F459504

General Info

Members Datasets Scaffolds Average Seq Length
527 259 526 303

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100000030|Ga0070680_10000003051
Length 338
Sequence MQGPLQSPRSALRLRYQRGAARYSGVVPPSKVASMHDAIAALVRDGDTVAIEGFTHLIGFAAGHEIIRQRRRDLTLARLTPDLIYDQMIAAGVARKLIFSWLGNPGVGGLGAIRRRTEVATSGEGKGLPRLELEEYSHFGMVGRYTAGAAGLPFYPIRSYFETDLPKANPRIREVQSPYGDGVVYAVPPLKPDVSIVHAQRADAAGNTQVWGLLGCQKEAAFAADRVIVVVEELVPEEVVRADPNRTIIPGLIVDAVVVEPYGAHPSYVQGAYDRDNRFYLDWDAITRDEDALQAWLREWVYDLGGRADYVEKLGPERVAALKPGSAPSGSVNYGSYT

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
142 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
143 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
144 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 5.31
Rhizosphere 93.74
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10088664 3300003316 Bacteria 2194
2 rootL2_10097823 3300003322 Bacteria 3653
3 Ga0070670_100009741 3300005331 Bacteria 8205
4 Ga0068869_100169357 3300005334 Bacteria 1705
5 Ga0070680_100000030 3300005336 Bacteria 74383
6 Ga0070680_100301204 3300005336 Bacteria 1360
7 Ga0070687_100124201 3300005343 Bacteria 1481
8 Ga0070661_100003381 3300005344 Bacteria 11001
9 Ga0070692_10024339 3300005345 Bacteria 2975
10 Ga0070675_100104840 3300005354 Bacteria 2385
11 Ga0070671_100169208 3300005355 Bacteria 1848
12 Ga0070674_100006197 3300005356 Bacteria 6958
13 Ga0070673_100126019 3300005364 Bacteria 2143
14 Ga0070703_10000022 3300005406 Bacteria 74865
15 Ga0070714_100144923 3300005435 Bacteria 2135
16 Ga0070710_10078469 3300005437 Bacteria 1921
17 Ga0070711_100008497 3300005439 Bacteria 6291
18 Ga0070705_100007619 3300005440 Bacteria 5336
19 Ga0070705_100137533 3300005440 Bacteria 1603
20 Ga0070700_100003796 3300005441 Bacteria 7824
21 Ga0070700_100121674 3300005441 Bacteria 1750
22 Ga0070694_100000211 3300005444 Bacteria 30779
23 Ga0070694_100001905 3300005444 Bacteria 12350
24 Ga0070694_100011981 3300005444 Bacteria 5382
25 Ga0070694_100133392 3300005444 Bacteria 1797
26 Ga0070708_100002785 3300005445 Bacteria 13585
27 Ga0070708_100007507 3300005445 Bacteria 8732
28 Ga0070708_100333137 3300005445 Bacteria 1430
29 Ga0070663_100068147 3300005455 Bacteria 2583
30 Ga0070678_100234609 3300005456 Bacteria 1531
31 Ga0068867_100038449 3300005459 Bacteria 3484
32 Ga0070706_100000084 3300005467 Bacteria 109077
33 Ga0070706_100000241 3300005467 Bacteria 66502
34 Ga0070706_100054147 3300005467 Bacteria 3703
35 Ga0070706_100140973 3300005467 Bacteria 2250
36 Ga0070707_100031518 3300005468 Bacteria 5051
37 Ga0070707_100073750 3300005468 Bacteria 3290
38 Ga0070707_100086487 3300005468 Bacteria 3032
39 Ga0070707_100086998 3300005468 Bacteria 3022
40 Ga0070698_100031498 3300005471 Bacteria 5499
41 Ga0070698_100160538 3300005471 Bacteria 2192
42 Ga0070699_100000297 3300005518 Bacteria 47937
43 Ga0070699_100002624 3300005518 Bacteria 16049
44 Ga0070699_100029430 3300005518 Bacteria 4735
45 Ga0070699_100088337 3300005518 Bacteria 2707
46 Ga0070699_100175884 3300005518 Bacteria 1898
47 Ga0070699_100198683 3300005518 Bacteria 1783
48 Ga0070699_100251941 3300005518 Bacteria 1578
49 Ga0070679_100110686 3300005530 Bacteria 2733
50 Ga0070684_100007384 3300005535 Bacteria 8544
51 Ga0070684_100007610 3300005535 Bacteria 8443
52 Ga0070697_100001269 3300005536 Bacteria 19059
53 Ga0070697_100089596 3300005536 Bacteria 2542
54 Ga0070697_100131699 3300005536 Bacteria 2098
55 Ga0070697_100498056 3300005536 Unclassified 1065
56 Ga0070686_100024401 3300005544 Bacteria 3624
57 Ga0070686_100299635 3300005544 Bacteria 1192
58 Ga0070695_100006419 3300005545 Bacteria 6953
59 Ga0070695_100173751 3300005545 Bacteria 1521
60 Ga0070696_100002574 3300005546 Bacteria 12019
61 Ga0070696_100014263 3300005546 Bacteria 5331
62 Ga0070696_100028809 3300005546 Bacteria 3790
63 Ga0070693_100083503 3300005547 Bacteria 1909
64 Ga0070704_100002379 3300005549 Bacteria 10556
65 Ga0070704_100013579 3300005549 Bacteria 5059
66 Ga0070704_100244765 3300005549 Bacteria 1469
67 Ga0070704_100271455 3300005549 Unclassified 1401
68 Ga0070664_100001249 3300005564 Bacteria 20353
69 Ga0070664_100293131 3300005564 Unclassified 1469
70 Ga0068857_100037611 3300005577 Bacteria 4288
71 Ga0068857_100233313 3300005577 Bacteria 1683
72 Ga0068854_100135097 3300005578 Bacteria 1887
73 Ga0070702_100024738 3300005615 Bacteria 3207
74 Ga0068864_100392477 3300005618 Bacteria 1318
75 Ga0068851_10068463 3300005834 Bacteria 1832
76 Ga0068870_10178567 3300005840 Bacteria 1273
77 Ga0068863_100014385 3300005841 Bacteria 7621
78 Ga0068858_100065249 3300005842 Bacteria 3368
79 Ga0081455_10002154 3300005937 Bacteria 23493
80 Ga0081455_10081484 3300005937 Bacteria 2650
81 Ga0081455_10300832 3300005937 Bacteria 1151
82 Ga0081455_10320111 3300005937 Bacteria 1105
83 Ga0081539_10019193 3300005985 Bacteria 4691
84 Ga0081539_10111667 3300005985 Bacteria 1374
85 Ga0070717_10000328 3300006028 Bacteria 30753
86 Ga0075432_10006414 3300006058 Bacteria 4004
87 Ga0075432_10024525 3300006058 Bacteria 2067
88 Ga0070716_100127020 3300006173 Bacteria 1605
89 Ga0070712_100019823 3300006175 Bacteria 4394
90 Ga0075428_100033932 3300006844 Bacteria 5630
91 Ga0075428_100363260 3300006844 Bacteria 1553
92 Ga0075430_100018933 3300006846 Bacteria 5858
93 Ga0075430_100081627 3300006846 Bacteria 2708
94 Ga0075430_100154002 3300006846 Bacteria 1914
95 Ga0075431_100006171 3300006847 Bacteria 11894
96 Ga0075431_100454980 3300006847 Bacteria 1275
97 Ga0075433_10000465 3300006852 Bacteria 26371
98 Ga0075433_10027429 3300006852 Bacteria 4831
99 Ga0075434_100003896 3300006871 Bacteria 13356
100 Ga0075434_100006419 3300006871 Bacteria 10775
101 Ga0075434_100007988 3300006871 Bacteria 9807
102 Ga0075434_100050372 3300006871 Bacteria 4137
103 Ga0075429_100035368 3300006880 Bacteria 4344
104 Ga0075429_100037293 3300006880 Bacteria 4232
105 Ga0075435_100007206 3300007076 Bacteria 7910
106 Ga0075435_100030552 3300007076 Bacteria 4238
107 Ga0075435_100082131 3300007076 Bacteria 2648
108 Ga0099794_10013212 3300007265 Unclassified 3588
109 Ga0105251_10080201 3300009011 Bacteria 1509
110 Ga0111539_10007309 3300009094 Bacteria 14141
111 Ga0111539_10014780 3300009094 Bacteria 9737
112 Ga0111539_10094418 3300009094 Bacteria 3514
113 Ga0111539_10538262 3300009094 Bacteria 1360
114 Ga0105245_10113716 3300009098 Bacteria 2520
115 Ga0105245_10200454 3300009098 Bacteria 1916
116 Ga0105245_10244660 3300009098 Bacteria 1740
117 Ga0105245_10612492 3300009098 Bacteria 1116
118 Ga0114129_10001747 3300009147 Bacteria 29573
119 Ga0114129_10008786 3300009147 Bacteria 14409
120 Ga0114129_10022300 3300009147 Bacteria 8990
121 Ga0114129_10049579 3300009147 Bacteria 5898
122 Ga0114129_10071601 3300009147 Bacteria 4834
123 Ga0114129_10152156 3300009147 Bacteria 3165
124 Ga0105243_10008392 3300009148 Bacteria 7928
125 Ga0105243_10016233 3300009148 Bacteria 5634
126 Ga0105243_10018461 3300009148 Bacteria 5284
127 Ga0105242_10007209 3300009176 Bacteria 8574
128 Ga0105242_10061923 3300009176 Bacteria 3078
129 Ga0105248_10003747 3300009177 Bacteria 16865
130 Ga0105238_10043441 3300009551 Bacteria 4548
131 Ga0105249_10076435 3300009553 Bacteria 3104
132 Ga0105249_10085210 3300009553 Bacteria 2944
133 Ga0105249_10202745 3300009553 Bacteria 1942
134 Ga0105249_10300435 3300009553 Bacteria 1610
135 Ga0105249_10321225 3300009553 Bacteria 1559
136 Ga0105246_10012684 3300011119 Bacteria 5266
137 Ga0105246_10066555 3300011119 Bacteria 2523
138 Ga0105246_10312703 3300011119 Bacteria 1273
139 Ga0157374_10416230 3300013296 Bacteria 1342
140 Ga0157378_10005101 3300013297 Bacteria 11530
141 Ga0157378_10038838 3300013297 Bacteria 4221
142 Ga0157378_10074298 3300013297 Bacteria 3059
143 Ga0157378_10088150 3300013297 Bacteria 2816
144 Ga0163162_10106168 3300013306 Bacteria 2903
145 Ga0163162_10189387 3300013306 Bacteria 2184
146 Ga0163162_10771264 3300013306 Bacteria 1080
147 Ga0157375_10026278 3300013308 Bacteria 5422
148 Ga0157375_10316075 3300013308 Bacteria 1726
149 Ga0157375_10498151 3300013308 Bacteria 1382
150 Ga0163163_10258620 3300014325 Bacteria 1792
151 Ga0157380_10182798 3300014326 Bacteria 1844
152 Ga0157377_10090911 3300014745 Unclassified 1803
153 Ga0157379_10027289 3300014968 Bacteria 5084
154 Ga0157379_10080085 3300014968 Bacteria 2926
155 Ga0157379_10167357 3300014968 Bacteria 1984
156 Ga0157376_10219574 3300014969 Bacteria 1760
157 Ga0207656_10058191 3300025321 Bacteria 1688
158 Ga0207653_10000100 3300025885 Bacteria 61375
159 Ga0207642_10078625 3300025899 Unclassified 1594
160 Ga0207680_10244894 3300025903 Bacteria 1237
161 Ga0207645_10018713 3300025907 Bacteria 4549
162 Ga0207645_10145283 3300025907 Bacteria 1546
163 Ga0207684_10000040 3300025910 Bacteria 262703
164 Ga0207684_10001387 3300025910 Bacteria 26348
165 Ga0207684_10009116 3300025910 Bacteria 8788
166 Ga0207660_10000001 3300025917 Bacteria 1034169
167 Ga0207662_10062588 3300025918 Bacteria 2236
168 Ga0207646_10005209 3300025922 Bacteria 13741
169 Ga0207646_10011824 3300025922 Bacteria 8427
170 Ga0207646_10016899 3300025922 Bacteria 6838
171 Ga0207646_10021124 3300025922 Bacteria 6021
172 Ga0207646_10110744 3300025922 Bacteria 2463
173 Ga0207646_10198578 3300025922 Bacteria 1811
174 Ga0207650_10006786 3300025925 Bacteria 7807
175 Ga0207650_10053416 3300025925 Bacteria 2995
176 Ga0207659_10022293 3300025926 Bacteria 4215
177 Ga0207687_10245485 3300025927 Bacteria 1421
178 Ga0207644_10158191 3300025931 Bacteria 1759
179 Ga0207690_10323068 3300025932 Bacteria 1213
180 Ga0207706_10170916 3300025933 Bacteria 1910
181 Ga0207686_10087797 3300025934 Bacteria 2046
182 Ga0207709_10045725 3300025935 Bacteria 2653
183 Ga0207670_10177131 3300025936 Bacteria 1603
184 Ga0207669_10011575 3300025937 Bacteria 4299
185 Ga0207665_10134997 3300025939 Bacteria 1755
186 Ga0207689_10181345 3300025942 Bacteria 1736
187 Ga0207689_10223389 3300025942 Bacteria 1556
188 Ga0207679_10025132 3300025945 Bacteria 4092
189 Ga0207712_10020510 3300025961 Bacteria 4328
190 Ga0207712_10223927 3300025961 Bacteria 1505
191 Ga0207640_10295990 3300025981 Unclassified 1278
192 Ga0207678_10107982 3300026067 Bacteria 2374
193 Ga0207708_10000835 3300026075 Bacteria 23253
194 Ga0207641_10279058 3300026088 Bacteria 1571
195 Ga0207641_10348657 3300026088 Bacteria 1410
196 Ga0207648_10100582 3300026089 Bacteria 2533
197 Ga0207648_10310611 3300026089 Bacteria 1415
198 Ga0207676_10026894 3300026095 Bacteria 4279
199 Ga0207676_10122110 3300026095 Bacteria 2199
200 Ga0207676_10293703 3300026095 Bacteria 1481
201 Ga0207674_10001985 3300026116 Bacteria 25920
202 Ga0207674_10219320 3300026116 Bacteria 1850
203 Ga0207674_10503358 3300026116 Bacteria 1170
204 Ga0207675_100033618 3300026118 Bacteria 4778
205 Ga0207675_100049918 3300026118 Bacteria 3904
206 Ga0207675_100089721 3300026118 Bacteria 2889
207 Ga0207683_10034112 3300026121 Bacteria 4422
208 Ga0207683_10146459 3300026121 Bacteria 2130
209 Ga0209998_10002500 3300027717 Bacteria 4188
210 Ga0207428_10000861 3300027907 Bacteria 34178
211 Ga0207428_10029914 3300027907 Bacteria 4505
212 Ga0207428_10104717 3300027907 Bacteria 2183
213 Ga0268264_10106224 3300028381 Bacteria 2450
214 Ga0265318_10008255 3300028577 Bacteria 4647
215 Ga0265318_10014121 3300028577 Bacteria 3357
216 Ga0265318_10037798 3300028577 Bacteria 1848
217 Ga0265323_10038500 3300028653 Bacteria 1748
218 Ga0307513_10241095 3300031456 Bacteria 1613
219 Ga0316575_10046246 3300031665 Bacteria 1728
220 Ga0316579_10001712 3300031691 Bacteria 8062
221 Ga0316576_10079078 3300031727 Bacteria 2437
222 Ga0316576_10170530 3300031727 Bacteria 1642
223 Ga0316576_10179277 3300031727 Bacteria 1598
224 Ga0316578_10072632 3300031728 Bacteria 2038
225 Ga0373926_0000162 3300035083 Bacteria 14602
226 Ga0373941_0026212 3300035115 Bacteria 1691
227 Ga0373945_0001103 3300035116 Bacteria 8141
228 Ga0373946_0000591 3300035171 Bacteria 11982
229 Ga0373946_0022842 3300035171 Bacteria 2439
230 Ga0373955_0018931 3300035172 Bacteria 3434
231 Ga0316574_0037094 3300035398 Bacteria 2988
232 Ga0373924_0000717 3300035410 Bacteria 10342
233 Ga0373935_0118095 3300035692 Bacteria 1768
234 Ga0373927_0001222 3300035695 Bacteria 19504
235 Ga0373947_0080823 3300035725 Bacteria 2011
236 Ga0373937_0146447 3300036401 Bacteria 2211
237 Ga0373937_0617258 3300036401 Bacteria 1029
238 Ga0316582_0027627 3300036647 Unclassified 3430
239 Ga0316582_0034317 3300036647 Bacteria 3124
240 Ga0316584_0164655 3300036712 Bacteria 1647
241 Ga0373925_0000622 3300037068 Bacteria 33799
242 Ga0373925_0042711 3300037068 Bacteria 3364
243 Ga0395899_0078498 3300037312 Bacteria 2406
244 Ga0395900_0011175 3300037418 Bacteria 9179
245 Ga0395900_0117369 3300037418 Bacteria 2730
246 Ga0316581_0004259 3300037588 Unclassified 3637
247 Ga0395901_0023227 3300038443 Bacteria 6356
248 Ga0395901_0322531 3300038443 Bacteria 1598
249 Ga0439461_0024338 3300041410 Bacteria 1224
250 Ga0451853_0005663 3300041512 Bacteria 2683
251 Ga0439448_0027686 3300042005 Bacteria 1788
252 Ga0439450_034724 3300042008 Bacteria 1148
253 Ga0439456_036261 3300042013 Bacteria 1064
254 Ga0450920_002404 3300042122 Bacteria 3179
255 Ga0450910_004740 3300042147 Bacteria 1845
256 Ga0439464_0039177 3300042439 Bacteria 1347
257 Ga0451577_0068992 3300042876 Bacteria 3153
258 Ga0451577_0525241 3300042876 Bacteria 1075
259 Ga0451576_0228463 3300045051 Bacteria 1943
260 Ga0495603_0051510 3300046455 Bacteria 2446
261 Ga0495603_0062785 3300046455 Bacteria 2192
262 Ga0495629_0000008 3300046459 Bacteria 352138
263 Ga0495629_0003782 3300046459 Bacteria 11396
264 Ga0495641_0002464 3300046461 Bacteria 14595
265 Ga0495641_0041683 3300046461 Bacteria 2132
266 Ga0495641_0239963 3300046461 Bacteria 814
267 Ga0495580_0199947 3300046472 Bacteria 1377
268 Ga0495582_0052436 3300046473 Bacteria 2249
269 Ga0495605_0050813 3300046474 Bacteria 2021
270 Ga0495639_0000405 3300046475 Bacteria 20511
271 Ga0495662_0008930 3300046476 Bacteria 4924
272 Ga0495662_0040177 3300046476 Bacteria 2259
273 Ga0495584_0088532 3300046491 Bacteria 1561
274 Ga0495594_0014616 3300046499 Bacteria 4116
275 Ga0495583_0100256 3300046506 Bacteria 1237
276 Ga0495616_0042520 3300046513 Bacteria 2313
277 Ga0495616_0080149 3300046513 Bacteria 1564
278 Ga0495630_0030712 3300046517 Bacteria 3998
279 Ga0495630_0063241 3300046517 Bacteria 2780
280 Ga0495644_0009041 3300046523 Bacteria 3834
281 Ga0495644_0009540 3300046523 Bacteria 3741
282 Ga0495663_0008044 3300046525 Bacteria 2918
283 Ga0495666_0001002 3300046526 Bacteria 13391
284 Ga0495666_0140698 3300046526 Bacteria 1125
285 Ga0495665_0012094 3300046531 Bacteria 4672
286 Ga0495665_0097417 3300046531 Bacteria 1544
287 Ga0495640_0105192 3300046533 Bacteria 1849
288 Ga0495640_0218581 3300046533 Bacteria 1202
289 Ga0495586_0018910 3300046535 Bacteria 3666
290 Ga0495586_0062219 3300046535 Bacteria 2032
291 Ga0495586_0138225 3300046535 Bacteria 1366
292 Ga0495586_0199068 3300046535 Bacteria 1135
293 Ga0495598_0000308 3300046537 Bacteria 8688
294 Ga0495598_0026692 3300046537 Bacteria 1586
295 Ga0495609_0059370 3300046538 Bacteria 1691
296 Ga0495609_0070173 3300046538 Bacteria 1540
297 Ga0495621_0065876 3300046539 Bacteria 1324
298 Ga0495645_0092695 3300046543 Bacteria 2157
299 Ga0495622_0012769 3300046557 Bacteria 3895
300 Ga0495667_0215126 3300046559 Bacteria 1227
301 Ga0495656_0000679 3300046615 Bacteria 10956
302 Ga0495656_0040268 3300046615 Bacteria 1946
303 Ga0495656_0091069 3300046615 Bacteria 1394
304 Ga0495634_0227928 3300046642 Bacteria 1147
305 Ga0495611_0021467 3300046648 Bacteria 2789
306 Ga0495635_0011047 3300046663 Bacteria 6331
307 Ga0495659_0019281 3300046664 Bacteria 2282
308 Ga0495661_0081667 3300046665 Bacteria 1862
309 Ga0495661_0091044 3300046665 Bacteria 1735
310 Ga0495588_0067638 3300046674 Bacteria 1854
311 Ga0495588_0100137 3300046674 Bacteria 1522
312 Ga0495599_0133380 3300046678 Bacteria 1542
313 Ga0495599_0299129 3300046678 Bacteria 972
314 Ga0495647_0002944 3300046681 Bacteria 5397
315 Ga0495658_0027330 3300046683 Bacteria 3069
316 Ga0495658_0127869 3300046683 Bacteria 1544
317 Ga0495613_0014056 3300046689 Bacteria 5939
318 Ga0495613_0051344 3300046689 Bacteria 3039
319 Ga0495624_0017953 3300046690 Bacteria 4740
320 Ga0495670_0037111 3300046691 Bacteria 2429
321 Ga0495670_0126643 3300046691 Bacteria 1330
322 Ga0495589_0055351 3300046794 Bacteria 1955
323 Ga0495600_0010964 3300046809 Bacteria 5639
324 Ga0495660_0146661 3300046810 Bacteria 1169
325 Ga0495581_0007164 3300047315 Bacteria 6457
326 Ga0495581_0107778 3300047315 Bacteria 1619
327 Ga0495636_0066386 3300047318 Bacteria 1534
328 Ga0495674_0005118 3300047319 Bacteria 12594
329 Ga0495674_0186783 3300047319 Bacteria 1724
330 Ga0495676_0001233 3300047321 Bacteria 21933
331 Ga0495676_0085545 3300047321 Bacteria 2375
332 Ga0495680_0001843 3300047322 Bacteria 22349
333 Ga0495680_0004136 3300047322 Bacteria 13947
334 Ga0495677_0024097 3300047445 Unclassified 2208
335 Ga0495684_0005538 3300047471 Bacteria 9840
336 Ga0495593_0008182 3300047673 Bacteria 6084
337 Ga0495614_0000927 3300048089 Bacteria 12494
338 Ga0496100_0017319 3300048903 Bacteria 4250
339 Ga0496101_0083713 3300048904 Bacteria 2362
340 Ga0496102_0024405 3300048905 Bacteria 5375
341 Ga0496102_0025334 3300048905 Bacteria 5280
342 Ga0496103_0262681 3300048906 Bacteria 1111
343 Ga0496104_0033281 3300048907 Bacteria 4801
344 Ga0496104_0085433 3300048907 Bacteria 3012
345 Ga0496104_0316821 3300048907 Bacteria 1473
346 Ga0496106_0009574 3300048909 Bacteria 7153
347 Ga0496106_0149829 3300048909 Bacteria 1840
348 Ga0496106_0243289 3300048909 Bacteria 1438
349 Ga0496107_0068806 3300048910 Bacteria 2569
350 Ga0496108_0057588 3300048911 Bacteria 3265
351 Ga0496108_0057788 3300048911 Bacteria 3259
352 Ga0496108_0123601 3300048911 Bacteria 2221
353 Ga0496109_0019137 3300048912 Bacteria 6031
354 Ga0496109_0034181 3300048912 Bacteria 4576
355 Ga0496109_0040463 3300048912 Bacteria 4222
356 Ga0496109_0184606 3300048912 Bacteria 1960
357 Ga0496109_0428136 3300048912 Bacteria 1250
358 Ga0496110_0072546 3300048913 Bacteria 3055
359 Ga0496110_0159657 3300048913 Bacteria 2043
360 Ga0496111_0004208 3300048914 Bacteria 9062
361 Ga0496112_0015922 3300048915 Bacteria 7027
362 Ga0496112_0774210 3300048915 Unclassified 885
363 Ga0496113_0011449 3300048916 Bacteria 5918
364 Ga0496113_0055267 3300048916 Bacteria 2975
365 Ga0496113_0159138 3300048916 Bacteria 1785
366 Ga0501031_0000828 3300049568 Bacteria 18618
367 Ga0501031_0013083 3300049568 Bacteria 5414
368 Ga0501031_0016751 3300049568 Bacteria 4760
369 Ga0501032_0014010 3300049569 Bacteria 5688
370 Ga0501032_0174377 3300049569 Bacteria 1409
371 Ga0501033_0020786 3300049570 Bacteria 4958
372 Ga0501034_0022972 3300049571 Bacteria 6355
373 Ga0501036_0010201 3300049572 Bacteria 7742
374 Ga0501036_0138031 3300049572 Bacteria 2057
375 Ga0501037_0088385 3300049573 Bacteria 2242
376 Ga0501037_0148873 3300049573 Bacteria 1674
377 Ga0501037_0149816 3300049573 Bacteria 1668
378 Ga0501038_0010395 3300049574 Bacteria 8508
379 Ga0501038_0039849 3300049574 Bacteria 4108
380 Ga0501038_0069272 3300049574 Bacteria 2997
381 Ga0501039_0003953 3300049575 Bacteria 11139
382 Ga0501039_0011349 3300049575 Bacteria 6786
383 Ga0501039_0013475 3300049575 Bacteria 6252
384 Ga0501039_0019849 3300049575 Bacteria 5151
385 Ga0501039_0042511 3300049575 Bacteria 3510
386 Ga0501039_0294293 3300049575 Bacteria 1276
387 Ga0501039_0348181 3300049575 Bacteria 1164
388 Ga0501040_0008616 3300049576 Bacteria 6622
389 Ga0501040_0009310 3300049576 Bacteria 6397
390 Ga0501040_0090427 3300049576 Bacteria 2127
391 Ga0501040_0156540 3300049576 Bacteria 1609
392 Ga0501041_0005561 3300049577 Bacteria 7369
393 Ga0501041_0018720 3300049577 Bacteria 4124
394 Ga0501041_0051566 3300049577 Bacteria 2507
395 Ga0501041_0124450 3300049577 Bacteria 1604
396 Ga0501042_0013200 3300049578 Bacteria 5624
397 Ga0501042_0013451 3300049578 Bacteria 5570
398 Ga0501042_0038019 3300049578 Bacteria 3417
399 Ga0501042_0051913 3300049578 Bacteria 2924
400 Ga0501042_0097203 3300049578 Bacteria 2116
401 Ga0501042_0108496 3300049578 Bacteria 1998
402 Ga0501043_0044545 3300049579 Bacteria 3488
403 Ga0501043_0073804 3300049579 Bacteria 2679
404 Ga0501046_0015258 3300049580 Bacteria 6461
405 Ga0501046_0024580 3300049580 Bacteria 4940
406 Ga0501046_0066063 3300049580 Bacteria 2820
407 Ga0501047_0023837 3300049581 Bacteria 5877
408 Ga0501047_0334856 3300049581 Bacteria 1352
409 Ga0501048_0011368 3300049582 Bacteria 6639
410 Ga0501048_0026827 3300049582 Bacteria 4192
411 Ga0501048_0031525 3300049582 Bacteria 3834
412 Ga0501048_0049071 3300049582 Bacteria 3009
413 Ga0501048_0070173 3300049582 Bacteria 2475
414 Ga0501068_0003372 3300049584 Bacteria 8585
415 Ga0501068_0024833 3300049584 Bacteria 3521
416 Ga0501068_0044989 3300049584 Bacteria 2659
417 Ga0501069_0000493 3300049585 Bacteria 17999
418 Ga0501069_0007299 3300049585 Bacteria 5797
419 Ga0501070_0016004 3300049586 Bacteria 6303
420 Ga0501070_0053854 3300049586 Bacteria 3336
421 Ga0501071_0002638 3300049587 Bacteria 10978
422 Ga0501071_0003029 3300049587 Bacteria 10406
423 Ga0501071_0004392 3300049587 Bacteria 8946
424 Ga0501071_0007646 3300049587 Bacteria 7121
425 Ga0501071_0067804 3300049587 Bacteria 2595
426 Ga0501071_0242397 3300049587 Bacteria 1359
427 Ga0501072_0003449 3300049588 Bacteria 11909
428 Ga0501072_0004158 3300049588 Bacteria 10957
429 Ga0501072_0010454 3300049588 Bacteria 7069
430 Ga0501072_0016680 3300049588 Bacteria 5642
431 Ga0501072_0064262 3300049588 Bacteria 2894
432 Ga0501072_0184185 3300049588 Bacteria 1666
433 Ga0501073_0017064 3300049589 Bacteria 5258
434 Ga0501074_0007708 3300049590 Bacteria 7798
435 Ga0501074_0017148 3300049590 Bacteria 5253
436 Ga0501074_0046032 3300049590 Bacteria 3155
437 Ga0501074_0082172 3300049590 Bacteria 2310
438 Ga0501075_0012193 3300049591 Bacteria 6101
439 Ga0501075_0021128 3300049591 Bacteria 4742
440 Ga0501075_0039794 3300049591 Bacteria 3519
441 Ga0501075_0190392 3300049591 Bacteria 1565
442 Ga0501076_0003817 3300049592 Bacteria 10613
443 Ga0501076_0010467 3300049592 Bacteria 6884
444 Ga0501076_0011360 3300049592 Bacteria 6630
445 Ga0501076_0019823 3300049592 Bacteria 5144
446 Ga0501076_0045619 3300049592 Bacteria 3460
447 Ga0501076_0227550 3300049592 Bacteria 1524
448 Ga0501076_0370178 3300049592 Bacteria 1177
449 Ga0501077_0013620 3300049593 Bacteria 5098
450 Ga0501077_0015639 3300049593 Bacteria 4779
451 Ga0501077_0054892 3300049593 Bacteria 2530
452 Ga0501077_0217456 3300049593 Bacteria 1214
453 Ga0501079_0002941 3300049741 Bacteria 12450
454 Ga0501079_0026035 3300049741 Bacteria 4485
455 Ga0501079_0032783 3300049741 Bacteria 3995
456 Ga0501079_0114089 3300049741 Bacteria 2100
457 Ga0501079_0141513 3300049741 Bacteria 1874
458 Ga0501079_0149518 3300049741 Bacteria 1820
459 Ga0501080_0003053 3300049742 Bacteria 14782
460 Ga0501080_0146871 3300049742 Bacteria 2180
461 Ga0501080_0193579 3300049742 Bacteria 1868
462 Ga0501080_0600558 3300049742 Bacteria 977
463 Ga0501081_0005930 3300049743 Bacteria 7908
464 Ga0501081_0008823 3300049743 Bacteria 6553
465 Ga0501081_0013632 3300049743 Bacteria 5343
466 Ga0501081_0257181 3300049743 Bacteria 1275
467 Ga0501083_0045796 3300049744 Bacteria 2958
468 Ga0501083_0186003 3300049744 Bacteria 1356
469 Ga0501083_0245638 3300049744 Bacteria 1165
470 Ga0501035_0013751 3300049822 Bacteria 7471
471 Ga0501035_0041543 3300049822 Bacteria 4152
472 Ga0501035_0125007 3300049822 Bacteria 2246
473 Ga0501035_0172856 3300049822 Bacteria 1865
474 Ga0501035_0302847 3300049822 Bacteria 1346
475 Ga0501044_0140141 3300049823 Bacteria 2407
476 Ga0501045_0002635 3300049824 Bacteria 12223
477 Ga0501045_0005544 3300049824 Bacteria 8729
478 Ga0501045_0008834 3300049824 Bacteria 7038
479 Ga0501045_0081580 3300049824 Bacteria 2385
480 Ga0501045_0110889 3300049824 Bacteria 2034
481 nmdc:mga05p37_141740_c1 3300050507 Bacteria 2945
482 nmdc:mga05p37_142_c1 3300050507 Bacteria 67494
483 nmdc:mga05p37_17779_c1 3300050507 Bacteria 8578
484 nmdc:mga05p37_5789_c1 3300050507 Bacteria 14529
485 nmdc:mga09592_135571_c1 3300050508 Bacteria 2120
486 nmdc:mga09592_22289_c1 3300050508 Bacteria 5226
487 nmdc:mga09592_31270_c1 3300050508 Bacteria 4435
488 nmdc:mga09592_69524_c1 3300050508 Bacteria 2987
489 nmdc:mga0qj67_193981_c1 3300050509 Bacteria 1650
490 nmdc:mga08y16_112205_c1 3300050511 Bacteria 2838
491 nmdc:mga08y16_26517_c1 3300050511 Bacteria 6108
492 nmdc:mga0n895_167812_c1 3300050512 Bacteria 2227
493 nmdc:mga0n895_24323_c1 3300050512 Bacteria 5707
494 nmdc:mga0n895_65594_c1 3300050512 Bacteria 3594
495 nmdc:mga0n895_7681_c1 3300050512 Bacteria 9276
496 nmdc:mga0rr50_15335_c1 3300050513 Bacteria 5056
497 nmdc:mga08x19_246271_c1 3300050514 Bacteria 1233
498 nmdc:mga0a205_211847_c1 3300050515 Bacteria 1826
499 nmdc:mga0a205_40099_c1 3300050515 Bacteria 4508
500 nmdc:mga0a205_63351_c1 3300050515 Bacteria 3572
501 Ga0495601_0007556 3300053077 Bacteria 6379
502 Ga0495601_0150572 3300053077 Bacteria 1519
503 Ga0495655_0011246 3300053083 Bacteria 1793
504 Ga0495595_0004336 3300053084 Bacteria 5710
505 Ga0495619_0019049 3300053085 Bacteria 4359
506 Ga0495619_0102537 3300053085 Bacteria 1949
507 Ga0495619_0174663 3300053085 Bacteria 1486
508 Ga0500566_0040300 3300053094 Bacteria 2699
509 Ga0501084_0009591 3300054114 Bacteria 8008
510 Ga0501084_0027237 3300054114 Bacteria 4777
511 Ga0501084_0036482 3300054114 Bacteria 4106
512 Ga0501084_0139852 3300054114 Bacteria 2038
513 Ga0501084_0188065 3300054114 Bacteria 1743
514 Ga0501084_0203216 3300054114 Bacteria 1672
515 Ga0501084_0594853 3300054114 Bacteria 935
516 Ga0501082_0007933 3300060353 Bacteria 9172
517 Ga0501082_0017403 3300060353 Bacteria 6192
518 Ga0501082_0021966 3300060353 Bacteria 5502
519 Ga0501082_0055068 3300060353 Bacteria 3427
520 Ga0501082_0085767 3300060353 Bacteria 2716
521 Ga0501082_0193383 3300060353 Bacteria 1769
522 Ga0530510_0003135 3300061734 Bacteria 11352
523 Ga0530510_0005355 3300061734 Bacteria 8877
524 Ga0530510_0011644 3300061734 Bacteria 6173
525 Ga0530510_0082592 3300061734 Bacteria 2339
526 Ga0530510_0136373 3300061734 Bacteria 1807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0239963 Ga0495641_0239963_36_803 246
2 3300048915 Ga0496112_0774210 Ga0496112_0774210_17_784 246
3 3300050514 nmdc:mga08x19_246271_c1 nmdc:mga08x19_246271_c1_50_817 246
4 3300054114 Ga0501084_0594853 Ga0501084_0594853_17_781 246
5 3300014969 Ga0157376_10219574 Ga0157376_102195742 247
6 3300006028 Ga0070717_10000328 Ga0070717_100003283 260
7 3300005518 Ga0070699_100002624 Ga0070699_1000026245 275
8 3300009147 Ga0114129_10049579 Ga0114129_100495792 275
9 3300050507 nmdc:mga05p37_17779_c1 nmdc:mga05p37_17779_c1_3458_4357 275
10 3300006846 Ga0075430_100081627 Ga0075430_1000816273 277
11 3300046678 Ga0495599_0299129 Ga0495599_0299129_102_962 277
12 3300005440 Ga0070705_100007619 Ga0070705_1000076193 278
13 3300005468 Ga0070707_100086998 Ga0070707_1000869982 278
14 3300005546 Ga0070696_100028809 Ga0070696_1000288093 278
15 3300049574 Ga0501038_0069272 Ga0501038_0069272_1419_2345 279
16 3300049575 Ga0501039_0294293 Ga0501039_0294293_309_1235 279
17 3300049577 Ga0501041_0124450 Ga0501041_0124450_314_1240 279
18 3300049582 Ga0501048_0070173 Ga0501048_0070173_67_993 279
19 3300049592 Ga0501076_0010467 Ga0501076_0010467_5759_6685 279
20 3300049593 Ga0501077_0054892 Ga0501077_0054892_348_1274 279
21 3300049741 Ga0501079_0032783 Ga0501079_0032783_1250_2176 279
22 3300049742 Ga0501080_0193579 Ga0501080_0193579_91_1017 279
23 3300054114 Ga0501084_0027237 Ga0501084_0027237_1146_2072 279
24 3300026116 Ga0207674_10503358 Ga0207674_105033582 280
25 3300054114 Ga0501084_0188065 Ga0501084_0188065_12_926 281
26 3300005344 Ga0070661_100003381 Ga0070661_10000338110 282
27 3300005441 Ga0070700_100003796 Ga0070700_1000037966 282
28 3300005455 Ga0070663_100068147 Ga0070663_1000681473 282
29 3300005518 Ga0070699_100029430 Ga0070699_1000294305 282
30 3300005535 Ga0070684_100007610 Ga0070684_1000076104 282
31 3300005564 Ga0070664_100001249 Ga0070664_10000124922 282
32 3300005577 Ga0068857_100037611 Ga0068857_1000376114 282
33 3300005840 Ga0068870_10178567 Ga0068870_101785672 282
34 3300005841 Ga0068863_100014385 Ga0068863_1000143852 282
35 3300009011 Ga0105251_10080201 Ga0105251_100802012 282
36 3300025925 Ga0207650_10006786 Ga0207650_100067868 282
37 3300025926 Ga0207659_10022293 Ga0207659_100222934 282
38 3300025945 Ga0207679_10025132 Ga0207679_100251324 282
39 3300026067 Ga0207678_10107982 Ga0207678_101079824 282
40 3300026075 Ga0207708_10000835 Ga0207708_1000083517 282
41 3300026088 Ga0207641_10348657 Ga0207641_103486572 282
42 3300026095 Ga0207676_10026894 Ga0207676_100268944 282
43 3300026116 Ga0207674_10001985 Ga0207674_100019859 282
44 3300048916 Ga0496113_0159138 Ga0496113_0159138_290_1186 282
45 3300049573 Ga0501037_0148873 Ga0501037_0148873_432_1355 282
46 3300049587 Ga0501071_0004392 Ga0501071_0004392_7724_8650 282
47 3300049590 Ga0501074_0046032 Ga0501074_0046032_169_1092 282
48 3300049593 Ga0501077_0015639 Ga0501077_0015639_2177_3100 282
49 3300005518 Ga0070699_100088337 Ga0070699_1000883372 283
50 3300049588 Ga0501072_0184185 Ga0501072_0184185_219_1139 283
51 3300049568 Ga0501031_0016751 Ga0501031_0016751_86_1003 284
52 3300049569 Ga0501032_0014010 Ga0501032_0014010_686_1603 284
53 3300049570 Ga0501033_0020786 Ga0501033_0020786_2101_3018 284
54 3300049571 Ga0501034_0022972 Ga0501034_0022972_319_1236 284
55 3300049572 Ga0501036_0138031 Ga0501036_0138031_425_1342 284
56 3300049573 Ga0501037_0088385 Ga0501037_0088385_482_1399 284
57 3300049575 Ga0501039_0042511 Ga0501039_0042511_653_1570 284
58 3300049576 Ga0501040_0009310 Ga0501040_0009310_559_1476 284
59 3300049577 Ga0501041_0051566 Ga0501041_0051566_471_1388 284
60 3300049578 Ga0501042_0051913 Ga0501042_0051913_86_1003 284
61 3300049579 Ga0501043_0044545 Ga0501043_0044545_471_1388 284
62 3300049581 Ga0501047_0023837 Ga0501047_0023837_3977_4894 284
63 3300049582 Ga0501048_0026827 Ga0501048_0026827_1941_2858 284
64 3300049584 Ga0501068_0003372 Ga0501068_0003372_2229_3146 284
65 3300049585 Ga0501069_0000493 Ga0501069_0000493_1131_2048 284
66 3300049586 Ga0501070_0053854 Ga0501070_0053854_319_1236 284
67 3300049587 Ga0501071_0067804 Ga0501071_0067804_1120_2037 284
68 3300049589 Ga0501073_0017064 Ga0501073_0017064_3587_4504 284
69 3300049590 Ga0501074_0017148 Ga0501074_0017148_4251_5168 284
70 3300049591 Ga0501075_0021128 Ga0501075_0021128_3605_4522 284
71 3300049592 Ga0501076_0045619 Ga0501076_0045619_86_1003 284
72 3300049741 Ga0501079_0114089 Ga0501079_0114089_64_981 284
73 3300049743 Ga0501081_0013632 Ga0501081_0013632_3179_4096 284
74 3300049744 Ga0501083_0045796 Ga0501083_0045796_1922_2839 284
75 3300049822 Ga0501035_0172856 Ga0501035_0172856_296_1213 284
76 3300049823 Ga0501044_0140141 Ga0501044_0140141_244_1161 284
77 3300060353 Ga0501082_0055068 Ga0501082_0055068_214_1131 284
78 3300005445 Ga0070708_100333137 Ga0070708_1003331371 286
79 3300005549 Ga0070704_100013579 Ga0070704_1000135795 286
80 3300025922 Ga0207646_10021124 Ga0207646_100211244 286
81 iso_pu_bacteria 8057568493 8057572853 286
82 3300046559 Ga0495667_0215126 Ga0495667_0215126_123_1013 287
83 3300009147 Ga0114129_10001747 Ga0114129_100017476 288
84 3300050507 nmdc:mga05p37_142_c1 nmdc:mga05p37_142_c1_57738_58658 288
85 3300046535 Ga0495586_0062219 Ga0495586_0062219_28_918 289
86 3300046689 Ga0495613_0051344 Ga0495613_0051344_1794_2684 289
87 3300048907 Ga0496104_0033281 Ga0496104_0033281_591_1538 289
88 3300048913 Ga0496110_0159657 Ga0496110_0159657_176_1123 289
89 3300005331 Ga0070670_100009741 Ga0070670_1000097418 290
90 3300005334 Ga0068869_100169357 Ga0068869_1001693572 290
91 3300005336 Ga0070680_100000030 Ga0070680_10000003051 290
92 3300005336 Ga0070680_100301204 Ga0070680_1003012041 290
93 3300005343 Ga0070687_100124201 Ga0070687_1001242012 290
94 3300005345 Ga0070692_10024339 Ga0070692_100243393 290
95 3300005354 Ga0070675_100104840 Ga0070675_1001048401 290
96 3300005355 Ga0070671_100169208 Ga0070671_1001692082 290
97 3300005356 Ga0070674_100006197 Ga0070674_1000061974 290
98 3300005364 Ga0070673_100126019 Ga0070673_1001260193 290
99 3300005406 Ga0070703_10000022 Ga0070703_1000002265 290
100 3300005437 Ga0070710_10078469 Ga0070710_100784693 290
101 3300005439 Ga0070711_100008497 Ga0070711_1000084976 290
102 3300005440 Ga0070705_100137533 Ga0070705_1001375332 290
103 3300005441 Ga0070700_100121674 Ga0070700_1001216742 290
104 3300005444 Ga0070694_100001905 Ga0070694_1000019054 290
105 3300005444 Ga0070694_100011981 Ga0070694_1000119813 290
106 3300005444 Ga0070694_100133392 Ga0070694_1001333921 290
107 3300005445 Ga0070708_100002785 Ga0070708_10000278513 290
108 3300005456 Ga0070678_100234609 Ga0070678_1002346092 290
109 3300005459 Ga0068867_100038449 Ga0068867_1000384495 290
110 3300005467 Ga0070706_100000084 Ga0070706_1000000849 290
111 3300005467 Ga0070706_100000241 Ga0070706_10000024110 290
112 3300005468 Ga0070707_100073750 Ga0070707_1000737504 290
113 3300005471 Ga0070698_100031498 Ga0070698_1000314984 290
114 3300005471 Ga0070698_100160538 Ga0070698_1001605383 290
115 3300005518 Ga0070699_100198683 Ga0070699_1001986832 290
116 3300005518 Ga0070699_100251941 Ga0070699_1002519412 290
117 3300005536 Ga0070697_100089596 Ga0070697_1000895962 290
118 3300005544 Ga0070686_100024401 Ga0070686_1000244013 290
119 3300005544 Ga0070686_100299635 Ga0070686_1002996351 290
120 3300005545 Ga0070695_100173751 Ga0070695_1001737512 290
121 3300005546 Ga0070696_100002574 Ga0070696_1000025746 290
122 3300005546 Ga0070696_100014263 Ga0070696_1000142635 290
123 3300005547 Ga0070693_100083503 Ga0070693_1000835032 290
124 3300005549 Ga0070704_100002379 Ga0070704_1000023793 290
125 3300005549 Ga0070704_100244765 Ga0070704_1002447652 290
126 3300005549 Ga0070704_100271455 Ga0070704_1002714552 290
127 3300005577 Ga0068857_100233313 Ga0068857_1002333132 290
128 3300005578 Ga0068854_100135097 Ga0068854_1001350972 290
129 3300005618 Ga0068864_100392477 Ga0068864_1003924772 290
130 3300005834 Ga0068851_10068463 Ga0068851_100684631 290
131 3300005842 Ga0068858_100065249 Ga0068858_1000652493 290
132 3300005937 Ga0081455_10002154 Ga0081455_100021543 290
133 3300005937 Ga0081455_10081484 Ga0081455_100814842 290
134 3300005937 Ga0081455_10300832 Ga0081455_103008321 290
135 3300005937 Ga0081455_10320111 Ga0081455_103201111 290
136 3300005985 Ga0081539_10019193 Ga0081539_100191932 290
137 3300005985 Ga0081539_10111667 Ga0081539_101116672 290
138 3300006058 Ga0075432_10006414 Ga0075432_100064142 290
139 3300006058 Ga0075432_10024525 Ga0075432_100245253 290
140 3300006173 Ga0070716_100127020 Ga0070716_1001270202 290
141 3300006175 Ga0070712_100019823 Ga0070712_1000198234 290
142 3300006844 Ga0075428_100033932 Ga0075428_1000339322 290
143 3300006844 Ga0075428_100363260 Ga0075428_1003632602 290
144 3300006846 Ga0075430_100018933 Ga0075430_1000189334 290
145 3300006846 Ga0075430_100154002 Ga0075430_1001540022 290
146 3300006847 Ga0075431_100006171 Ga0075431_10000617112 290
147 3300006847 Ga0075431_100454980 Ga0075431_1004549801 290
148 3300006852 Ga0075433_10000465 Ga0075433_1000046521 290
149 3300006852 Ga0075433_10027429 Ga0075433_100274294 290
150 3300006871 Ga0075434_100003896 Ga0075434_1000038966 290
151 3300006871 Ga0075434_100006419 Ga0075434_1000064195 290
152 3300006871 Ga0075434_100007988 Ga0075434_1000079887 290
153 3300006871 Ga0075434_100050372 Ga0075434_1000503724 290
154 3300006880 Ga0075429_100035368 Ga0075429_1000353684 290
155 3300007076 Ga0075435_100007206 Ga0075435_1000072065 290
156 3300007076 Ga0075435_100030552 Ga0075435_1000305525 290
157 3300007076 Ga0075435_100082131 Ga0075435_1000821312 290
158 3300009094 Ga0111539_10007309 Ga0111539_100073098 290
159 3300009094 Ga0111539_10094418 Ga0111539_100944184 290
160 3300009094 Ga0111539_10538262 Ga0111539_105382622 290
161 3300009098 Ga0105245_10113716 Ga0105245_101137162 290
162 3300009098 Ga0105245_10200454 Ga0105245_102004543 290
163 3300009098 Ga0105245_10612492 Ga0105245_106124922 290
164 3300009147 Ga0114129_10022300 Ga0114129_100223003 290
165 3300009147 Ga0114129_10071601 Ga0114129_100716015 290
166 3300009147 Ga0114129_10152156 Ga0114129_101521564 290
167 3300009148 Ga0105243_10008392 Ga0105243_100083924 290
168 3300009148 Ga0105243_10016233 Ga0105243_100162336 290
169 3300009148 Ga0105243_10018461 Ga0105243_100184617 290
170 3300009176 Ga0105242_10007209 Ga0105242_1000720912 290
171 3300009177 Ga0105248_10003747 Ga0105248_1000374720 290
172 3300009551 Ga0105238_10043441 Ga0105238_100434412 290
173 3300009553 Ga0105249_10076435 Ga0105249_100764353 290
174 3300009553 Ga0105249_10085210 Ga0105249_100852102 290
175 3300009553 Ga0105249_10300435 Ga0105249_103004352 290
176 3300009553 Ga0105249_10321225 Ga0105249_103212252 290
177 3300011119 Ga0105246_10066555 Ga0105246_100665552 290
178 3300011119 Ga0105246_10312703 Ga0105246_103127032 290
179 3300013296 Ga0157374_10416230 Ga0157374_104162302 290
180 3300013297 Ga0157378_10005101 Ga0157378_1000510110 290
181 3300013297 Ga0157378_10038838 Ga0157378_100388382 290
182 3300013297 Ga0157378_10088150 Ga0157378_100881504 290
183 3300013306 Ga0163162_10106168 Ga0163162_101061684 290
184 3300013306 Ga0163162_10189387 Ga0163162_101893872 290
185 3300013306 Ga0163162_10771264 Ga0163162_107712642 290
186 3300013308 Ga0157375_10026278 Ga0157375_100262784 290
187 3300013308 Ga0157375_10316075 Ga0157375_103160752 290
188 3300013308 Ga0157375_10498151 Ga0157375_104981512 290
189 3300014326 Ga0157380_10182798 Ga0157380_101827982 290
190 3300014968 Ga0157379_10027289 Ga0157379_100272892 290
191 3300025321 Ga0207656_10058191 Ga0207656_100581912 290
192 3300025885 Ga0207653_10000100 Ga0207653_1000010065 290
193 3300025899 Ga0207642_10078625 Ga0207642_100786252 290
194 3300025907 Ga0207645_10018713 Ga0207645_100187136 290
195 3300025910 Ga0207684_10000040 Ga0207684_10000040186 290
196 3300025910 Ga0207684_10001387 Ga0207684_1000138718 290
197 3300025917 Ga0207660_10000001 Ga0207660_10000001938 290
198 3300025918 Ga0207662_10062588 Ga0207662_100625882 290
199 3300025922 Ga0207646_10005209 Ga0207646_1000520913 290
200 3300025922 Ga0207646_10198578 Ga0207646_101985782 290
201 3300025925 Ga0207650_10053416 Ga0207650_100534163 290
202 3300025927 Ga0207687_10245485 Ga0207687_102454852 290
203 3300025931 Ga0207644_10158191 Ga0207644_101581912 290
204 3300025932 Ga0207690_10323068 Ga0207690_103230682 290
205 3300025933 Ga0207706_10170916 Ga0207706_101709162 290
206 3300025935 Ga0207709_10045725 Ga0207709_100457253 290
207 3300025936 Ga0207670_10177131 Ga0207670_101771312 290
208 3300025937 Ga0207669_10011575 Ga0207669_100115755 290
209 3300025939 Ga0207665_10134997 Ga0207665_101349972 290
210 3300025942 Ga0207689_10223389 Ga0207689_102233892 290
211 3300025961 Ga0207712_10020510 Ga0207712_100205105 290
212 3300025961 Ga0207712_10223927 Ga0207712_102239272 290
213 3300026089 Ga0207648_10100582 Ga0207648_101005822 290
214 3300026089 Ga0207648_10310611 Ga0207648_103106112 290
215 3300026095 Ga0207676_10122110 Ga0207676_101221104 290
216 3300026095 Ga0207676_10293703 Ga0207676_102937032 290
217 3300026116 Ga0207674_10219320 Ga0207674_102193202 290
218 3300026118 Ga0207675_100033618 Ga0207675_1000336186 290
219 3300026118 Ga0207675_100049918 Ga0207675_1000499184 290
220 3300026118 Ga0207675_100089721 Ga0207675_1000897212 290
221 3300026121 Ga0207683_10146459 Ga0207683_101464593 290
222 3300027907 Ga0207428_10000861 Ga0207428_1000086126 290
223 3300027907 Ga0207428_10029914 Ga0207428_100299143 290
224 3300027907 Ga0207428_10104717 Ga0207428_101047172 290
225 3300028381 Ga0268264_10106224 Ga0268264_101062242 290
226 3300035083 Ga0373926_0000162 Ga0373926_0000162_11269_12192 290
227 3300035115 Ga0373941_0026212 Ga0373941_0026212_411_1343 290
228 3300035116 Ga0373945_0001103 Ga0373945_0001103_7028_7927 290
229 3300035171 Ga0373946_0000591 Ga0373946_0000591_911_1810 290
230 3300035172 Ga0373955_0018931 Ga0373955_0018931_2432_3355 290
231 3300035410 Ga0373924_0000717 Ga0373924_0000717_684_1607 290
232 3300035692 Ga0373935_0118095 Ga0373935_0118095_746_1645 290
233 3300035695 Ga0373927_0001222 Ga0373927_0001222_10764_11687 290
234 3300035725 Ga0373947_0080823 Ga0373947_0080823_202_1101 290
235 3300037312 Ga0395899_0078498 Ga0395899_0078498_954_1850 290
236 3300037418 Ga0395900_0011175 Ga0395900_0011175_6209_7105 290
237 3300037418 Ga0395900_0117369 Ga0395900_0117369_1249_2145 290
238 3300038443 Ga0395901_0023227 Ga0395901_0023227_4573_5469 290
239 3300038443 Ga0395901_0322531 Ga0395901_0322531_233_1153 290
240 3300041410 Ga0439461_0024338 Ga0439461_0024338_40_963 290
241 3300042005 Ga0439448_0027686 Ga0439448_0027686_803_1699 290
242 3300042008 Ga0439450_034724 Ga0439450_034724_154_1050 290
243 3300042013 Ga0439456_036261 Ga0439456_036261_16_912 290
244 3300042122 Ga0450920_002404 Ga0450920_002404_28_990 290
245 3300042147 Ga0450910_004740 Ga0450910_004740_252_1214 290
246 3300042439 Ga0439464_0039177 Ga0439464_0039177_26_922 290
247 3300042876 Ga0451577_0525241 Ga0451577_0525241_63_1001 290
248 3300046455 Ga0495603_0051510 Ga0495603_0051510_1206_2105 290
249 3300046455 Ga0495603_0062785 Ga0495603_0062785_1281_2180 290
250 3300046459 Ga0495629_0003782 Ga0495629_0003782_22_921 290
251 3300046461 Ga0495641_0002464 Ga0495641_0002464_3248_4171 290
252 3300046461 Ga0495641_0041683 Ga0495641_0041683_155_1054 290
253 3300046473 Ga0495582_0052436 Ga0495582_0052436_1277_2176 290
254 3300046474 Ga0495605_0050813 Ga0495605_0050813_1033_1932 290
255 3300046476 Ga0495662_0008930 Ga0495662_0008930_3396_4319 290
256 3300046476 Ga0495662_0040177 Ga0495662_0040177_988_1887 290
257 3300046491 Ga0495584_0088532 Ga0495584_0088532_79_999 290
258 3300046499 Ga0495594_0014616 Ga0495594_0014616_2610_3533 290
259 3300046506 Ga0495583_0100256 Ga0495583_0100256_151_1047 290
260 3300046513 Ga0495616_0042520 Ga0495616_0042520_54_971 290
261 3300046513 Ga0495616_0080149 Ga0495616_0080149_26_922 290
262 3300046517 Ga0495630_0030712 Ga0495630_0030712_3026_3925 290
263 3300046523 Ga0495644_0009041 Ga0495644_0009041_1813_2730 290
264 3300046523 Ga0495644_0009540 Ga0495644_0009540_1631_2548 290
265 3300046525 Ga0495663_0008044 Ga0495663_0008044_304_1221 290
266 3300046526 Ga0495666_0001002 Ga0495666_0001002_10630_11529 290
267 3300046531 Ga0495665_0012094 Ga0495665_0012094_853_1752 290
268 3300046531 Ga0495665_0097417 Ga0495665_0097417_609_1526 290
269 3300046533 Ga0495640_0218581 Ga0495640_0218581_15_938 290
270 3300046535 Ga0495586_0018910 Ga0495586_0018910_195_1118 290
271 3300046535 Ga0495586_0138225 Ga0495586_0138225_296_1195 290
272 3300046537 Ga0495598_0000308 Ga0495598_0000308_1950_2867 290
273 3300046537 Ga0495598_0026692 Ga0495598_0026692_94_990 290
274 3300046538 Ga0495609_0059370 Ga0495609_0059370_739_1635 290
275 3300046538 Ga0495609_0070173 Ga0495609_0070173_429_1346 290
276 3300046539 Ga0495621_0065876 Ga0495621_0065876_18_917 290
277 3300046543 Ga0495645_0092695 Ga0495645_0092695_191_1090 290
278 3300046615 Ga0495656_0000679 Ga0495656_0000679_210_1127 290
279 3300046615 Ga0495656_0040268 Ga0495656_0040268_322_1218 290
280 3300046615 Ga0495656_0091069 Ga0495656_0091069_270_1187 290
281 3300046642 Ga0495634_0227928 Ga0495634_0227928_187_1104 290
282 3300046648 Ga0495611_0021467 Ga0495611_0021467_1729_2646 290
283 3300046664 Ga0495659_0019281 Ga0495659_0019281_330_1247 290
284 3300046665 Ga0495661_0081667 Ga0495661_0081667_53_970 290
285 3300046665 Ga0495661_0091044 Ga0495661_0091044_457_1353 290
286 3300046674 Ga0495588_0067638 Ga0495588_0067638_32_955 290
287 3300046674 Ga0495588_0100137 Ga0495588_0100137_179_1078 290
288 3300046678 Ga0495599_0133380 Ga0495599_0133380_243_1142 290
289 3300046681 Ga0495647_0002944 Ga0495647_0002944_15_938 290
290 3300046683 Ga0495658_0127869 Ga0495658_0127869_340_1239 290
291 3300046689 Ga0495613_0014056 Ga0495613_0014056_4188_5087 290
292 3300046690 Ga0495624_0017953 Ga0495624_0017953_445_1344 290
293 3300046691 Ga0495670_0037111 Ga0495670_0037111_499_1416 290
294 3300046691 Ga0495670_0126643 Ga0495670_0126643_339_1262 290
295 3300046794 Ga0495589_0055351 Ga0495589_0055351_485_1417 290
296 3300046810 Ga0495660_0146661 Ga0495660_0146661_69_965 290
297 3300047315 Ga0495581_0007164 Ga0495581_0007164_3124_4041 290
298 3300047318 Ga0495636_0066386 Ga0495636_0066386_134_1033 290
299 3300047319 Ga0495674_0005118 Ga0495674_0005118_10658_11557 290
300 3300047319 Ga0495674_0186783 Ga0495674_0186783_580_1497 290
301 3300047321 Ga0495676_0085545 Ga0495676_0085545_727_1650 290
302 3300047322 Ga0495680_0004136 Ga0495680_0004136_10137_11036 290
303 3300047445 Ga0495677_0024097 Ga0495677_0024097_602_1519 290
304 3300047673 Ga0495593_0008182 Ga0495593_0008182_3450_4349 290
305 3300048089 Ga0495614_0000927 Ga0495614_0000927_1746_2645 290
306 3300048903 Ga0496100_0017319 Ga0496100_0017319_257_1180 290
307 3300048904 Ga0496101_0083713 Ga0496101_0083713_531_1448 290
308 3300048905 Ga0496102_0024405 Ga0496102_0024405_826_1749 290
309 3300048905 Ga0496102_0025334 Ga0496102_0025334_2702_3601 290
310 3300048906 Ga0496103_0262681 Ga0496103_0262681_39_938 290
311 3300048907 Ga0496104_0085433 Ga0496104_0085433_687_1586 290
312 3300048909 Ga0496106_0009574 Ga0496106_0009574_627_1550 290
313 3300048909 Ga0496106_0149829 Ga0496106_0149829_581_1477 290
314 3300048910 Ga0496107_0068806 Ga0496107_0068806_723_1622 290
315 3300048911 Ga0496108_0057588 Ga0496108_0057588_2140_3057 290
316 3300048912 Ga0496109_0019137 Ga0496109_0019137_231_1148 290
317 3300048912 Ga0496109_0034181 Ga0496109_0034181_445_1368 290
318 3300048912 Ga0496109_0428136 Ga0496109_0428136_267_1190 290
319 3300048913 Ga0496110_0072546 Ga0496110_0072546_25_939 290
320 3300048916 Ga0496113_0055267 Ga0496113_0055267_1896_2819 290
321 3300049569 Ga0501032_0174377 Ga0501032_0174377_204_1121 290
322 3300049572 Ga0501036_0010201 Ga0501036_0010201_2049_2966 290
323 3300049574 Ga0501038_0039849 Ga0501038_0039849_1396_2310 290
324 3300049575 Ga0501039_0011349 Ga0501039_0011349_1297_2211 290
325 3300049575 Ga0501039_0013475 Ga0501039_0013475_110_1027 290
326 3300049575 Ga0501039_0019849 Ga0501039_0019849_888_1805 290
327 3300049575 Ga0501039_0348181 Ga0501039_0348181_24_938 290
328 3300049576 Ga0501040_0090427 Ga0501040_0090427_610_1509 290
329 3300049576 Ga0501040_0156540 Ga0501040_0156540_575_1501 290
330 3300049577 Ga0501041_0018720 Ga0501041_0018720_1043_1960 290
331 3300049578 Ga0501042_0013200 Ga0501042_0013200_273_1187 290
332 3300049578 Ga0501042_0013451 Ga0501042_0013451_4453_5367 290
333 3300049578 Ga0501042_0108496 Ga0501042_0108496_807_1724 290
334 3300049579 Ga0501043_0073804 Ga0501043_0073804_872_1789 290
335 3300049580 Ga0501046_0024580 Ga0501046_0024580_1068_1985 290
336 3300049580 Ga0501046_0066063 Ga0501046_0066063_285_1184 290
337 3300049581 Ga0501047_0334856 Ga0501047_0334856_352_1272 290
338 3300049582 Ga0501048_0011368 Ga0501048_0011368_766_1665 290
339 3300049582 Ga0501048_0049071 Ga0501048_0049071_2056_2973 290
340 3300049584 Ga0501068_0044989 Ga0501068_0044989_77_994 290
341 3300049587 Ga0501071_0007646 Ga0501071_0007646_1194_2111 290
342 3300049587 Ga0501071_0242397 Ga0501071_0242397_289_1188 290
343 3300049588 Ga0501072_0003449 Ga0501072_0003449_8427_9341 290
344 3300049588 Ga0501072_0004158 Ga0501072_0004158_1575_2492 290
345 3300049588 Ga0501072_0064262 Ga0501072_0064262_376_1275 290
346 3300049590 Ga0501074_0082172 Ga0501074_0082172_813_1730 290
347 3300049591 Ga0501075_0039794 Ga0501075_0039794_1687_2604 290
348 3300049591 Ga0501075_0190392 Ga0501075_0190392_47_970 290
349 3300049592 Ga0501076_0003817 Ga0501076_0003817_5331_6245 290
350 3300049592 Ga0501076_0011360 Ga0501076_0011360_2057_2974 290
351 3300049593 Ga0501077_0013620 Ga0501077_0013620_1100_2017 290
352 3300049593 Ga0501077_0217456 Ga0501077_0217456_96_1010 290
353 3300049741 Ga0501079_0026035 Ga0501079_0026035_3406_4323 290
354 3300049741 Ga0501079_0149518 Ga0501079_0149518_581_1480 290
355 3300049742 Ga0501080_0600558 Ga0501080_0600558_41_955 290
356 3300049743 Ga0501081_0008823 Ga0501081_0008823_443_1360 290
357 3300049743 Ga0501081_0257181 Ga0501081_0257181_65_982 290
358 3300049744 Ga0501083_0245638 Ga0501083_0245638_202_1101 290
359 3300049822 Ga0501035_0013751 Ga0501035_0013751_2369_3286 290
360 3300049822 Ga0501035_0125007 Ga0501035_0125007_1293_2207 290
361 3300049822 Ga0501035_0302847 Ga0501035_0302847_170_1069 290
362 3300049824 Ga0501045_0005544 Ga0501045_0005544_6661_7560 290
363 3300049824 Ga0501045_0008834 Ga0501045_0008834_4314_5228 290
364 3300049824 Ga0501045_0110889 Ga0501045_0110889_452_1351 290
365 3300050507 nmdc:mga05p37_141740_c1 nmdc:mga05p37_141740_c1_1778_2698 290
366 3300050507 nmdc:mga05p37_5789_c1 nmdc:mga05p37_5789_c1_4533_5429 290
367 3300050508 nmdc:mga09592_31270_c1 nmdc:mga09592_31270_c1_3494_4411 290
368 3300050508 nmdc:mga09592_69524_c1 nmdc:mga09592_69524_c1_866_1789 290
369 3300050509 nmdc:mga0qj67_193981_c1 nmdc:mga0qj67_193981_c1_253_1149 290
370 3300050511 nmdc:mga08y16_26517_c1 nmdc:mga08y16_26517_c1_838_1761 290
371 3300050512 nmdc:mga0n895_167812_c1 nmdc:mga0n895_167812_c1_272_1186 290
372 3300050512 nmdc:mga0n895_24323_c1 nmdc:mga0n895_24323_c1_2396_3316 290
373 3300050512 nmdc:mga0n895_65594_c1 nmdc:mga0n895_65594_c1_1632_2555 290
374 3300050512 nmdc:mga0n895_7681_c1 nmdc:mga0n895_7681_c1_8061_8957 290
375 3300050513 nmdc:mga0rr50_15335_c1 nmdc:mga0rr50_15335_c1_2392_3312 290
376 3300050515 nmdc:mga0a205_211847_c1 nmdc:mga0a205_211847_c1_83_1006 290
377 3300050515 nmdc:mga0a205_40099_c1 nmdc:mga0a205_40099_c1_2432_3352 290
378 3300050515 nmdc:mga0a205_63351_c1 nmdc:mga0a205_63351_c1_2464_3378 290
379 3300053077 Ga0495601_0007556 Ga0495601_0007556_2502_3401 290
380 3300053083 Ga0495655_0011246 Ga0495655_0011246_538_1437 290
381 3300053084 Ga0495595_0004336 Ga0495595_0004336_2640_3539 290
382 3300053085 Ga0495619_0019049 Ga0495619_0019049_3017_3916 290
383 3300054114 Ga0501084_0009591 Ga0501084_0009591_3197_4111 290
384 3300054114 Ga0501084_0139852 Ga0501084_0139852_300_1199 290
385 3300060353 Ga0501082_0007933 Ga0501082_0007933_6428_7342 290
386 3300060353 Ga0501082_0017403 Ga0501082_0017403_2166_3083 290
387 3300060353 Ga0501082_0193383 Ga0501082_0193383_301_1200 290
388 3300061734 Ga0530510_0003135 Ga0530510_0003135_1323_2222 290
389 3300061734 Ga0530510_0005355 Ga0530510_0005355_4134_5048 290
390 3300061734 Ga0530510_0082592 Ga0530510_0082592_326_1243 290
391 3300061734 Ga0530510_0136373 Ga0530510_0136373_174_1088 290
392 3300005444 Ga0070694_100000211 Ga0070694_10000021119 291
393 3300005445 Ga0070708_100007507 Ga0070708_1000075074 291
394 3300005467 Ga0070706_100054147 Ga0070706_1000541471 291
395 3300005467 Ga0070706_100140973 Ga0070706_1001409732 291
396 3300005468 Ga0070707_100031518 Ga0070707_1000315182 291
397 3300005468 Ga0070707_100086487 Ga0070707_1000864873 291
398 3300005518 Ga0070699_100000297 Ga0070699_10000029710 291
399 3300005518 Ga0070699_100175884 Ga0070699_1001758842 291
400 3300005530 Ga0070679_100110686 Ga0070679_1001106863 291
401 3300005535 Ga0070684_100007384 Ga0070684_1000073847 291
402 3300005536 Ga0070697_100001269 Ga0070697_1000012697 291
403 3300005536 Ga0070697_100131699 Ga0070697_1001316993 291
404 3300005536 Ga0070697_100498056 Ga0070697_1004980561 291
405 3300005545 Ga0070695_100006419 Ga0070695_1000064192 291
406 3300005564 Ga0070664_100293131 Ga0070664_1002931312 291
407 3300005615 Ga0070702_100024738 Ga0070702_1000247383 291
408 3300007265 Ga0099794_10013212 Ga0099794_100132123 291
409 3300009098 Ga0105245_10244660 Ga0105245_102446602 291
410 3300009147 Ga0114129_10008786 Ga0114129_1000878612 291
411 3300009176 Ga0105242_10061923 Ga0105242_100619233 291
412 3300009553 Ga0105249_10202745 Ga0105249_102027452 291
413 3300011119 Ga0105246_10012684 Ga0105246_100126846 291
414 3300013297 Ga0157378_10074298 Ga0157378_100742984 291
415 3300014325 Ga0163163_10258620 Ga0163163_102586202 291
416 3300014745 Ga0157377_10090911 Ga0157377_100909112 291
417 3300014968 Ga0157379_10080085 Ga0157379_100800852 291
418 3300014968 Ga0157379_10167357 Ga0157379_101673572 291
419 3300025903 Ga0207680_10244894 Ga0207680_102448942 291
420 3300025907 Ga0207645_10145283 Ga0207645_101452832 291
421 3300025910 Ga0207684_10009116 Ga0207684_100091166 291
422 3300025922 Ga0207646_10011824 Ga0207646_100118248 291
423 3300025922 Ga0207646_10016899 Ga0207646_100168991 291
424 3300025922 Ga0207646_10110744 Ga0207646_101107442 291
425 3300025934 Ga0207686_10087797 Ga0207686_100877972 291
426 3300025942 Ga0207689_10181345 Ga0207689_101813452 291
427 3300025981 Ga0207640_10295990 Ga0207640_102959902 291
428 3300026088 Ga0207641_10279058 Ga0207641_102790582 291
429 3300026121 Ga0207683_10034112 Ga0207683_100341124 291
430 3300027717 Ga0209998_10002500 Ga0209998_100025003 291
431 3300028577 Ga0265318_10008255 Ga0265318_100082554 291
432 3300028577 Ga0265318_10014121 Ga0265318_100141213 291
433 3300028577 Ga0265318_10037798 Ga0265318_100377982 291
434 3300028653 Ga0265323_10038500 Ga0265323_100385002 291
435 3300031456 Ga0307513_10241095 Ga0307513_102410952 291
436 3300031665 Ga0316575_10046246 Ga0316575_100462462 291
437 3300031691 Ga0316579_10001712 Ga0316579_100017127 291
438 3300031727 Ga0316576_10079078 Ga0316576_100790783 291
439 3300031727 Ga0316576_10170530 Ga0316576_101705302 291
440 3300031727 Ga0316576_10179277 Ga0316576_101792772 291
441 3300031728 Ga0316578_10072632 Ga0316578_100726323 291
442 3300035171 Ga0373946_0022842 Ga0373946_0022842_935_1822 291
443 3300035398 Ga0316574_0037094 Ga0316574_0037094_982_1878 291
444 3300036401 Ga0373937_0146447 Ga0373937_0146447_213_1100 291
445 3300036401 Ga0373937_0617258 Ga0373937_0617258_42_1004 291
446 3300036647 Ga0316582_0027627 Ga0316582_0027627_893_1810 291
447 3300036712 Ga0316584_0164655 Ga0316584_0164655_439_1368 291
448 3300037068 Ga0373925_0000622 Ga0373925_0000622_20257_21144 291
449 3300037068 Ga0373925_0042711 Ga0373925_0042711_229_1116 291
450 3300037588 Ga0316581_0004259 Ga0316581_0004259_1164_2081 291
451 3300041512 Ga0451853_0005663 Ga0451853_0005663_1195_2091 291
452 3300042876 Ga0451577_0068992 Ga0451577_0068992_1897_2856 291
453 3300046459 Ga0495629_0000008 Ga0495629_0000008_320000_320887 291
454 3300046472 Ga0495580_0199947 Ga0495580_0199947_357_1244 291
455 3300046475 Ga0495639_0000405 Ga0495639_0000405_8333_9220 291
456 3300046517 Ga0495630_0063241 Ga0495630_0063241_1377_2264 291
457 3300046526 Ga0495666_0140698 Ga0495666_0140698_42_929 291
458 3300046533 Ga0495640_0105192 Ga0495640_0105192_492_1379 291
459 3300046535 Ga0495586_0199068 Ga0495586_0199068_70_957 291
460 3300046557 Ga0495622_0012769 Ga0495622_0012769_170_1057 291
461 3300046663 Ga0495635_0011047 Ga0495635_0011047_3811_4698 291
462 3300046683 Ga0495658_0027330 Ga0495658_0027330_56_943 291
463 3300046809 Ga0495600_0010964 Ga0495600_0010964_3825_4712 291
464 3300047315 Ga0495581_0107778 Ga0495581_0107778_660_1547 291
465 3300047321 Ga0495676_0001233 Ga0495676_0001233_7481_8368 291
466 3300047322 Ga0495680_0001843 Ga0495680_0001843_14647_15534 291
467 3300047471 Ga0495684_0005538 Ga0495684_0005538_2313_3200 291
468 3300048907 Ga0496104_0316821 Ga0496104_0316821_48_977 291
469 3300048909 Ga0496106_0243289 Ga0496106_0243289_47_943 291
470 3300048911 Ga0496108_0057788 Ga0496108_0057788_522_1418 291
471 3300048911 Ga0496108_0123601 Ga0496108_0123601_624_1556 291
472 3300048912 Ga0496109_0040463 Ga0496109_0040463_560_1456 291
473 3300048912 Ga0496109_0184606 Ga0496109_0184606_923_1855 291
474 3300048914 Ga0496111_0004208 Ga0496111_0004208_2360_3256 291
475 3300048915 Ga0496112_0015922 Ga0496112_0015922_1088_1984 291
476 3300048916 Ga0496113_0011449 Ga0496113_0011449_746_1642 291
477 3300049568 Ga0501031_0000828 Ga0501031_0000828_10013_10951 291
478 3300049568 Ga0501031_0013083 Ga0501031_0013083_693_1622 291
479 3300049573 Ga0501037_0149816 Ga0501037_0149816_55_984 291
480 3300049574 Ga0501038_0010395 Ga0501038_0010395_3267_4205 291
481 3300049575 Ga0501039_0003953 Ga0501039_0003953_7105_8043 291
482 3300049576 Ga0501040_0008616 Ga0501040_0008616_5188_6126 291
483 3300049577 Ga0501041_0005561 Ga0501041_0005561_4343_5281 291
484 3300049578 Ga0501042_0038019 Ga0501042_0038019_2321_3259 291
485 3300049578 Ga0501042_0097203 Ga0501042_0097203_993_1922 291
486 3300049580 Ga0501046_0015258 Ga0501046_0015258_4677_5615 291
487 3300049582 Ga0501048_0031525 Ga0501048_0031525_497_1435 291
488 3300049584 Ga0501068_0024833 Ga0501068_0024833_2155_3093 291
489 3300049585 Ga0501069_0007299 Ga0501069_0007299_1750_2688 291
490 3300049586 Ga0501070_0016004 Ga0501070_0016004_1090_2028 291
491 3300049587 Ga0501071_0002638 Ga0501071_0002638_6890_7828 291
492 3300049587 Ga0501071_0003029 Ga0501071_0003029_541_1470 291
493 3300049588 Ga0501072_0010454 Ga0501072_0010454_1298_2227 291
494 3300049588 Ga0501072_0016680 Ga0501072_0016680_91_1029 291
495 3300049590 Ga0501074_0007708 Ga0501074_0007708_4788_5726 291
496 3300049591 Ga0501075_0012193 Ga0501075_0012193_2706_3644 291
497 3300049592 Ga0501076_0019823 Ga0501076_0019823_658_1596 291
498 3300049592 Ga0501076_0227550 Ga0501076_0227550_280_1209 291
499 3300049592 Ga0501076_0370178 Ga0501076_0370178_236_1162 291
500 3300049741 Ga0501079_0002941 Ga0501079_0002941_520_1458 291
501 3300049741 Ga0501079_0141513 Ga0501079_0141513_466_1380 291
502 3300049742 Ga0501080_0003053 Ga0501080_0003053_5047_5985 291
503 3300049742 Ga0501080_0146871 Ga0501080_0146871_665_1594 291
504 3300049743 Ga0501081_0005930 Ga0501081_0005930_2279_3217 291
505 3300049744 Ga0501083_0186003 Ga0501083_0186003_333_1262 291
506 3300049822 Ga0501035_0041543 Ga0501035_0041543_969_1907 291
507 3300049824 Ga0501045_0002635 Ga0501045_0002635_6529_7467 291
508 3300049824 Ga0501045_0081580 Ga0501045_0081580_42_971 291
509 3300050508 nmdc:mga09592_135571_c1 nmdc:mga09592_135571_c1_1177_2082 291
510 3300053077 Ga0495601_0150572 Ga0495601_0150572_174_1070 291
511 3300053085 Ga0495619_0102537 Ga0495619_0102537_326_1222 291
512 3300053085 Ga0495619_0174663 Ga0495619_0174663_395_1282 291
513 3300053094 Ga0500566_0040300 Ga0500566_0040300_520_1407 291
514 3300054114 Ga0501084_0036482 Ga0501084_0036482_748_1686 291
515 3300054114 Ga0501084_0203216 Ga0501084_0203216_476_1432 291
516 3300060353 Ga0501082_0021966 Ga0501082_0021966_1363_2301 291
517 3300060353 Ga0501082_0085767 Ga0501082_0085767_206_1135 291
518 3300061734 Ga0530510_0011644 Ga0530510_0011644_1451_2389 291
519 3300003316 rootH1_10088664 rootH1_100886642 293
520 3300003322 rootL2_10097823 rootL2_100978232 293
521 3300005435 Ga0070714_100144923 Ga0070714_1001449232 293
522 3300006880 Ga0075429_100037293 Ga0075429_1000372935 293
523 3300009094 Ga0111539_10014780 Ga0111539_100147803 293
524 3300036647 Ga0316582_0034317 Ga0316582_0034317_1797_2720 293
525 3300045051 Ga0451576_0228463 Ga0451576_0228463_735_1679 293
526 3300050508 nmdc:mga09592_22289_c1 nmdc:mga09592_22289_c1_1983_2888 293
527 3300050511 nmdc:mga08y16_112205_c1 nmdc:mga08y16_112205_c1_1868_2770 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

32

260

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1poi-assembly1.cif.gz_A crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution 0.8888 2 293
1poi-assembly1.cif.gz_A crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution 0.883 2 293
3cdk-assembly1.cif.gz_C crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.8802 2 220
5dbn-assembly2.cif.gz_E crystal structure of atoda complex 0.8671 1 218
1k6d-assembly1.cif.gz_A crystal structure of acetate coa-transferase alpha subunit 0.865 1 220
ID Description Score Start End Superfamily
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8732 2 293 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8684 2 220 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8618 1 219 3.40.1080.10
af_Q2G1C6_6_271_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8615 1 219 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8407 2 219 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A7C3QNR2-F1-model_v4 CoA transferase subunit A 0.9847 2 66 GO:0016020
GO:0016740
AF-A0A6I3BCP0-F1-model_v4 CoA transferase subunit A 0.9828 2 69 GO:0008410
AF-A0A847FV37-F1-model_v4 CoA transferase subunit A 0.978 2 225 GO:0008410
AF-A0A538PWZ6-F1-model_v4 CoA transferase subunit A 0.9728 1 131 GO:0008410
AF-A0A2V6BVX4-F1-model_v4 3-oxoadipate--succinyl-CoA transferase subunit A 0.9715 2 163 GO:0008410

Feature Viewer

pLDDT pTM Quality
87.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map