F459501

General Info

Members Datasets Scaffolds Average Seq Length
527 310 1054 289

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10275794|Ga0070658_102757942
Length 306
Sequence VTTPAIAPNAERMSIARVGVVGGGLMGSGIAQVAAQAGIATTLRELSEPLVQRARVNITRSLDKSIEKGKLTADARDAALSRLTTTTRLDDLAACDVVIEAVVEDLDVKNALWRELNVHCAADTVFASNTSSLTIAAMAAASGRPDRLVGLHFFNPVPLMRLVEVVRTLTTSDATFDLAMTLVRQLGKQPVVARDSSGFVVNRLLIPYMLDAIRALENGVGTITDIDAGMQLGAGHPMGPFTLLDFVGLDTVERVAEVMFDEYREQRFAPPPLLRRLVRAGHLGRKAGRGFYDHTVDPPVPSPLAL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
256 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
258 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
259 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
260 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
261 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
262 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
263 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
264 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
265 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
266 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
267 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
268 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
269 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
270 2738541295 Bacillus sp. OK085 Isolate Unclassified
271 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
272 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
273 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
274 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
275 2857472729 Cohnella sp. R-74144 Isolate Unclassified
276 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
277 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
278 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
279 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
280 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
281 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
282 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
283 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
284 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
285 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
286 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
287 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
288 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
289 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
290 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
291 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
292 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
293 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
294 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
295 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
296 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
297 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
298 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
299 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
300 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
301 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
302 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
303 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
304 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
305 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
306 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
307 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
308 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
309 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
310 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 2.66
Isolates 10.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 1.14
Rhizosphere 84.63
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10275794 3300005327 Bacteria 1431
2 MBSR1b_contig_10852878 2162886012 Unclassified 1010
3 JGI25162J39368_1004829 3300002737 Bacteria 2923
4 Ga0006562J51391_1002201 3300003578 Bacteria 4397
5 Ga0055538_1000136 3300003751 Bacteria 52142
6 Ga0055535_1003604 3300003761 Bacteria 4262
7 Ga0055541_1001498 3300003841 Bacteria 5033
8 Ga0055541_1009946 3300003841 Bacteria 1450
9 Ga0070658_10216976 3300005327 Unclassified 1617
10 Ga0070658_10268584 3300005327 Bacteria 1450
11 Ga0070676_10029620 3300005328 Bacteria 3115
12 Ga0070676_10080054 3300005328 Bacteria 1979
13 Ga0070683_100002047 3300005329 Bacteria 15886
14 Ga0070683_100013939 3300005329 Bacteria 7023
15 Ga0070683_100036410 3300005329 Bacteria 4503
16 Ga0070683_100155361 3300005329 Unclassified 2170
17 Ga0070690_100158169 3300005330 Bacteria 1551
18 Ga0070670_100024211 3300005331 Bacteria 5223
19 Ga0070670_100025023 3300005331 Bacteria 5135
20 Ga0070670_100033642 3300005331 Bacteria 4415
21 Ga0070677_10012745 3300005333 Bacteria 2924
22 Ga0068869_100092016 3300005334 Bacteria 2282
23 Ga0070680_100083742 3300005336 Bacteria 2634
24 Ga0070680_100134025 3300005336 Bacteria 2074
25 Ga0068868_100012746 3300005338 Bacteria 6149
26 Ga0068868_100123054 3300005338 Bacteria 2117
27 Ga0070660_100074994 3300005339 Bacteria 2648
28 Ga0070689_100004502 3300005340 Bacteria 9433
29 Ga0070689_100081790 3300005340 Bacteria 2536
30 Ga0070691_10002872 3300005341 Bacteria 7716
31 Ga0070691_10045453 3300005341 Bacteria 2083
32 Ga0070687_100003342 3300005343 Bacteria 6210
33 Ga0070661_100005878 3300005344 Bacteria 8442
34 Ga0070661_100018111 3300005344 Bacteria 5005
35 Ga0070661_100216500 3300005344 Bacteria 1468
36 Ga0070661_100438354 3300005344 Bacteria 1038
37 Ga0070668_100010618 3300005347 Bacteria 6849
38 Ga0070668_100197751 3300005347 Bacteria 1649
39 Ga0070669_100003709 3300005353 Bacteria 11021
40 Ga0070669_100006986 3300005353 Bacteria 8112
41 Ga0070669_100018032 3300005353 Bacteria 5042
42 Ga0070669_100018617 3300005353 Bacteria 4963
43 Ga0070669_100439877 3300005353 Bacteria 1073
44 Ga0070675_100016968 3300005354 Bacteria 5784
45 Ga0070671_100113718 3300005355 Bacteria 2275
46 Ga0070674_100019674 3300005356 Bacteria 4293
47 Ga0070673_100002435 3300005364 Bacteria 11340
48 Ga0070673_100005506 3300005364 Bacteria 8110
49 Ga0070673_100018551 3300005364 Bacteria 4973
50 Ga0070688_100008192 3300005365 Bacteria 5663
51 Ga0070688_100098563 3300005365 Bacteria 1923
52 Ga0070659_100007256 3300005366 Bacteria 8044
53 Ga0070659_100151525 3300005366 Bacteria 1892
54 Ga0070659_100227566 3300005366 Bacteria 1540
55 Ga0070667_100185733 3300005367 Bacteria 1840
56 Ga0070714_100039605 3300005435 Bacteria 3968
57 Ga0070713_100001008 3300005436 Bacteria 18012
58 Ga0070701_10001343 3300005438 Bacteria 9064
59 Ga0070701_10018075 3300005438 Bacteria 3308
60 Ga0070705_100181786 3300005440 Bacteria 1425
61 Ga0070694_100024822 3300005444 Bacteria 3872
62 Ga0070694_100064037 3300005444 Bacteria 2516
63 Ga0070708_100005601 3300005445 Bacteria 9958
64 Ga0070708_100013913 3300005445 Bacteria 6609
65 Ga0070708_100243024 3300005445 Bacteria 1690
66 Ga0070663_100047300 3300005455 Bacteria 3047
67 Ga0070678_100123726 3300005456 Bacteria 2044
68 Ga0070662_100024778 3300005457 Bacteria 4137
69 Ga0070662_100104126 3300005457 Bacteria 2153
70 Ga0070681_10001693 3300005458 Bacteria 19724
71 Ga0068867_100071679 3300005459 Bacteria 2592
72 Ga0068867_100230612 3300005459 Bacteria 1496
73 Ga0070685_10018043 3300005466 Bacteria 3791
74 Ga0070706_100005629 3300005467 Bacteria 11922
75 Ga0070706_100005965 3300005467 Bacteria 11527
76 Ga0070706_100009068 3300005467 Bacteria 9261
77 Ga0070706_100024474 3300005467 Bacteria 5558
78 Ga0070706_100121752 3300005467 Bacteria 2432
79 Ga0070706_100128083 3300005467 Bacteria 2368
80 Ga0070707_100005485 3300005468 Bacteria 11863
81 Ga0070707_100100656 3300005468 Bacteria 2800
82 Ga0070698_100000438 3300005471 Bacteria 44134
83 Ga0070698_100252623 3300005471 Unclassified 1696
84 Ga0070698_100281789 3300005471 Unclassified 1593
85 Ga0070699_100004243 3300005518 Bacteria 12673
86 Ga0070699_100006704 3300005518 Bacteria 10015
87 Ga0070699_100075053 3300005518 Bacteria 2942
88 Ga0070679_100035244 3300005530 Bacteria 4964
89 Ga0070684_100000591 3300005535 Bacteria 25009
90 Ga0070684_100026455 3300005535 Unclassified 4888
91 Ga0070684_100047712 3300005535 Bacteria 3712
92 Ga0070697_100011732 3300005536 Bacteria 6853
93 Ga0070697_100215708 3300005536 Bacteria 1635
94 Ga0068853_100008069 3300005539 Bacteria 8444
95 Ga0068853_100458934 3300005539 Bacteria 1199
96 Ga0070672_100002424 3300005543 Bacteria 11818
97 Ga0070672_100243604 3300005543 Bacteria 1513
98 Ga0070686_100033045 3300005544 Bacteria 3176
99 Ga0070695_100148686 3300005545 Bacteria 1632
100 Ga0070696_100378982 3300005546 Bacteria 1102
101 Ga0070693_100201799 3300005547 Bacteria 1292
102 Ga0070665_100081760 3300005548 Bacteria 3236
103 Ga0070665_100523263 3300005548 Bacteria 1198
104 Ga0070704_100444692 3300005549 Bacteria 1115
105 Ga0070704_100468663 3300005549 Unclassified 1088
106 Ga0068855_100038163 3300005563 Bacteria 5708
107 Ga0070664_100004327 3300005564 Bacteria 11414
108 Ga0070664_100022723 3300005564 Bacteria 5172
109 Ga0070664_100033544 3300005564 Bacteria 4301
110 Ga0070664_100188828 3300005564 Bacteria 1835
111 Ga0070664_100306555 3300005564 Bacteria 1436
112 Ga0068857_100008871 3300005577 Bacteria 8711
113 Ga0068857_100010398 3300005577 Bacteria 8086
114 Ga0068857_100016859 3300005577 Bacteria 6400
115 Ga0068857_100217671 3300005577 Bacteria 1744
116 Ga0068854_100083079 3300005578 Unclassified 2368
117 Ga0068854_100096410 3300005578 Bacteria 2210
118 Ga0068856_100004267 3300005614 Bacteria 14276
119 Ga0070702_100016196 3300005615 Bacteria 3821
120 Ga0068852_100036200 3300005616 Bacteria 4127
121 Ga0068852_100143705 3300005616 Bacteria 2211
122 Ga0068852_100196659 3300005616 Unclassified 1906
123 Ga0068859_100063284 3300005617 Bacteria 3730
124 Ga0068859_100211064 3300005617 Bacteria 2028
125 Ga0068864_100011601 3300005618 Bacteria 7277
126 Ga0068864_100300556 3300005618 Bacteria 1502
127 Ga0068866_10032233 3300005718 Bacteria 2532
128 Ga0068861_100001333 3300005719 Bacteria 15481
129 Ga0068861_100086725 3300005719 Bacteria 2461
130 Ga0068851_10036697 3300005834 Bacteria 2455
131 Ga0068870_10112324 3300005840 Bacteria 1558
132 Ga0068863_100069860 3300005841 Bacteria 3321
133 Ga0068863_100086606 3300005841 Bacteria 2968
134 Ga0068858_100021354 3300005842 Bacteria 6048
135 Ga0068858_100040650 3300005842 Bacteria 4313
136 Ga0068860_100012357 3300005843 Bacteria 8412
137 Ga0068862_100000825 3300005844 Bacteria 30645
138 Ga0068862_100043284 3300005844 Bacteria 3838
139 Ga0068862_100128628 3300005844 Bacteria 2238
140 Ga0081539_10001120 3300005985 Bacteria 48648
141 Ga0081539_10126230 3300005985 Bacteria 1264
142 Ga0070717_10046165 3300006028 Bacteria 3563
143 Ga0070717_10102480 3300006028 Bacteria 2432
144 Ga0070717_10454858 3300006028 Bacteria 1154
145 Ga0075365_10057822 3300006038 Bacteria 2580
146 Ga0075363_100091271 3300006048 Bacteria 1677
147 Ga0075362_10074895 3300006177 Bacteria 1552
148 Ga0075366_10005245 3300006195 Bacteria 7015
149 Ga0097621_100235869 3300006237 Bacteria 1598
150 Ga0068871_100529816 3300006358 Unclassified 1065
151 Ga0075428_100008312 3300006844 Bacteria 11501
152 Ga0075428_100012729 3300006844 Bacteria 9358
153 Ga0075428_100014382 3300006844 Bacteria 8795
154 Ga0075428_100053821 3300006844 Bacteria 4410
155 Ga0075428_100087914 3300006844 Bacteria 3390
156 Ga0075428_100207228 3300006844 Bacteria 2119
157 Ga0075430_100002963 3300006846 Bacteria 14214
158 Ga0075430_100126199 3300006846 Bacteria 2133
159 Ga0075431_100033829 3300006847 Bacteria 5266
160 Ga0075431_100220716 3300006847 Bacteria 1934
161 Ga0075433_10000233 3300006852 Bacteria 31730
162 Ga0075433_10002585 3300006852 Bacteria 13797
163 Ga0075433_10028367 3300006852 Bacteria 4758
164 Ga0075433_10030837 3300006852 Bacteria 4578
165 Ga0075433_10092602 3300006852 Bacteria 2673
166 Ga0075434_100000314 3300006871 Bacteria 34611
167 Ga0075434_100005330 3300006871 Bacteria 11702
168 Ga0075434_100015153 3300006871 Bacteria 7385
169 Ga0075434_100032599 3300006871 Bacteria 5138
170 Ga0075434_100052234 3300006871 Bacteria 4061
171 Ga0075434_100465585 3300006871 Bacteria 1285
172 Ga0075429_100024469 3300006880 Bacteria 5239
173 Ga0075429_100024964 3300006880 Bacteria 5189
174 Ga0075429_100133370 3300006880 Bacteria 2173
175 Ga0075429_100338538 3300006880 Bacteria 1317
176 Ga0068865_100102695 3300006881 Bacteria 2095
177 Ga0075436_100053703 3300006914 Bacteria 2782
178 Ga0075436_100067308 3300006914 Bacteria 2476
179 Ga0097620_100063283 3300006931 Bacteria 3730
180 Ga0097620_100211063 3300006931 Bacteria 2028
181 Ga0075435_100002838 3300007076 Bacteria 11596
182 Ga0075435_100060275 3300007076 Bacteria 3077
183 Ga0105244_10032786 3300009036 Bacteria 2745
184 Ga0111539_10003639 3300009094 Bacteria 20303
185 Ga0111539_10016566 3300009094 Bacteria 9138
186 Ga0111539_10130137 3300009094 Bacteria 2947
187 Ga0111539_10251749 3300009094 Bacteria 2057
188 Ga0105245_10071705 3300009098 Bacteria 3146
189 Ga0114129_10009241 3300009147 Bacteria 14062
190 Ga0114129_10014787 3300009147 Bacteria 11118
191 Ga0114129_10088921 3300009147 Bacteria 4282
192 Ga0114129_10112240 3300009147 Bacteria 3759
193 Ga0114129_10147828 3300009147 Bacteria 3218
194 Ga0114129_10219655 3300009147 Bacteria 2564
195 Ga0114129_10409591 3300009147 Bacteria 1786
196 Ga0105243_10038315 3300009148 Bacteria 3733
197 Ga0105241_10354562 3300009174 Bacteria 1275
198 Ga0105242_10042525 3300009176 Bacteria 3670
199 Ga0105248_10009215 3300009177 Bacteria 10857
200 Ga0105248_10011221 3300009177 Bacteria 9882
201 Ga0105248_10103624 3300009177 Bacteria 3207
202 Ga0105248_10149739 3300009177 Bacteria 2633
203 Ga0105248_10416530 3300009177 Bacteria 1513
204 Ga0105249_10000665 3300009553 Bacteria 31200
205 Ga0105249_10028565 3300009553 Bacteria 5035
206 Ga0105249_10283287 3300009553 Bacteria 1656
207 Ga0105246_10014400 3300011119 Bacteria 4974
208 Ga0157371_10008058 3300013102 Bacteria 8429
209 Ga0157371_10168923 3300013102 Bacteria 1562
210 Ga0157370_10182431 3300013104 Bacteria 1950
211 Ga0157369_10006102 3300013105 Bacteria 13988
212 Ga0157369_10179790 3300013105 Bacteria 2226
213 Ga0157369_10336621 3300013105 Unclassified 1568
214 Ga0163162_10004121 3300013306 Bacteria 13949
215 Ga0163162_10277039 3300013306 Bacteria 1809
216 Ga0163162_10777902 3300013306 Unclassified 1075
217 Ga0157372_10182921 3300013307 Bacteria 2426
218 Ga0157372_10424674 3300013307 Bacteria 1549
219 Ga0157375_10012559 3300013308 Bacteria 7517
220 Ga0157375_10017400 3300013308 Bacteria 6486
221 Ga0157375_10026806 3300013308 Bacteria 5378
222 Ga0157375_10223342 3300013308 Bacteria 2042
223 Ga0163163_10005980 3300014325 Bacteria 10582
224 Ga0157380_10009092 3300014326 Bacteria 7100
225 Ga0157380_10213103 3300014326 Bacteria 1723
226 Ga0157377_10099509 3300014745 Bacteria 1730
227 Ga0157379_10016617 3300014968 Bacteria 6471
228 Ga0163161_10038571 3300017792 Bacteria 3427
229 Ga0206356_10008437 3300020070 Bacteria 2229
230 Ga0206349_1554179 3300020075 Bacteria 1846
231 Ga0206355_1174927 3300020076 Bacteria 1009
232 Ga0206351_10804232 3300020077 Bacteria 1401
233 Ga0206352_10131924 3300020078 Bacteria 967
234 Ga0206350_11459179 3300020080 Bacteria 1545
235 Ga0206350_11570404 3300020080 Bacteria 1181
236 Ga0206354_10143697 3300020081 Bacteria 1693
237 Ga0206354_10782550 3300020081 Bacteria 1713
238 Ga0206353_11663656 3300020082 Bacteria 2018
239 Ga0224712_10007351 3300022467 Bacteria 3203
240 Ga0224712_10010067 3300022467 Bacteria 2875
241 Ga0224712_10014388 3300022467 Bacteria 2546
242 Ga0209784_100085 3300025224 Bacteria 122828
243 Ga0209566_100015 3300025225 Bacteria 457963
244 Ga0209566_100090 3300025225 Bacteria 141829
245 Ga0209437_100571 3300025233 Bacteria 23926
246 Ga0209258_100669 3300025242 Bacteria 24339
247 Ga0209025_1007644 3300025294 Bacteria 7993
248 Ga0207697_10003131 3300025315 Bacteria 8256
249 Ga0207656_10073781 3300025321 Unclassified 1521
250 Ga0207655_1061308 3300025728 Bacteria 1453
251 Ga0207653_10009160 3300025885 Bacteria 3086
252 Ga0207653_10099737 3300025885 Unclassified 1026
253 Ga0207642_10013319 3300025899 Bacteria 2998
254 Ga0207688_10014975 3300025901 Bacteria 4208
255 Ga0207647_10083692 3300025904 Bacteria 1910
256 Ga0207645_10000951 3300025907 Bacteria 24030
257 Ga0207645_10059214 3300025907 Bacteria 2446
258 Ga0207645_10079470 3300025907 Bacteria 2102
259 Ga0207643_10006225 3300025908 Bacteria 6384
260 Ga0207643_10040142 3300025908 Bacteria 2634
261 Ga0207705_10296712 3300025909 Bacteria 1239
262 Ga0207684_10002752 3300025910 Bacteria 17519
263 Ga0207684_10003942 3300025910 Bacteria 14205
264 Ga0207684_10004787 3300025910 Bacteria 12679
265 Ga0207684_10011659 3300025910 Bacteria 7674
266 Ga0207684_10027809 3300025910 Bacteria 4817
267 Ga0207684_10028472 3300025910 Bacteria 4760
268 Ga0207684_10072043 3300025910 Bacteria 2936
269 Ga0207707_10055068 3300025912 Unclassified 3461
270 Ga0207707_10151019 3300025912 Bacteria 2031
271 Ga0207693_10054896 3300025915 Bacteria 3125
272 Ga0207663_10158595 3300025916 Bacteria 1594
273 Ga0207660_10014149 3300025917 Bacteria 5238
274 Ga0207660_10416035 3300025917 Bacteria 1084
275 Ga0207662_10000600 3300025918 Bacteria 16115
276 Ga0207657_10022234 3300025919 Bacteria 5943
277 Ga0207657_10289623 3300025919 Unclassified 1299
278 Ga0207652_10184208 3300025921 Bacteria 1877
279 Ga0207646_10012158 3300025922 Bacteria 8282
280 Ga0207646_10012213 3300025922 Bacteria 8263
281 Ga0207646_10018265 3300025922 Bacteria 6544
282 Ga0207646_10031767 3300025922 Bacteria 4779
283 Ga0207646_10067430 3300025922 Bacteria 3195
284 Ga0207681_10003025 3300025923 Bacteria 10563
285 Ga0207681_10017906 3300025923 Bacteria 4455
286 Ga0207650_10013676 3300025925 Bacteria 5626
287 Ga0207650_10022275 3300025925 Bacteria 4483
288 Ga0207650_10022850 3300025925 Bacteria 4431
289 Ga0207650_10222122 3300025925 Bacteria 1521
290 Ga0207659_10017970 3300025926 Bacteria 4628
291 Ga0207659_10034089 3300025926 Bacteria 3509
292 Ga0207687_10148170 3300025927 Bacteria 1788
293 Ga0207700_10001607 3300025928 Bacteria 12822
294 Ga0207664_10056810 3300025929 Bacteria 3109
295 Ga0207690_10314838 3300025932 Bacteria 1228
296 Ga0207706_10001908 3300025933 Bacteria 20474
297 Ga0207706_10045772 3300025933 Bacteria 3876
298 Ga0207706_10158583 3300025933 Bacteria 1990
299 Ga0207709_10041229 3300025935 Bacteria 2769
300 Ga0207670_10085305 3300025936 Bacteria 2219
301 Ga0207670_10130990 3300025936 Bacteria 1837
302 Ga0207704_10012070 3300025938 Bacteria 4278
303 Ga0207691_10000366 3300025940 Bacteria 45517
304 Ga0207691_10008377 3300025940 Bacteria 9935
305 Ga0207691_10022639 3300025940 Bacteria 5926
306 Ga0207691_10202261 3300025940 Bacteria 1728
307 Ga0207711_10040740 3300025941 Bacteria 3952
308 Ga0207711_10062422 3300025941 Bacteria 3214
309 Ga0207711_10276273 3300025941 Bacteria 1546
310 Ga0207689_10009030 3300025942 Bacteria 8632
311 Ga0207689_10015290 3300025942 Bacteria 6496
312 Ga0207661_10006705 3300025944 Bacteria 8144
313 Ga0207661_10153082 3300025944 Bacteria 1995
314 Ga0207679_10013335 3300025945 Bacteria 5384
315 Ga0207679_10015642 3300025945 Bacteria 5019
316 Ga0207679_10178416 3300025945 Bacteria 1755
317 Ga0207679_10189018 3300025945 Bacteria 1710
318 Ga0207667_10120590 3300025949 Bacteria 2702
319 Ga0207667_10428414 3300025949 Bacteria 1346
320 Ga0207651_10133448 3300025960 Bacteria 1905
321 Ga0207651_10194135 3300025960 Bacteria 1622
322 Ga0207651_10436016 3300025960 Bacteria 1121
323 Ga0207712_10001698 3300025961 Bacteria 14778
324 Ga0207658_10089240 3300025986 Bacteria 2386
325 Ga0207658_10441565 3300025986 Bacteria 1150
326 Ga0207703_10131695 3300026035 Bacteria 2160
327 Ga0207678_10004766 3300026067 Bacteria 12177
328 Ga0207678_10059300 3300026067 Bacteria 3293
329 Ga0207708_10035775 3300026075 Unclassified 3779
330 Ga0207702_10000826 3300026078 Bacteria 32710
331 Ga0207641_10072381 3300026088 Bacteria 2968
332 Ga0207648_10000817 3300026089 Bacteria 35192
333 Ga0207676_10245746 3300026095 Unclassified 1608
334 Ga0207674_10000025 3300026116 Bacteria 152434
335 Ga0207674_10000247 3300026116 Bacteria 67328
336 Ga0207674_10009546 3300026116 Bacteria 11069
337 Ga0207675_100000319 3300026118 Bacteria 45892
338 Ga0207675_100014183 3300026118 Bacteria 7431
339 Ga0207675_100020411 3300026118 Bacteria 6175
340 Ga0207698_10052215 3300026142 Bacteria 3131
341 Ga0207698_10076145 3300026142 Bacteria 2684
342 Ga0207428_10000773 3300027907 Bacteria 36367
343 Ga0207428_10098054 3300027907 Bacteria 2268
344 Ga0207428_10202851 3300027907 Bacteria 1492
345 Ga0207428_10243526 3300027907 Bacteria 1343
346 Ga0268266_10124654 3300028379 Bacteria 2297
347 Ga0268265_10000988 3300028380 Bacteria 25833
348 Ga0268265_10003129 3300028380 Bacteria 12062
349 Ga0268264_10037879 3300028381 Bacteria 3977
350 Ga0268264_10086192 3300028381 Bacteria 2698
351 Ga0265338_10116964 3300028800 Bacteria 2134
352 Ga0265320_10064208 3300031240 Bacteria 1745
353 Ga0307408_100007531 3300031548 Bacteria 7197
354 Ga0307406_10000858 3300031901 Bacteria 17105
355 Ga0307416_100018702 3300032002 Bacteria 4891
356 Ga0307414_10360185 3300032004 Bacteria 1251
357 Ga0307411_10522249 3300032005 Bacteria 1008
358 Ga0373954_0009364 3300035118 Bacteria 4309
359 Ga0373954_0137711 3300035118 Bacteria 1190
360 Ga0373956_0000210 3300035119 Bacteria 22794
361 Ga0373956_0006338 3300035119 Bacteria 4736
362 Ga0373927_0000142 3300035695 Bacteria 55761
363 Ga0373933_0046710 3300035724 Bacteria 2572
364 Ga0373933_0069922 3300035724 Bacteria 2135
365 Ga0373937_0012727 3300036401 Bacteria 7404
366 Ga0373937_0100527 3300036401 Bacteria 2684
367 Ga0436364_0069628 3300037853 Bacteria 2575
368 Ga0400489_26268 3300039093 Bacteria 1646
369 Ga0436365_1815152 3300039437 Bacteria 3283
370 Ga0436363_1253050 3300039450 Bacteria 12479
371 Ga0439439_0000142 3300041406 Bacteria 10246
372 Ga0439449_0002253 3300042007 Bacteria 7583
373 Ga0439449_0040725 3300042007 Bacteria 1727
374 Ga0439449_0125471 3300042007 Bacteria 953
375 Ga0439462_0001202 3300042015 Bacteria 5657
376 Ga0451577_0054034 3300042876 Bacteria 3586
377 Ga0466969_0001196 3300044656 Bacteria 14018
378 Ga0453683_0000269 3300044673 Bacteria 68263
379 Ga0466966_0004794 3300044684 Bacteria 8895
380 Ga0466966_0148129 3300044684 Bacteria 1432
381 Ga0466961_0048099 3300044693 Bacteria 2726
382 Ga0466964_0030743 3300044706 Bacteria 2126
383 Ga0466968_0002810 3300044735 Bacteria 6432
384 Ga0466970_0002149 3300044765 Bacteria 9517
385 Ga0466957_0039471 3300044842 Bacteria 2848
386 Ga0466959_0079119 3300045049 Bacteria 2370
387 Ga0466959_0271955 3300045049 Bacteria 1164
388 Ga0451576_0559340 3300045051 Bacteria 1202
389 Ga0466958_0387861 3300045836 Bacteria 901
390 Ga0495651_0357316 3300046462 Bacteria 964
391 Ga0495653_0231647 3300046463 Bacteria 1236
392 Ga0495608_0030933 3300046511 Bacteria 3620
393 Ga0495661_0132237 3300046665 Bacteria 1366
394 Ga0495657_0017011 3300046675 Bacteria 5285
395 Ga0495599_0034485 3300046678 Bacteria 3179
396 Ga0495660_0016861 3300046810 Bacteria 4209
397 Ga0495674_0152065 3300047319 Bacteria 1940
398 Ga0495674_0259682 3300047319 Bacteria 1427
399 Ga0495672_0000569 3300047320 Bacteria 41729
400 Ga0495680_0110329 3300047322 Bacteria 2039
401 Ga0495675_0059481 3300047444 Bacteria 2422
402 Ga0495602_0090246 3300048088 Bacteria 2546
403 Ga0495626_0053456 3300048091 Bacteria 1859
404 Ga0496104_0151597 3300048907 Bacteria 2225
405 Ga0496105_0283292 3300048908 Bacteria 1336
406 Ga0496109_0147808 3300048912 Bacteria 2199
407 Ga0496112_0002709 3300048915 Bacteria 14336
408 Ga0496115_0066328 3300048918 Bacteria 2917
409 Ga0496116_0001229 3300048919 Bacteria 29859
410 Ga0496116_0009723 3300048919 Bacteria 8166
411 Ga0496116_0012851 3300048919 Bacteria 6803
412 Ga0496116_0043484 3300048919 Bacteria 3060
413 Ga0496118_0009182 3300048921 Bacteria 10042
414 Ga0496119_0000221 3300048922 Bacteria 79912
415 Ga0496119_0006720 3300048922 Bacteria 10568
416 Ga0496120_0000045 3300048923 Bacteria 191663
417 Ga0496121_0031411 3300048924 Bacteria 4852
418 Ga0496122_0014034 3300048925 Bacteria 7780
419 Ga0496122_0039621 3300048925 Bacteria 3755
420 Ga0496122_0041908 3300048925 Bacteria 3610
421 Ga0496122_0045595 3300048925 Bacteria 3406
422 Ga0496122_0049807 3300048925 Bacteria 3201
423 Ga0496122_0072378 3300048925 Bacteria 2451
424 Ga0496123_0016235 3300048926 Bacteria 6057
425 Ga0496123_0035095 3300048926 Bacteria 3580
426 Ga0496123_0079643 3300048926 Bacteria 2001
427 Ga0496124_0000572 3300048927 Bacteria 62388
428 Ga0496124_0001026 3300048927 Bacteria 44181
429 Ga0496124_0087009 3300048927 Bacteria 2556
430 Ga0496125_0001387 3300048928 Bacteria 35448
431 Ga0496125_0001624 3300048928 Bacteria 31668
432 Ga0496125_0032974 3300048928 Bacteria 4591
433 Ga0496126_0001866 3300048929 Bacteria 30684
434 Ga0496126_0013738 3300048929 Bacteria 8212
435 Ga0496126_0118393 3300048929 Bacteria 2299
436 Ga0501217_053438 3300049661 Bacteria 1062
437 nmdc:mga03683_46626_c1 3300050489 Bacteria 1797
438 nmdc:mga00v17_139666_c1 3300050491 Bacteria 1553
439 nmdc:mga0yw44_76290_c1 3300050492 Bacteria 2092
440 nmdc:mga0k408_6689_c1 3300050493 Bacteria 6145
441 nmdc:mga05p37_127225_c1 3300050507 Bacteria 3128
442 nmdc:mga05p37_155213_c1 3300050507 Bacteria 2798
443 nmdc:mga05p37_7269_c1 3300050507 Bacteria 13064
444 nmdc:mga09592_389098_c1 3300050508 Bacteria 1205
445 nmdc:mga09592_39047_c1 3300050508 Bacteria 3987
446 nmdc:mga09592_44172_c1 3300050508 Bacteria 3750
447 nmdc:mga0qj67_113275_c1 3300050509 Bacteria 2190
448 nmdc:mga0qj67_302392_c1 3300050509 Bacteria 1296
449 nmdc:mga06r32_178445_c1 3300050510 Bacteria 2109
450 nmdc:mga06r32_276262_c1 3300050510 Bacteria 1667
451 nmdc:mga06r32_2781_c1 3300050510 Bacteria 15670
452 nmdc:mga06r32_403352_c1 3300050510 Bacteria 1349
453 nmdc:mga08y16_1319_c1 3300050511 Bacteria 24661
454 nmdc:mga08y16_160740_c1 3300050511 Bacteria 2334
455 nmdc:mga08y16_385940_c1 3300050511 Bacteria 1435
456 nmdc:mga0n895_131278_c1 3300050512 Bacteria 2530
457 nmdc:mga0n895_200860_c1 3300050512 Bacteria 2025
458 nmdc:mga0n895_27665_c1 3300050512 Bacteria 5389
459 nmdc:mga0n895_33377_c1 3300050512 Bacteria 4947
460 nmdc:mga0n895_62794_c1 3300050512 Bacteria 3672
461 nmdc:mga0rr50_210908_c1 3300050513 Bacteria 1600
462 nmdc:mga0rr50_23097_c1 3300050513 Bacteria 4282
463 nmdc:mga08x19_10569_c1 3300050514 Bacteria 5547
464 nmdc:mga08x19_58962_c1 3300050514 Bacteria 2484
465 nmdc:mga0a205_1552_c1 3300050515 Bacteria 19656
466 nmdc:mga0a205_34280_c1 3300050515 Bacteria 4871
467 nmdc:mga0a205_353464_c1 3300050515 Bacteria 1336
468 nmdc:mga0a205_374888_c1 3300050515 Bacteria 1288
469 nmdc:mga0a205_57921_c1 3300050515 Bacteria 3741
470 Ga0495601_0257379 3300053077 Bacteria 1140
471 Ga0495595_0013478 3300053084 Bacteria 3453
472 Ga0500637_0048872 3300053178 Unclassified 2407
473 Ga0590077_008227 3300059426 Bacteria 2136
474 2524186159 2524023129 Bacteria 6762600
475 2550906626 2548877040 Bacteria 7507281
476 2563929038 2563366752 Bacteria 4961801
477 2571527628 2571042143 Bacteria 6986194
478 2573037312 2571042588 Bacteria 5045676
479 2578337662 2576861424 Bacteria 5270569
480 2580934032 2579778775 Bacteria 5360914
481 2601638739 2600255286 Bacteria 5390125
482 2621276000 2619619294 Bacteria 5575484
483 2643738413 2643221543 Bacteria 6628015
484 2723604583 2721755693 Bacteria 6126117
485 2728530285 2728368933 Bacteria 7044283
486 2730135224 2728369359 Bacteria 5621728
487 2738817883 2738541295 Bacteria 5730091
488 2753809966 2751185905 Bacteria 6142767
489 2793184436 2791355222 Bacteria 5898266
490 2802436845 2802428803 Bacteria 5806948
491 2821114279 2821111986 Bacteria 6894338
492 2857474034 2857472729 Bacteria 6568124
493 2864737471 2864733723 Bacteria 6770668
494 2865003739 2865002811 Bacteria 6333767
495 2881636995 2881636855 Bacteria 5205297
496 2885527735 2885526491 Bacteria 7164189
497 2889046386 2889042446 Bacteria 7618936
498 2889280490 2889276214 Bacteria 5979355
499 2904115703 2904113452 Bacteria 7796941
500 2904163624 2904162308 Bacteria 7086713
501 2904493289 2904490793 Bacteria 7046938
502 2904595578 2904595352 Bacteria 6124848
503 2907205170 2907202186 Bacteria 6632024
504 2919162581 2919160200 Bacteria 6929020
505 2931389835 2931384279 Bacteria 7299545
506 2938651878 2938649242 Bacteria 7118381
507 2939680778 2939679117 Bacteria 6921672
508 2939705331 2939702853 Bacteria 5139229
509 2945991474 2945991243 Bacteria 7008369
510 2946054169 2946053406 Bacteria 6978655
511 2968560726 2968558590 Bacteria 6956864
512 2971407780 2971403814 Bacteria 7370929
513 2971512262 2971511577 Bacteria 5404012
514 2980177358 2980176882 Bacteria 5397533
515 2984530023 2984527788 Bacteria 5288478
516 2984536128 2984532647 Bacteria 5288506
517 2988231930 2988225383 Bacteria 7221625
518 2996638234 2996632988 Bacteria 6921523
519 2996709839 2996706504 Bacteria 5757485
520 3006982239 3006978542 Bacteria 5328100
521 648170624 648028048 Bacteria 5394884
522 8002320544 8002317523 Bacteria 8051857
523 8054469515 8054465665 Bacteria 7323556
524 8055635561 8055632911 Bacteria 5283357
525 8057478232 8057473075 Bacteria 5892720
526 8057739443 8057733483 Bacteria 6578323
527 8057978841 8057977335 Bacteria 5694872
528 Ga0070658_10275794
529 MBSR1b_contig_10852878
530 JGI25162J39368_1004829
531 Ga0006562J51391_1002201
532 Ga0055538_1000136
533 Ga0055535_1003604
534 Ga0055541_1001498
535 Ga0055541_1009946
536 Ga0070658_10216976
537 Ga0070658_10268584
538 Ga0070676_10029620
539 Ga0070676_10080054
540 Ga0070683_100002047
541 Ga0070683_100013939
542 Ga0070683_100036410
543 Ga0070683_100155361
544 Ga0070690_100158169
545 Ga0070670_100024211
546 Ga0070670_100025023
547 Ga0070670_100033642
548 Ga0070677_10012745
549 Ga0068869_100092016
550 Ga0070680_100083742
551 Ga0070680_100134025
552 Ga0068868_100012746
553 Ga0068868_100123054
554 Ga0070660_100074994
555 Ga0070689_100004502
556 Ga0070689_100081790
557 Ga0070691_10002872
558 Ga0070691_10045453
559 Ga0070687_100003342
560 Ga0070661_100005878
561 Ga0070661_100018111
562 Ga0070661_100216500
563 Ga0070661_100438354
564 Ga0070668_100010618
565 Ga0070668_100197751
566 Ga0070669_100003709
567 Ga0070669_100006986
568 Ga0070669_100018032
569 Ga0070669_100018617
570 Ga0070669_100439877
571 Ga0070675_100016968
572 Ga0070671_100113718
573 Ga0070674_100019674
574 Ga0070673_100002435
575 Ga0070673_100005506
576 Ga0070673_100018551
577 Ga0070688_100008192
578 Ga0070688_100098563
579 Ga0070659_100007256
580 Ga0070659_100151525
581 Ga0070659_100227566
582 Ga0070667_100185733
583 Ga0070714_100039605
584 Ga0070713_100001008
585 Ga0070701_10001343
586 Ga0070701_10018075
587 Ga0070705_100181786
588 Ga0070694_100024822
589 Ga0070694_100064037
590 Ga0070708_100005601
591 Ga0070708_100013913
592 Ga0070708_100243024
593 Ga0070663_100047300
594 Ga0070678_100123726
595 Ga0070662_100024778
596 Ga0070662_100104126
597 Ga0070681_10001693
598 Ga0068867_100071679
599 Ga0068867_100230612
600 Ga0070685_10018043
601 Ga0070706_100005629
602 Ga0070706_100005965
603 Ga0070706_100009068
604 Ga0070706_100024474
605 Ga0070706_100121752
606 Ga0070706_100128083
607 Ga0070707_100005485
608 Ga0070707_100100656
609 Ga0070698_100000438
610 Ga0070698_100252623
611 Ga0070698_100281789
612 Ga0070699_100004243
613 Ga0070699_100006704
614 Ga0070699_100075053
615 Ga0070679_100035244
616 Ga0070684_100000591
617 Ga0070684_100026455
618 Ga0070684_100047712
619 Ga0070697_100011732
620 Ga0070697_100215708
621 Ga0068853_100008069
622 Ga0068853_100458934
623 Ga0070672_100002424
624 Ga0070672_100243604
625 Ga0070686_100033045
626 Ga0070695_100148686
627 Ga0070696_100378982
628 Ga0070693_100201799
629 Ga0070665_100081760
630 Ga0070665_100523263
631 Ga0070704_100444692
632 Ga0070704_100468663
633 Ga0068855_100038163
634 Ga0070664_100004327
635 Ga0070664_100022723
636 Ga0070664_100033544
637 Ga0070664_100188828
638 Ga0070664_100306555
639 Ga0068857_100008871
640 Ga0068857_100010398
641 Ga0068857_100016859
642 Ga0068857_100217671
643 Ga0068854_100083079
644 Ga0068854_100096410
645 Ga0068856_100004267
646 Ga0070702_100016196
647 Ga0068852_100036200
648 Ga0068852_100143705
649 Ga0068852_100196659
650 Ga0068859_100063284
651 Ga0068859_100211064
652 Ga0068864_100011601
653 Ga0068864_100300556
654 Ga0068866_10032233
655 Ga0068861_100001333
656 Ga0068861_100086725
657 Ga0068851_10036697
658 Ga0068870_10112324
659 Ga0068863_100069860
660 Ga0068863_100086606
661 Ga0068858_100021354
662 Ga0068858_100040650
663 Ga0068860_100012357
664 Ga0068862_100000825
665 Ga0068862_100043284
666 Ga0068862_100128628
667 Ga0081539_10001120
668 Ga0081539_10126230
669 Ga0070717_10046165
670 Ga0070717_10102480
671 Ga0070717_10454858
672 Ga0075365_10057822
673 Ga0075363_100091271
674 Ga0075362_10074895
675 Ga0075366_10005245
676 Ga0097621_100235869
677 Ga0068871_100529816
678 Ga0075428_100008312
679 Ga0075428_100012729
680 Ga0075428_100014382
681 Ga0075428_100053821
682 Ga0075428_100087914
683 Ga0075428_100207228
684 Ga0075430_100002963
685 Ga0075430_100126199
686 Ga0075431_100033829
687 Ga0075431_100220716
688 Ga0075433_10000233
689 Ga0075433_10002585
690 Ga0075433_10028367
691 Ga0075433_10030837
692 Ga0075433_10092602
693 Ga0075434_100000314
694 Ga0075434_100005330
695 Ga0075434_100015153
696 Ga0075434_100032599
697 Ga0075434_100052234
698 Ga0075434_100465585
699 Ga0075429_100024469
700 Ga0075429_100024964
701 Ga0075429_100133370
702 Ga0075429_100338538
703 Ga0068865_100102695
704 Ga0075436_100053703
705 Ga0075436_100067308
706 Ga0097620_100063283
707 Ga0097620_100211063
708 Ga0075435_100002838
709 Ga0075435_100060275
710 Ga0105244_10032786
711 Ga0111539_10003639
712 Ga0111539_10016566
713 Ga0111539_10130137
714 Ga0111539_10251749
715 Ga0105245_10071705
716 Ga0114129_10009241
717 Ga0114129_10014787
718 Ga0114129_10088921
719 Ga0114129_10112240
720 Ga0114129_10147828
721 Ga0114129_10219655
722 Ga0114129_10409591
723 Ga0105243_10038315
724 Ga0105241_10354562
725 Ga0105242_10042525
726 Ga0105248_10009215
727 Ga0105248_10011221
728 Ga0105248_10103624
729 Ga0105248_10149739
730 Ga0105248_10416530
731 Ga0105249_10000665
732 Ga0105249_10028565
733 Ga0105249_10283287
734 Ga0105246_10014400
735 Ga0157371_10008058
736 Ga0157371_10168923
737 Ga0157370_10182431
738 Ga0157369_10006102
739 Ga0157369_10179790
740 Ga0157369_10336621
741 Ga0163162_10004121
742 Ga0163162_10277039
743 Ga0163162_10777902
744 Ga0157372_10182921
745 Ga0157372_10424674
746 Ga0157375_10012559
747 Ga0157375_10017400
748 Ga0157375_10026806
749 Ga0157375_10223342
750 Ga0163163_10005980
751 Ga0157380_10009092
752 Ga0157380_10213103
753 Ga0157377_10099509
754 Ga0157379_10016617
755 Ga0163161_10038571
756 Ga0206356_10008437
757 Ga0206349_1554179
758 Ga0206355_1174927
759 Ga0206351_10804232
760 Ga0206352_10131924
761 Ga0206350_11459179
762 Ga0206350_11570404
763 Ga0206354_10143697
764 Ga0206354_10782550
765 Ga0206353_11663656
766 Ga0224712_10007351
767 Ga0224712_10010067
768 Ga0224712_10014388
769 Ga0209784_100085
770 Ga0209566_100015
771 Ga0209566_100090
772 Ga0209437_100571
773 Ga0209258_100669
774 Ga0209025_1007644
775 Ga0207697_10003131
776 Ga0207656_10073781
777 Ga0207655_1061308
778 Ga0207653_10009160
779 Ga0207653_10099737
780 Ga0207642_10013319
781 Ga0207688_10014975
782 Ga0207647_10083692
783 Ga0207645_10000951
784 Ga0207645_10059214
785 Ga0207645_10079470
786 Ga0207643_10006225
787 Ga0207643_10040142
788 Ga0207705_10296712
789 Ga0207684_10002752
790 Ga0207684_10003942
791 Ga0207684_10004787
792 Ga0207684_10011659
793 Ga0207684_10027809
794 Ga0207684_10028472
795 Ga0207684_10072043
796 Ga0207707_10055068
797 Ga0207707_10151019
798 Ga0207693_10054896
799 Ga0207663_10158595
800 Ga0207660_10014149
801 Ga0207660_10416035
802 Ga0207662_10000600
803 Ga0207657_10022234
804 Ga0207657_10289623
805 Ga0207652_10184208
806 Ga0207646_10012158
807 Ga0207646_10012213
808 Ga0207646_10018265
809 Ga0207646_10031767
810 Ga0207646_10067430
811 Ga0207681_10003025
812 Ga0207681_10017906
813 Ga0207650_10013676
814 Ga0207650_10022275
815 Ga0207650_10022850
816 Ga0207650_10222122
817 Ga0207659_10017970
818 Ga0207659_10034089
819 Ga0207687_10148170
820 Ga0207700_10001607
821 Ga0207664_10056810
822 Ga0207690_10314838
823 Ga0207706_10001908
824 Ga0207706_10045772
825 Ga0207706_10158583
826 Ga0207709_10041229
827 Ga0207670_10085305
828 Ga0207670_10130990
829 Ga0207704_10012070
830 Ga0207691_10000366
831 Ga0207691_10008377
832 Ga0207691_10022639
833 Ga0207691_10202261
834 Ga0207711_10040740
835 Ga0207711_10062422
836 Ga0207711_10276273
837 Ga0207689_10009030
838 Ga0207689_10015290
839 Ga0207661_10006705
840 Ga0207661_10153082
841 Ga0207679_10013335
842 Ga0207679_10015642
843 Ga0207679_10178416
844 Ga0207679_10189018
845 Ga0207667_10120590
846 Ga0207667_10428414
847 Ga0207651_10133448
848 Ga0207651_10194135
849 Ga0207651_10436016
850 Ga0207712_10001698
851 Ga0207658_10089240
852 Ga0207658_10441565
853 Ga0207703_10131695
854 Ga0207678_10004766
855 Ga0207678_10059300
856 Ga0207708_10035775
857 Ga0207702_10000826
858 Ga0207641_10072381
859 Ga0207648_10000817
860 Ga0207676_10245746
861 Ga0207674_10000025
862 Ga0207674_10000247
863 Ga0207674_10009546
864 Ga0207675_100000319
865 Ga0207675_100014183
866 Ga0207675_100020411
867 Ga0207698_10052215
868 Ga0207698_10076145
869 Ga0207428_10000773
870 Ga0207428_10098054
871 Ga0207428_10202851
872 Ga0207428_10243526
873 Ga0268266_10124654
874 Ga0268265_10000988
875 Ga0268265_10003129
876 Ga0268264_10037879
877 Ga0268264_10086192
878 Ga0265338_10116964
879 Ga0265320_10064208
880 Ga0307408_100007531
881 Ga0307406_10000858
882 Ga0307416_100018702
883 Ga0307414_10360185
884 Ga0307411_10522249
885 Ga0373954_0009364
886 Ga0373954_0137711
887 Ga0373956_0000210
888 Ga0373956_0006338
889 Ga0373927_0000142
890 Ga0373933_0046710
891 Ga0373933_0069922
892 Ga0373937_0012727
893 Ga0373937_0100527
894 Ga0436364_0069628
895 Ga0400489_26268
896 Ga0436365_1815152
897 Ga0436363_1253050
898 Ga0439439_0000142
899 Ga0439449_0002253
900 Ga0439449_0040725
901 Ga0439449_0125471
902 Ga0439462_0001202
903 Ga0451577_0054034
904 Ga0466969_0001196
905 Ga0453683_0000269
906 Ga0466966_0004794
907 Ga0466966_0148129
908 Ga0466961_0048099
909 Ga0466964_0030743
910 Ga0466968_0002810
911 Ga0466970_0002149
912 Ga0466957_0039471
913 Ga0466959_0079119
914 Ga0466959_0271955
915 Ga0451576_0559340
916 Ga0466958_0387861
917 Ga0495651_0357316
918 Ga0495653_0231647
919 Ga0495608_0030933
920 Ga0495661_0132237
921 Ga0495657_0017011
922 Ga0495599_0034485
923 Ga0495660_0016861
924 Ga0495674_0152065
925 Ga0495674_0259682
926 Ga0495672_0000569
927 Ga0495680_0110329
928 Ga0495675_0059481
929 Ga0495602_0090246
930 Ga0495626_0053456
931 Ga0496104_0151597
932 Ga0496105_0283292
933 Ga0496109_0147808
934 Ga0496112_0002709
935 Ga0496115_0066328
936 Ga0496116_0001229
937 Ga0496116_0009723
938 Ga0496116_0012851
939 Ga0496116_0043484
940 Ga0496118_0009182
941 Ga0496119_0000221
942 Ga0496119_0006720
943 Ga0496120_0000045
944 Ga0496121_0031411
945 Ga0496122_0014034
946 Ga0496122_0039621
947 Ga0496122_0041908
948 Ga0496122_0045595
949 Ga0496122_0049807
950 Ga0496122_0072378
951 Ga0496123_0016235
952 Ga0496123_0035095
953 Ga0496123_0079643
954 Ga0496124_0000572
955 Ga0496124_0001026
956 Ga0496124_0087009
957 Ga0496125_0001387
958 Ga0496125_0001624
959 Ga0496125_0032974
960 Ga0496126_0001866
961 Ga0496126_0013738
962 Ga0496126_0118393
963 Ga0501217_053438
964 nmdc:mga03683_46626_c1
965 nmdc:mga00v17_139666_c1
966 nmdc:mga0yw44_76290_c1
967 nmdc:mga0k408_6689_c1
968 nmdc:mga05p37_127225_c1
969 nmdc:mga05p37_155213_c1
970 nmdc:mga05p37_7269_c1
971 nmdc:mga09592_389098_c1
972 nmdc:mga09592_39047_c1
973 nmdc:mga09592_44172_c1
974 nmdc:mga0qj67_113275_c1
975 nmdc:mga0qj67_302392_c1
976 nmdc:mga06r32_178445_c1
977 nmdc:mga06r32_276262_c1
978 nmdc:mga06r32_2781_c1
979 nmdc:mga06r32_403352_c1
980 nmdc:mga08y16_1319_c1
981 nmdc:mga08y16_160740_c1
982 nmdc:mga08y16_385940_c1
983 nmdc:mga0n895_131278_c1
984 nmdc:mga0n895_200860_c1
985 nmdc:mga0n895_27665_c1
986 nmdc:mga0n895_33377_c1
987 nmdc:mga0n895_62794_c1
988 nmdc:mga0rr50_210908_c1
989 nmdc:mga0rr50_23097_c1
990 nmdc:mga08x19_10569_c1
991 nmdc:mga08x19_58962_c1
992 nmdc:mga0a205_1552_c1
993 nmdc:mga0a205_34280_c1
994 nmdc:mga0a205_353464_c1
995 nmdc:mga0a205_374888_c1
996 nmdc:mga0a205_57921_c1
997 Ga0495601_0257379
998 Ga0495595_0013478
999 Ga0500637_0048872
1000 Ga0590077_008227
1001 2524186159
1002 2550906626
1003 2563929038
1004 2571527628
1005 2573037312
1006 2578337662
1007 2580934032
1008 2601638739
1009 2621276000
1010 2643738413
1011 2723604583
1012 2728530285
1013 2730135224
1014 2738817883
1015 2753809966
1016 2793184436
1017 2802436845
1018 2821114279
1019 2857474034
1020 2864737471
1021 2865003739
1022 2881636995
1023 2885527735
1024 2889046386
1025 2889280490
1026 2904115703
1027 2904163624
1028 2904493289
1029 2904595578
1030 2907205170
1031 2919162581
1032 2931389835
1033 2938651878
1034 2939680778
1035 2939705331
1036 2945991474
1037 2946054169
1038 2968560726
1039 2971407780
1040 2971512262
1041 2980177358
1042 2984530023
1043 2984536128
1044 2988231930
1045 2996638234
1046 2996709839
1047 3006982239
1048 648170624
1049 8002320544
1050 8054469515
1051 8055635561
1052 8057478232
1053 8057739443
1054 8057978841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

198

294

0.99

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

17

196

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7eme-assembly1.cif.gz_B putative leptospira interrogans recombinant l-amino acid oxidase 0.9877 5 35
7vwp-assembly2.cif.gz_B structure of the flavin-dependent monooxygenase flso1 from the biosynthesis of fluostatinsin 0.9796 7 35
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 0.9781 6 35
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.9775 5 35
4icy-assembly1.cif.gz_A-2 tracing the evolution of angucyclinone monooxygenases: structural determinants for c-12b hydroxylation and substrate inhibition in pgae 0.9743 7 35
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9925 7 35 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9879 7 35 3.50.50.60
6acqA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9867 195 279 1.10.1040.10
6hrdD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9856 195 279 1.10.1040.10
4kueB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9851 195 279 1.10.1040.10
ID Description Score Start End GO Terms
AF-H9V6S3-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase C-terminal domain-containing protein 0.996 192 283 GO:0006631
GO:0016616
AF-A0A519PEM2-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9905 192 283 GO:0006631
GO:0008691
AF-A0A656TFL7-F1-model_v4 deleted 0.9905 196 283
AF-T1BIX9-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9898 185 283 GO:0006631
GO:0016616
AF-A0A2V8F207-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9892 184 283 GO:0003857
GO:0006635

Map