 | Ga0466961_0330285 | Ga0466961_0330285_370_807 | 145 |
| 433 | 3300044712 | Ga0453684_0063353 | Ga0453684_0063353_4247_4684 | 145 |
| 434 | 3300044735 | Ga0466968_0032828 | Ga0466968_0032828_251_688 | 145 |
| 435 | 3300044765 | Ga0466970_0131722 | Ga0466970_0131722_777_1214 | 145 |
| 436 | 3300044842 | Ga0466957_0000186 | Ga0466957_0000186_27040_27477 | 145 |
| 437 | 3300044842 | Ga0466957_0011910 | Ga0466957_0011910_402_839 | 145 |
| 438 | 3300045049 | Ga0466959_0000380 | Ga0466959_0000380_18031_18468 | 145 |
| 439 | 3300046522 | Ga0495643_0047658 | Ga0495643_0047658_774_1211 | 145 |
| 440 | 3300047320 | Ga0495672_0019406 | Ga0495672_0019406_2207_2644 | 145 |
| 441 | 3300047472 | Ga0495686_0365366 | Ga0495686_0365366_321_758 | 145 |
| 442 | 3300048912 | Ga0496109_1579012 | Ga0496109_1579012_37_474 | 145 |
| 443 | 3300049569 | Ga0501032_0376487 | Ga0501032_0376487_105_575 | 145 |
| 444 | 3300049571 | Ga0501034_0024146 | Ga0501034_0024146_4173_4613 | 145 |
| 445 | 3300049572 | Ga0501036_0627095 | Ga0501036_0627095_272_742 | 145 |
| 446 | 3300049574 | Ga0501038_0070245 | Ga0501038_0070245_2445_2885 | 145 |
| 447 | 3300049575 | Ga0501039_0506040 | Ga0501039_0506040_441_881 | 145 |
| 448 | 3300049580 | Ga0501046_0021115 | Ga0501046_0021115_830_1270 | 145 |
| 449 | 3300049581 | Ga0501047_0254834 | Ga0501047_0254834_550_987 | 145 |
| 450 | 3300049823 | Ga0501044_0050326 | Ga0501044_0050326_347_784 | 145 |
| 451 | 3300049853 | Ga0501226_011946 | Ga0501226_011946_105_542 | 145 |
| 452 | 3300050493 | nmdc:mga0k408_87764_c1 | nmdc:mga0k408_87764_c1_777_1214 | 145 |
| 453 | 3300050493 | nmdc:mga0k408_9500_c1 | nmdc:mga0k408_9500_c1_4388_4825 | 145 |
| 454 | 3300050507 | nmdc:mga05p37_97180_c1 | nmdc:mga05p37_97180_c1_2707_3144 | 145 |
| 455 | 3300050511 | nmdc:mga08y16_392878_c1 | nmdc:mga08y16_392878_c1_134_571 | 145 |
| 456 | 3300053092 | Ga0500583_0000147 | Ga0500583_0000147_25928_26365 | 145 |
| 457 | 3300053094 | Ga0500566_0269797 | Ga0500566_0269797_202_639 | 145 |
| 458 | 3300053130 | Ga0500642_0248079 | Ga0500642_0248079_236_673 | 145 |
| 459 | 3300053134 | Ga0500658_0488950 | Ga0500658_0488950_38_475 | 145 |
| 460 | 3300053139 | Ga0500568_0000416 | Ga0500568_0000416_16908_17345 | 145 |
| 461 | 3300053147 | Ga0500589_131872 | Ga0500589_131872_158_595 | 145 |
| 462 | 3300053150 | Ga0500603_111241 | Ga0500603_111241_102_539 | 145 |
| 463 | 3300053160 | Ga0500633_0070148 | Ga0500633_0070148_238_675 | 145 |
| 464 | 3300053163 | Ga0500639_167585 | Ga0500639_167585_235_672 | 145 |
| 465 | 3300053177 | Ga0500636_0118991 | Ga0500636_0118991_915_1352 | 145 |
| 466 | 3300053727 | Ga0500611_000074 | Ga0500611_000074_97_534 | 145 |
| 467 | 3300061719 | Ga0466962_0174904 | Ga0466962_0174904_46_483 | 145 |
| 468 | 3300061719 | Ga0466962_0321861 | Ga0466962_0321861_149_586 | 145 |
| 469 | 3300005335 | Ga0070666_11207430 | Ga0070666_112074301 | 146 |
| 470 | 3300005353 | Ga0070669_100552296 | Ga0070669_1005522961 | 146 |
| 471 | 3300005356 | Ga0070674_100411237 | Ga0070674_1004112372 | 146 |
| 472 | 3300005459 | Ga0068867_100317122 | Ga0068867_1003171222 | 146 |
| 473 | 3300005564 | Ga0070664_100172494 | Ga0070664_1001724942 | 146 |
| 474 | 3300005578 | Ga0068854_100215664 | Ga0068854_1002156642 | 146 |
| 475 | 3300005616 | Ga0068852_101115495 | Ga0068852_1011154952 | 146 |
| 476 | 3300005718 | Ga0068866_10948566 | Ga0068866_109485661 | 146 |
| 477 | 3300006237 | Ga0097621_100057470 | Ga0097621_1000574701 | 146 |
| 478 | 3300006881 | Ga0068865_100683255 | Ga0068865_1006832551 | 146 |
| 479 | 3300009094 | Ga0111539_10499309 | Ga0111539_104993092 | 146 |
| 480 | 3300013102 | Ga0157371_10074953 | Ga0157371_100749533 | 146 |
| 481 | 3300013102 | Ga0157371_10823664 | Ga0157371_108236641 | 146 |
| 482 | 3300013104 | Ga0157370_10561249 | Ga0157370_105612492 | 146 |
| 483 | 3300013307 | Ga0157372_10119439 | Ga0157372_101194393 | 146 |
| 484 | 3300014326 | Ga0157380_10807154 | Ga0157380_108071542 | 146 |
| 485 | 3300014969 | Ga0157376_11566372 | Ga0157376_115663721 | 146 |
| 486 | 3300021384 | Ga0213876_10009856 | Ga0213876_100098565 | 146 |
| 487 | 3300025899 | Ga0207642_10509008 | Ga0207642_105090081 | 146 |
| 488 | 3300025912 | Ga0207707_10273100 | Ga0207707_102731002 | 146 |
| 489 | 3300026089 | Ga0207648_10015903 | Ga0207648_100159035 | 146 |
| 490 | 3300026121 | Ga0207683_10350538 | Ga0207683_103505382 | 146 |
| 491 | 3300039437 | Ga0436365_0716477 | Ga0436365_0716477_23332_23772 | 146 |
| 492 | 3300050511 | nmdc:mga08y16_381199_c1 | nmdc:mga08y16_381199_c1_46_486 | 146 |
| 493 | 3300053096 | Ga0500641_0004448 | Ga0500641_0004448_1725_2165 | 146 |
| 494 | 3300053153 | Ga0500616_0020037 | Ga0500616_0020037_2465_2905 | 146 |
| 495 | 3300053156 | Ga0500622_0396846 | Ga0500622_0396846_100_540 | 146 |
| 496 | 3300001979 | JGI24740J21852_10013453 | JGI24740J21852_100134532 | 147 |
| 497 | 3300005327 | Ga0070658_11391461 | Ga0070658_113914612 | 147 |
| 498 | 3300005355 | Ga0070671_101272700 | Ga0070671_1012727001 | 147 |
| 499 | 3300005367 | Ga0070667_100248550 | Ga0070667_1002485502 | 147 |
| 500 | 3300005459 | Ga0068867_100085605 | Ga0068867_1000856052 | 147 |
| 501 | 3300005459 | Ga0068867_100100112 | Ga0068867_1001001123 | 147 |
| 502 | 3300005539 | Ga0068853_100286295 | Ga0068853_1002862952 | 147 |
| 503 | 3300005843 | Ga0068860_101006091 | Ga0068860_1010060911 | 147 |
| 504 | 3300006358 | Ga0068871_101358826 | Ga0068871_1013588262 | 147 |
| 505 | 3300006881 | Ga0068865_100424104 | Ga0068865_1004241042 | 147 |
| 506 | 3300009174 | Ga0105241_10071986 | Ga0105241_100719862 | 147 |
| 507 | 3300009545 | Ga0105237_10001055 | Ga0105237_100010552 | 147 |
| 508 | 3300010375 | Ga0105239_10004772 | Ga0105239_100047726 | 147 |
| 509 | 3300011119 | Ga0105246_10540779 | Ga0105246_105407792 | 147 |
| 510 | 3300013104 | Ga0157370_10187187 | Ga0157370_101871873 | 147 |
| 511 | 3300013306 | Ga0163162_10274546 | Ga0163162_102745462 | 147 |
| 512 | 3300013307 | Ga0157372_10110799 | Ga0157372_101107993 | 147 |
| 513 | 3300025904 | Ga0207647_10204376 | Ga0207647_102043762 | 147 |
| 514 | 3300025909 | Ga0207705_11085444 | Ga0207705_110854442 | 147 |
| 515 | 3300025925 | Ga0207650_11907200 | Ga0207650_119072001 | 147 |
| 516 | 3300026089 | Ga0207648_10025914 | Ga0207648_100259143 | 147 |
| 517 | 3300026089 | Ga0207648_10106303 | Ga0207648_101063032 | 147 |
| 518 | 3300026116 | Ga0207674_10052605 | Ga0207674_100526054 | 147 |
| 519 | 3300031507 | Ga0307509_10024172 | Ga0307509_100241723 | 147 |
| 520 | 3300031616 | Ga0307508_10000407 | Ga0307508_1000040721 | 147 |
| 521 | 3300037471 | Ga0395905_0114020 | Ga0395905_0114020_1007_1450 | 147 |
| 522 | 3300041451 | Ga0451791_1109553 | Ga0451791_1109553_185_631 | 147 |
| 523 | 3300041501 | Ga0451845_0954817 | Ga0451845_0954817_100_624 | 147 |
| 524 | 3300045976 | Ga0466967_0304492 | Ga0466967_0304492_742_1191 | 147 |
| 525 | 3300046694 | Ga0495649_0213785 | Ga0495649_0213785_471_920 | 147 |
| 526 | 3300049822 | Ga0501035_0566459 | Ga0501035_0566459_147_590 | 147 |
| 527 | 3300049823 | Ga0501044_0114455 | Ga0501044_0114455_644_1087 | 147 |
| 528 | 3300053146 | Ga0500588_0045031 | Ga0500588_0045031_639_1088 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2egi-assembly1.cif.gz_C | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.9466 | 4 | 132 |
| 5byu-assembly1.cif.gz_D | crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila | 0.9431 | 5 | 113 |
| 2egi-assembly1.cif.gz_H | crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus | 0.9404 | 4 | 112 |
| 5t06-assembly1.cif.gz_C | crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa | 0.9351 | 4 | 132 |
| 5t07-assembly1.cif.gz_A | crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa | 0.9282 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5byuD00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9431 | 5 | 113 | 3.10.129.10 |
| 2egiH00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9404 | 4 | 112 | 3.10.129.10 |
| 5eo2C01 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9351 | 2 | 133 | 3.10.129.10 |
| 5t06C00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.935 | 4 | 132 | 3.10.129.10 |
| 5byuD00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9256 | 5 | 113 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S0FYZ5-F1-model_v4 | Thioesterase | 0.9914 | 2 | 144 |
GO:0047617
|
| AF-A0A355BQP5-F1-model_v4 | Thioesterase | 0.9883 | 1 | 144 |
GO:0047617
|
| AF-A0A3C0RCH5-F1-model_v4 | Thioesterase | 0.9872 | 1 | 125 |
GO:0047617
|
| AF-A0A3S0FYZ5-F1-model_v4 | Thioesterase | 0.9846 | 2 | 144 |
GO:0047617
|
| AF-A0A0H5DS85-F1-model_v4 | Putative thioesterase | 0.9845 | 1 | 143 |
GO:0047617
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar