F459392

General Info

Members Datasets Scaffolds Average Seq Length
526 343 516 361

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10094460|Ga0111539_100944606
Length 400
Sequence MQFGRAVPTIVSPRRMVGTARFQSHHLLRARRNAPLPTLHFIMRTDLFDFELPADRIALRPVSPRDAAQLLVVRPGQASEYEDRGIADLPDLLAPGDALVFNDTRVIAARLSGRRVGRGEEPRIEATLTKRLDGSRWRALVRPAKKLKPGDVVRFGEEGRVCFLGQLDATVEEKGHEGEVTLAFAFHGPVLDSAIDERGDMPLPPYIASRRPPDARDRDDYQTMFARQEGSVAAPTAALHFTENLVERLRQRGVALHFVTLHVGPGTFLPVKADDTSAHHMHPEWGTVSPETASALNAVHRAGGRIVAVGSTSLRLLETAATDDGALRPFSGDTALFITPGDRFRVVDVMLTNFHLPRSTLFMLVAAFSGLDVMQRAYAHAIRAGYRFYSYGDACLLFRA

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2643221640 Caulobacter sp. Root342 Isolate Unclassified
4 2643221642 Caulobacter sp. Root343 Isolate Unclassified
5 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
6 2851153111 Caulobacter radicis 736 Isolate Unclassified
7 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
8 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
9 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
10 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
333 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
334 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
335 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
336 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
337 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
338 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
339 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
340 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0
Isolates 1.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.27
Nodule 0
Rhizoplane 9.89
Rhizosphere 81.56
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000689 3300003781 Bacteria 22680
2 Ga0055536_1000750 3300003781 Bacteria 21664
3 Ga0055530_10001625 3300003791 Bacteria 16093
4 Ga0055530_10004094 3300003791 Bacteria 7762
5 Ga0055531_10000307 3300003794 Bacteria 48396
6 Ga0070676_10006454 3300005328 Bacteria 6270
7 Ga0070690_100000610 3300005330 Bacteria 18087
8 Ga0070670_100001815 3300005331 Bacteria 17406
9 Ga0070666_10002138 3300005335 Bacteria 12008
10 Ga0070680_100027419 3300005336 Bacteria 4561
11 Ga0070660_100083717 3300005339 Bacteria 2506
12 Ga0070660_100170271 3300005339 Bacteria 1759
13 Ga0070689_100001684 3300005340 Bacteria 14130
14 Ga0070689_100009603 3300005340 Bacteria 6865
15 Ga0070691_10045255 3300005341 Bacteria 2088
16 Ga0070661_100004008 3300005344 Bacteria 10125
17 Ga0070692_10003164 3300005345 Bacteria 6610
18 Ga0070668_100006577 3300005347 Bacteria 8609
19 Ga0070669_100001652 3300005353 Bacteria 16134
20 Ga0070675_100001837 3300005354 Bacteria 15692
21 Ga0070671_100010824 3300005355 Bacteria 7319
22 Ga0070674_100002900 3300005356 Bacteria 9496
23 Ga0070674_100232351 3300005356 Bacteria 1440
24 Ga0070673_100000178 3300005364 Bacteria 31036
25 Ga0070673_100228694 3300005364 Bacteria 1613
26 Ga0070688_100001229 3300005365 Bacteria 12784
27 Ga0070659_100007056 3300005366 Bacteria 8139
28 Ga0070667_100011689 3300005367 Bacteria 7256
29 Ga0070667_100211545 3300005367 Bacteria 1723
30 Ga0070703_10005299 3300005406 Bacteria 3601
31 Ga0070709_10016209 3300005434 Bacteria 4250
32 Ga0070714_100029999 3300005435 Bacteria 4525
33 Ga0070713_100011743 3300005436 Bacteria 6395
34 Ga0070710_10002055 3300005437 Bacteria 9535
35 Ga0070701_10139826 3300005438 Bacteria 1383
36 Ga0070711_100014106 3300005439 Bacteria 5029
37 Ga0070711_100067472 3300005439 Bacteria 2510
38 Ga0070705_100001032 3300005440 Bacteria 15518
39 Ga0070700_100044677 3300005441 Bacteria 2730
40 Ga0070700_100144883 3300005441 Bacteria 1618
41 Ga0070694_100000754 3300005444 Bacteria 18116
42 Ga0070663_100001099 3300005455 Bacteria 14848
43 Ga0070678_100002107 3300005456 Bacteria 10790
44 Ga0070662_100003112 3300005457 Bacteria 10304
45 Ga0070681_10146561 3300005458 Bacteria 2289
46 Ga0068867_100056422 3300005459 Bacteria 2906
47 Ga0070679_100150659 3300005530 Bacteria 2303
48 Ga0070684_100013716 3300005535 Bacteria 6541
49 Ga0070697_100002089 3300005536 Bacteria 15283
50 Ga0068853_100002601 3300005539 Bacteria 13569
51 Ga0068853_100016114 3300005539 Bacteria 6147
52 Ga0070672_100004259 3300005543 Bacteria 9355
53 Ga0070686_100028638 3300005544 Bacteria 3380
54 Ga0070686_100093949 3300005544 Bacteria 2012
55 Ga0070695_100001920 3300005545 Bacteria 11764
56 Ga0070696_100001022 3300005546 Bacteria 18054
57 Ga0070693_100002127 3300005547 Bacteria 9068
58 Ga0070665_100022148 3300005548 Bacteria 6391
59 Ga0070704_100000591 3300005549 Bacteria 17382
60 Ga0068855_100046800 3300005563 Bacteria 5112
61 Ga0070664_100016985 3300005564 Bacteria 5973
62 Ga0068857_100006522 3300005577 Bacteria 10013
63 Ga0068854_100012704 3300005578 Bacteria 5514
64 Ga0068856_100019043 3300005614 Bacteria 6660
65 Ga0068856_100162187 3300005614 Bacteria 2246
66 Ga0070702_100000503 3300005615 Bacteria 14034
67 Ga0070702_100005628 3300005615 Bacteria 5860
68 Ga0068852_100005695 3300005616 Bacteria 8936
69 Ga0068859_100006718 3300005617 Bacteria 11686
70 Ga0068864_100054195 3300005618 Bacteria 3461
71 Ga0068866_10001746 3300005718 Bacteria 9141
72 Ga0068861_100005178 3300005719 Bacteria 8797
73 Ga0068863_100031708 3300005841 Bacteria 5042
74 Ga0068858_100034409 3300005842 Bacteria 4699
75 Ga0068860_100014904 3300005843 Bacteria 7601
76 Ga0068860_100164978 3300005843 Bacteria 2138
77 Ga0068862_100006841 3300005844 Bacteria 9453
78 Ga0068862_100114361 3300005844 Bacteria 2372
79 Ga0081455_10003512 3300005937 Bacteria 18009
80 Ga0081540_1000762 3300005983 Bacteria 29651
81 Ga0081540_1010588 3300005983 Bacteria 6231
82 Ga0075365_10034315 3300006038 Bacteria 3276
83 Ga0075364_10055588 3300006051 Bacteria 2590
84 Ga0070715_10002047 3300006163 Bacteria 6081
85 Ga0070716_100000897 3300006173 Bacteria 12870
86 Ga0070712_100004972 3300006175 Bacteria 8224
87 Ga0070712_100017748 3300006175 Bacteria 4610
88 Ga0070712_100036199 3300006175 Bacteria 3357
89 Ga0075367_10086146 3300006178 Bacteria 1906
90 Ga0075369_10002442 3300006186 Bacteria 6627
91 Ga0075366_10071641 3300006195 Bacteria 2065
92 Ga0097621_100243010 3300006237 Bacteria 1574
93 Ga0068871_100134613 3300006358 Bacteria 2098
94 Ga0075428_100151733 3300006844 Bacteria 2517
95 Ga0075430_100000184 3300006846 Bacteria 41914
96 Ga0075430_100057643 3300006846 Bacteria 3267
97 Ga0075431_100104659 3300006847 Bacteria 2920
98 Ga0075431_100141016 3300006847 Bacteria 2484
99 Ga0075431_100193606 3300006847 Bacteria 2082
100 Ga0075433_10032682 3300006852 Bacteria 4458
101 Ga0075433_10324687 3300006852 Bacteria 1361
102 Ga0075434_100023235 3300006871 Bacteria 6039
103 Ga0075434_100076270 3300006871 Bacteria 3347
104 Ga0075434_100180360 3300006871 Bacteria 2132
105 Ga0075434_100236449 3300006871 Bacteria 1847
106 Ga0075429_100287795 3300006880 Bacteria 1439
107 Ga0075429_100315959 3300006880 Bacteria 1367
108 Ga0068865_100001831 3300006881 Bacteria 12494
109 Ga0068865_100015795 3300006881 Bacteria 4818
110 Ga0075436_100229322 3300006914 Bacteria 1319
111 Ga0097620_100006718 3300006931 Bacteria 11686
112 Ga0075435_100211854 3300007076 Bacteria 1644
113 Ga0105240_10029175 3300009093 Bacteria 7194
114 Ga0111539_10094460 3300009094 Bacteria 3513
115 Ga0111539_10107927 3300009094 Bacteria 3266
116 Ga0105247_10001700 3300009101 Bacteria 15532
117 Ga0114129_10004024 3300009147 Bacteria 20739
118 Ga0114129_10097903 3300009147 Bacteria 4061
119 Ga0105243_10006393 3300009148 Bacteria 9103
120 Ga0105241_10004531 3300009174 Bacteria 10280
121 Ga0105242_10003507 3300009176 Bacteria 12190
122 Ga0105242_10123359 3300009176 Bacteria 2227
123 Ga0105248_10017589 3300009177 Bacteria 7885
124 Ga0105248_10146055 3300009177 Bacteria 2669
125 Ga0105237_10042872 3300009545 Bacteria 4561
126 Ga0105238_10047170 3300009551 Bacteria 4345
127 Ga0105238_10298769 3300009551 Bacteria 1593
128 Ga0105249_10005672 3300009553 Bacteria 10798
129 Ga0105249_10014958 3300009553 Bacteria 6862
130 Ga0105246_10001845 3300011119 Bacteria 12721
131 Ga0157373_10007439 3300013100 Bacteria 8146
132 Ga0157373_10019877 3300013100 Bacteria 4885
133 Ga0157371_10004963 3300013102 Bacteria 11425
134 Ga0157370_10064469 3300013104 Bacteria 3469
135 Ga0157369_10019012 3300013105 Bacteria 7694
136 Ga0157369_10301019 3300013105 Bacteria 1668
137 Ga0157374_10008799 3300013296 Bacteria 8640
138 Ga0163162_10005855 3300013306 Bacteria 11893
139 Ga0163162_10382928 3300013306 Bacteria 1540
140 Ga0157372_10016968 3300013307 Bacteria 7817
141 Ga0157375_10002853 3300013308 Bacteria 14966
142 Ga0157375_10246405 3300013308 Bacteria 1947
143 Ga0163163_10284633 3300014325 Bacteria 1705
144 Ga0157377_10056121 3300014745 Bacteria 2235
145 Ga0157379_10003063 3300014968 Bacteria 14133
146 Ga0157379_10023810 3300014968 Bacteria 5435
147 Ga0157376_10000570 3300014969 Bacteria 23753
148 Ga0163161_10004937 3300017792 Bacteria 9279
149 Ga0163161_10005377 3300017792 Bacteria 8895
150 Ga0209233_1026553 3300025261 Bacteria 1414
151 Ga0209676_1000136 3300025292 Bacteria 181860
152 Ga0209676_1000200 3300025292 Bacteria 133793
153 Ga0209050_1000057 3300025298 Bacteria 326289
154 Ga0209050_1000568 3300025298 Bacteria 59952
155 Ga0209051_1000836 3300025303 Bacteria 31706
156 Ga0209257_1000142 3300025304 Bacteria 200756
157 Ga0209257_1008523 3300025304 Bacteria 5796
158 Ga0207696_1011469 3300025711 Bacteria 3188
159 Ga0207692_10004819 3300025898 Bacteria 5365
160 Ga0207692_10022950 3300025898 Bacteria 2879
161 Ga0207642_10003910 3300025899 Bacteria 4752
162 Ga0207688_10006083 3300025901 Bacteria 6565
163 Ga0207688_10061769 3300025901 Bacteria 2112
164 Ga0207680_10019280 3300025903 Bacteria 3645
165 Ga0207647_10009635 3300025904 Bacteria 6857
166 Ga0207685_10000315 3300025905 Bacteria 7745
167 Ga0207699_10056913 3300025906 Bacteria 2333
168 Ga0207645_10002711 3300025907 Bacteria 13796
169 Ga0207643_10056900 3300025908 Bacteria 2225
170 Ga0207705_10033846 3300025909 Bacteria 3652
171 Ga0207654_10020566 3300025911 Bacteria 3501
172 Ga0207707_10070603 3300025912 Bacteria 3043
173 Ga0207707_10295676 3300025912 Bacteria 1401
174 Ga0207695_10034247 3300025913 Bacteria 5528
175 Ga0207693_10005832 3300025915 Bacteria 10221
176 Ga0207693_10009760 3300025915 Bacteria 7815
177 Ga0207693_10064726 3300025915 Bacteria 2864
178 Ga0207660_10060813 3300025917 Bacteria 2717
179 Ga0207657_10001866 3300025919 Bacteria 22797
180 Ga0207657_10061464 3300025919 Bacteria 3221
181 Ga0207649_10003925 3300025920 Bacteria 8112
182 Ga0207652_10040109 3300025921 Bacteria 3975
183 Ga0207652_10113660 3300025921 Bacteria 2403
184 Ga0207652_10121335 3300025921 Bacteria 2326
185 Ga0207681_10002877 3300025923 Bacteria 10880
186 Ga0207694_10118449 3300025924 Bacteria 2112
187 Ga0207650_10003214 3300025925 Bacteria 11266
188 Ga0207659_10005097 3300025926 Bacteria 7963
189 Ga0207687_10006111 3300025927 Bacteria 7970
190 Ga0207664_10016876 3300025929 Bacteria 5338
191 Ga0207664_10020295 3300025929 Bacteria 4922
192 Ga0207644_10036741 3300025931 Bacteria 3440
193 Ga0207690_10005451 3300025932 Bacteria 7499
194 Ga0207706_10001431 3300025933 Bacteria 23899
195 Ga0207686_10205753 3300025934 Bacteria 1412
196 Ga0207709_10011736 3300025935 Bacteria 4830
197 Ga0207670_10041153 3300025936 Bacteria 3037
198 Ga0207669_10035805 3300025937 Bacteria 2829
199 Ga0207704_10008153 3300025938 Bacteria 4990
200 Ga0207665_10002101 3300025939 Bacteria 13465
201 Ga0207711_10107406 3300025941 Bacteria 2478
202 Ga0207661_10037213 3300025944 Bacteria 3805
203 Ga0207679_10140179 3300025945 Bacteria 1953
204 Ga0207651_10004133 3300025960 Bacteria 7252
205 Ga0207668_10186940 3300025972 Bacteria 1638
206 Ga0207668_10187642 3300025972 Bacteria 1636
207 Ga0207640_10043745 3300025981 Bacteria 2864
208 Ga0207658_10007506 3300025986 Bacteria 7427
209 Ga0207658_10095163 3300025986 Bacteria 2320
210 Ga0207677_10271896 3300026023 Bacteria 1387
211 Ga0207703_10207185 3300026035 Bacteria 1746
212 Ga0207639_10022411 3300026041 Bacteria 4550
213 Ga0207639_10124471 3300026041 Bacteria 2124
214 Ga0207639_10256449 3300026041 Bacteria 1527
215 Ga0207678_10002104 3300026067 Bacteria 18028
216 Ga0207708_10001818 3300026075 Bacteria 15746
217 Ga0207708_10210519 3300026075 Bacteria 1554
218 Ga0207702_10008843 3300026078 Bacteria 8488
219 Ga0207702_10144045 3300026078 Bacteria 2160
220 Ga0207702_10253238 3300026078 Bacteria 1654
221 Ga0207641_10326889 3300026088 Bacteria 1455
222 Ga0207648_10011227 3300026089 Bacteria 8446
223 Ga0207674_10004952 3300026116 Bacteria 15911
224 Ga0207675_100000249 3300026118 Bacteria 51517
225 Ga0207675_100076325 3300026118 Bacteria 3138
226 Ga0207683_10001156 3300026121 Bacteria 24004
227 Ga0207683_10058139 3300026121 Bacteria 3395
228 Ga0207683_10211819 3300026121 Bacteria 1764
229 Ga0207698_10010099 3300026142 Bacteria 6047
230 Ga0268266_10023678 3300028379 Bacteria 5227
231 Ga0268264_10005008 3300028381 Bacteria 11210
232 Ga0307515_10056829 3300028794 Bacteria 5677
233 Ga0265338_10088214 3300028800 Bacteria 2575
234 Ga0265325_10002730 3300031241 Bacteria 11787
235 Ga0265325_10009871 3300031241 Bacteria 5558
236 Ga0307513_10058634 3300031456 Bacteria 4090
237 Ga0265313_10017035 3300031595 Bacteria 4150
238 Ga0316579_10115121 3300031691 Bacteria 1291
239 Ga0265314_10135445 3300031711 Bacteria 1530
240 Ga0265342_10014994 3300031712 Bacteria 5118
241 Ga0373938_0005178 3300034957 Bacteria 2209
242 Ga0373926_0000693 3300035083 Bacteria 9301
243 Ga0373929_0015725 3300035085 Bacteria 1475
244 Ga0373951_0024061 3300035091 Bacteria 1409
245 Ga0373936_0002391 3300035113 Bacteria 7024
246 Ga0373936_0033542 3300035113 Bacteria 2035
247 Ga0373939_0006158 3300035114 Bacteria 2884
248 Ga0373939_0042429 3300035114 Bacteria 1375
249 Ga0373941_0008486 3300035115 Bacteria 2553
250 Ga0373945_0005113 3300035116 Bacteria 4186
251 Ga0373945_0008225 3300035116 Bacteria 3393
252 Ga0373954_0002383 3300035118 Bacteria 7863
253 Ga0373957_0010302 3300035120 Bacteria 3086
254 Ga0373943_0000268 3300035170 Bacteria 21475
255 Ga0373943_0036377 3300035170 Bacteria 2358
256 Ga0373946_0034498 3300035171 Bacteria 2043
257 Ga0373955_0000399 3300035172 Bacteria 18379
258 Ga0373961_0005801 3300035241 Bacteria 2964
259 Ga0373924_0001527 3300035410 Bacteria 7550
260 Ga0373931_0004198 3300035691 Bacteria 6560
261 Ga0373931_0026950 3300035691 Bacteria 2929
262 Ga0373931_0044485 3300035691 Bacteria 2342
263 Ga0373931_0051276 3300035691 Bacteria 2197
264 Ga0373931_0146765 3300035691 Bacteria 1372
265 Ga0373935_0000286 3300035692 Bacteria 24948
266 Ga0373935_0026063 3300035692 Bacteria 3605
267 Ga0373935_0032185 3300035692 Bacteria 3258
268 Ga0373935_0159801 3300035692 Bacteria 1535
269 Ga0373935_0274400 3300035692 Bacteria 1186
270 Ga0373927_0001748 3300035695 Bacteria 16212
271 Ga0373927_0005366 3300035695 Bacteria 8856
272 Ga0373927_0036597 3300035695 Bacteria 3191
273 Ga0373927_0040440 3300035695 Bacteria 3024
274 Ga0373933_0005496 3300035724 Bacteria 6905
275 Ga0373947_0001270 3300035725 Bacteria 15552
276 Ga0373947_0007076 3300035725 Bacteria 6502
277 Ga0373947_0007690 3300035725 Bacteria 6228
278 Ga0373947_0010286 3300035725 Bacteria 5368
279 Ga0373937_0000695 3300036401 Bacteria 29345
280 Ga0373925_0000019 3300037068 Bacteria 170628
281 Ga0373925_0012774 3300037068 Bacteria 6083
282 Ga0373925_0028134 3300037068 Bacteria 4117
283 Ga0395900_0005362 3300037418 Bacteria 13439
284 Ga0395898_0008423 3300037466 Bacteria 10902
285 Ga0395905_0002905 3300037471 Bacteria 18696
286 Ga0395901_0063898 3300038443 Bacteria 3831
287 Ga0436365_0734149 3300039437 Bacteria 2024
288 Ga0436365_1795903 3300039437 Bacteria 1372
289 Ga0451576_0203921 3300045051 Bacteria 2065
290 Ga0466967_0025986 3300045976 Bacteria 4840
291 Ga0495592_0000005 3300046454 Bacteria 194493
292 Ga0495592_0167865 3300046454 Bacteria 1505
293 Ga0495603_0000114 3300046455 Bacteria 38942
294 Ga0495590_0001808 3300046457 Bacteria 9060
295 Ga0495629_0000430 3300046459 Bacteria 34982
296 Ga0495629_0037713 3300046459 Bacteria 3406
297 Ga0495629_0067171 3300046459 Bacteria 2502
298 Ga0495638_0000600 3300046460 Bacteria 40531
299 Ga0495638_0017040 3300046460 Bacteria 4854
300 Ga0495638_0141988 3300046460 Bacteria 1400
301 Ga0495641_0006916 3300046461 Bacteria 7238
302 Ga0495651_0014746 3300046462 Bacteria 6043
303 Ga0495653_0000017 3300046463 Bacteria 190660
304 Ga0495650_0067344 3300046471 Bacteria 1415
305 Ga0495580_0000080 3300046472 Bacteria 61309
306 Ga0495580_0101972 3300046472 Bacteria 1995
307 Ga0495582_0002704 3300046473 Bacteria 9893
308 Ga0495582_0044243 3300046473 Bacteria 2453
309 Ga0495639_0002522 3300046475 Bacteria 7995
310 Ga0495662_0000724 3300046476 Bacteria 15776
311 Ga0495662_0019870 3300046476 Bacteria 3249
312 Ga0495664_0000014 3300046477 Bacteria 193962
313 Ga0495664_0001240 3300046477 Bacteria 13352
314 Ga0495594_0005083 3300046499 Bacteria 6770
315 Ga0495608_0000034 3300046511 Bacteria 136686
316 Ga0495610_0065308 3300046512 Bacteria 1717
317 Ga0495618_0000011 3300046514 Bacteria 179208
318 Ga0495618_0000925 3300046514 Bacteria 20165
319 Ga0495628_0000017 3300046516 Bacteria 169983
320 Ga0495630_0000472 3300046517 Bacteria 30208
321 Ga0495630_0296067 3300046517 Bacteria 1236
322 Ga0495631_0003894 3300046518 Bacteria 8075
323 Ga0495648_0001025 3300046524 Bacteria 28499
324 Ga0495666_0042384 3300046526 Bacteria 2201
325 Ga0495652_0000008 3300046529 Bacteria 343637
326 Ga0495652_0073238 3300046529 Bacteria 2853
327 Ga0495665_0016593 3300046531 Bacteria 3967
328 Ga0495665_0106375 3300046531 Bacteria 1472
329 Ga0495640_0000024 3300046533 Bacteria 99088
330 Ga0495640_0000947 3300046533 Bacteria 22435
331 Ga0495640_0014456 3300046533 Bacteria 5973
332 Ga0495587_0000039 3300046536 Bacteria 114200
333 Ga0495597_0009230 3300046542 Bacteria 4887
334 Ga0495645_0000006 3300046543 Bacteria 382503
335 Ga0495645_0031508 3300046543 Bacteria 3864
336 Ga0495622_0005445 3300046557 Bacteria 5907
337 Ga0495667_0000026 3300046559 Bacteria 154971
338 Ga0495668_0000014 3300046616 Bacteria 442055
339 Ga0495668_0006444 3300046616 Bacteria 7683
340 Ga0495634_0000009 3300046642 Bacteria 162893
341 Ga0495634_0000941 3300046642 Bacteria 27590
342 Ga0495634_0010307 3300046642 Bacteria 6849
343 Ga0495634_0011375 3300046642 Bacteria 6483
344 Ga0495625_0018457 3300046660 Bacteria 5445
345 Ga0495635_0000014 3300046663 Bacteria 218080
346 Ga0495635_0004745 3300046663 Bacteria 9447
347 Ga0495588_0007588 3300046674 Bacteria 4946
348 Ga0495657_0000038 3300046675 Bacteria 117535
349 Ga0495599_0000010 3300046678 Bacteria 211658
350 Ga0495623_0000074 3300046679 Bacteria 59542
351 Ga0495646_0000008 3300046680 Bacteria 214486
352 Ga0495647_0001891 3300046681 Bacteria 6519
353 Ga0495647_0023940 3300046681 Bacteria 2219
354 Ga0495658_0002490 3300046683 Bacteria 9267
355 Ga0495613_0000335 3300046689 Bacteria 42318
356 Ga0495613_0022544 3300046689 Bacteria 4690
357 Ga0495624_0001454 3300046690 Bacteria 18421
358 Ga0495600_0000213 3300046809 Bacteria 32833
359 Ga0495581_0038077 3300047315 Bacteria 2783
360 Ga0495604_0000006 3300047317 Bacteria 420480
361 Ga0495674_0000009 3300047319 Bacteria 310479
362 Ga0495674_0000859 3300047319 Bacteria 29014
363 Ga0495674_0034072 3300047319 Bacteria 4607
364 Ga0495676_0023022 3300047321 Bacteria 5413
365 Ga0495676_0144489 3300047321 Bacteria 1701
366 Ga0495680_0008445 3300047322 Bacteria 9361
367 Ga0495680_0014658 3300047322 Bacteria 6780
368 Ga0495675_0000044 3300047444 Bacteria 83527
369 Ga0495673_0000123 3300047469 Bacteria 144484
370 Ga0495684_0000015 3300047471 Bacteria 169596
371 Ga0495684_0001275 3300047471 Bacteria 20286
372 Ga0495684_0002706 3300047471 Bacteria 14030
373 Ga0495686_0003073 3300047472 Bacteria 14792
374 Ga0495686_0082493 3300047472 Bacteria 1962
375 Ga0495593_0000148 3300047673 Bacteria 34657
376 Ga0495593_0000735 3300047673 Bacteria 19005
377 Ga0495602_0000006 3300048088 Bacteria 322593
378 Ga0495602_0114619 3300048088 Bacteria 2182
379 Ga0495614_0001428 3300048089 Bacteria 10307
380 Ga0496100_0013285 3300048903 Bacteria 4743
381 Ga0496100_0079551 3300048903 Bacteria 2209
382 Ga0496100_0148066 3300048903 Bacteria 1671
383 Ga0496100_0243954 3300048903 Bacteria 1327
384 Ga0496101_0016350 3300048904 Bacteria 5010
385 Ga0496101_0041223 3300048904 Bacteria 3291
386 Ga0496101_0052923 3300048904 Bacteria 2928
387 Ga0496101_0090733 3300048904 Bacteria 2273
388 Ga0496101_0208951 3300048904 Bacteria 1511
389 Ga0496102_0069549 3300048905 Bacteria 3231
390 Ga0496102_0265132 3300048905 Bacteria 1619
391 Ga0496103_0006988 3300048906 Bacteria 6735
392 Ga0496104_0001526 3300048907 Bacteria 19967
393 Ga0496104_0007852 3300048907 Bacteria 9458
394 Ga0496104_0007867 3300048907 Bacteria 9450
395 Ga0496104_0062647 3300048907 Bacteria 3526
396 Ga0496104_0131757 3300048907 Bacteria 2401
397 Ga0496104_0147940 3300048907 Bacteria 2255
398 Ga0496104_0225193 3300048907 Bacteria 1787
399 Ga0496105_0059001 3300048908 Bacteria 3166
400 Ga0496105_0066074 3300048908 Bacteria 2985
401 Ga0496105_0102488 3300048908 Bacteria 2364
402 Ga0496105_0173400 3300048908 Bacteria 1767
403 Ga0496106_0002576 3300048909 Bacteria 13500
404 Ga0496106_0011183 3300048909 Bacteria 6640
405 Ga0496106_0029579 3300048909 Bacteria 4083
406 Ga0496106_0319982 3300048909 Bacteria 1245
407 Ga0496107_0019640 3300048910 Bacteria 4767
408 Ga0496107_0125250 3300048910 Bacteria 1894
409 Ga0496108_0030216 3300048911 Bacteria 4490
410 Ga0496109_0014004 3300048912 Bacteria 6972
411 Ga0496109_0028071 3300048912 Bacteria 5031
412 Ga0496109_0034072 3300048912 Bacteria 4583
413 Ga0496110_0002003 3300048913 Bacteria 15155
414 Ga0496110_0018081 3300048913 Bacteria 5905
415 Ga0496110_0113717 3300048913 Bacteria 2435
416 Ga0496110_0158966 3300048913 Bacteria 2048
417 Ga0496111_0010887 3300048914 Bacteria 6118
418 Ga0496111_0046921 3300048914 Bacteria 3111
419 Ga0496111_0089412 3300048914 Bacteria 2255
420 Ga0496112_0010822 3300048915 Bacteria 8301
421 Ga0496112_0023334 3300048915 Bacteria 5910
422 Ga0496112_0111445 3300048915 Bacteria 2706
423 Ga0496112_0256692 3300048915 Bacteria 1698
424 Ga0496113_0032900 3300048916 Bacteria 3771
425 Ga0496113_0203334 3300048916 Bacteria 1575
426 Ga0496114_0002575 3300048917 Bacteria 13855
427 Ga0496114_0011842 3300048917 Bacteria 6978
428 Ga0496114_0297582 3300048917 Bacteria 1424
429 Ga0496115_0099282 3300048918 Bacteria 2385
430 Ga0496115_0124548 3300048918 Bacteria 2122
431 Ga0496115_0161198 3300048918 Bacteria 1853
432 Ga0496124_0044024 3300048927 Bacteria 3833
433 Ga0496125_0095679 3300048928 Bacteria 2208
434 Ga0496126_0001922 3300048929 Bacteria 29774
435 Ga0495678_001696 3300049459 Bacteria 16649
436 Ga0501032_0079600 3300049569 Bacteria 2181
437 Ga0501033_0090109 3300049570 Bacteria 2244
438 Ga0501036_0047191 3300049572 Bacteria 3648
439 Ga0501037_0008867 3300049573 Bacteria 7365
440 Ga0501037_0210518 3300049573 Bacteria 1371
441 Ga0501037_0232490 3300049573 Bacteria 1294
442 Ga0501038_0003209 3300049574 Bacteria 15262
443 Ga0501039_0103952 3300049575 Bacteria 2217
444 Ga0501039_0215836 3300049575 Bacteria 1508
445 Ga0501040_0071969 3300049576 Bacteria 2387
446 Ga0501040_0131431 3300049576 Bacteria 1761
447 Ga0501041_0029860 3300049577 Bacteria 3290
448 Ga0501041_0107165 3300049577 Bacteria 1732
449 Ga0501042_0069038 3300049578 Bacteria 2527
450 Ga0501042_0097217 3300049578 Bacteria 2116
451 Ga0501046_0032243 3300049580 Bacteria 4242
452 Ga0501046_0155634 3300049580 Bacteria 1722
453 Ga0501048_0002278 3300049582 Bacteria 14644
454 Ga0501048_0021998 3300049582 Bacteria 4667
455 Ga0501067_0022653 3300049583 Bacteria 3476
456 Ga0501068_0105728 3300049584 Bacteria 1747
457 Ga0501069_0000984 3300049585 Bacteria 13576
458 Ga0501071_0064982 3300049587 Bacteria 2648
459 Ga0501072_0023012 3300049588 Bacteria 4838
460 Ga0501072_0180470 3300049588 Bacteria 1684
461 Ga0501073_0019108 3300049589 Bacteria 4950
462 Ga0501075_0027298 3300049591 Bacteria 4207
463 Ga0501075_0054133 3300049591 Bacteria 3018
464 Ga0501075_0075616 3300049591 Bacteria 2547
465 Ga0501076_0085755 3300049592 Bacteria 2531
466 Ga0501076_0309565 3300049592 Bacteria 1295
467 Ga0501080_0274117 3300049742 Bacteria 1535
468 Ga0501081_0030821 3300049743 Bacteria 3633
469 Ga0501035_0096414 3300049822 Bacteria 2599
470 Ga0501044_0001015 3300049823 Bacteria 33737
471 Ga0501044_0321162 3300049823 Bacteria 1472
472 Ga0501045_0026056 3300049824 Bacteria 4203
473 Ga0501045_0058478 3300049824 Bacteria 2823
474 Ga0501045_0163637 3300049824 Bacteria 1656
475 Ga0501045_0178669 3300049824 Bacteria 1581
476 nmdc:mga00v17_96769_c1 3300050491 Bacteria 1859
477 nmdc:mga09592_119911_c1 3300050508 Bacteria 2259
478 nmdc:mga0qj67_17268_c1 3300050509 Bacteria 5484
479 nmdc:mga0qj67_83_c1 3300050509 Bacteria 63959
480 nmdc:mga0qj67_86109_c1 3300050509 Bacteria 2521
481 nmdc:mga06r32_116322_c1 3300050510 Bacteria 2634
482 nmdc:mga06r32_188814_c1 3300050510 Bacteria 2048
483 nmdc:mga06r32_205795_c1 3300050510 Bacteria 1956
484 nmdc:mga06r32_46212_c1 3300050510 Bacteria 4155
485 nmdc:mga0n895_260272_c1 3300050512 Bacteria 1761
486 nmdc:mga0rr50_138535_c1 3300050513 Bacteria 1955
487 nmdc:mga08x19_214181_c1 3300050514 Bacteria 1323
488 nmdc:mga0sz30_8523_c1 3300050516 Bacteria 3874
489 Ga0495601_0000007 3300053077 Bacteria 365972
490 Ga0495601_0003709 3300053077 Bacteria 8792
491 Ga0495612_0000015 3300053078 Bacteria 167816
492 Ga0495612_0002398 3300053078 Bacteria 7727
493 Ga0495655_0000341 3300053083 Bacteria 8234
494 Ga0495595_0000023 3300053084 Bacteria 108096
495 Ga0495595_0102858 3300053084 Bacteria 1380
496 Ga0495619_0000017 3300053085 Bacteria 219276
497 Ga0495619_0001652 3300053085 Bacteria 14723
498 Ga0495619_0003502 3300053085 Bacteria 10119
499 Ga0495619_0041199 3300053085 Bacteria 3020
500 Ga0500578_0000005 3300053086 Bacteria 243789
501 Ga0500644_0000191 3300053088 Bacteria 38234
502 Ga0500646_0024943 3300053090 Bacteria 1612
503 Ga0500562_000175 3300053108 Bacteria 17715
504 Ga0500594_0000329 3300053118 Bacteria 10615
505 Ga0500608_000093 3300053122 Bacteria 36398
506 Ga0500652_000214 3300053131 Bacteria 22083
507 Ga0500652_041929 3300053131 Bacteria 1845
508 Ga0500559_0016342 3300053136 Bacteria 3132
509 Ga0500564_000070 3300053138 Bacteria 27126
510 Ga0500622_0002118 3300053156 Bacteria 14773
511 Ga0500622_0005697 3300053156 Bacteria 7405
512 Ga0500622_0016249 3300053156 Bacteria 3978
513 Ga0501084_0014003 3300054114 Bacteria 6639
514 Ga0501082_0000012 3300060353 Bacteria 119898
515 Ga0501082_0041351 3300060353 Bacteria 3974
516 Ga0501082_0051672 3300060353 Bacteria 3542

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10187642 Ga0207668_101876422 288
2 3300049580 Ga0501046_0155634 Ga0501046_0155634_10_975 320
3 3300050491 nmdc:mga00v17_96769_c1 nmdc:mga00v17_96769_c1_150_1136 324
4 3300047319 Ga0495674_0034072 Ga0495674_0034072_2143_3144 327
5 3300048908 Ga0496105_0066074 Ga0496105_0066074_597_1610 334
6 3300005340 Ga0070689_100009603 Ga0070689_1000096035 335
7 3300005367 Ga0070667_100211545 Ga0070667_1002115452 335
8 3300005544 Ga0070686_100093949 Ga0070686_1000939492 335
9 3300025901 Ga0207688_10061769 Ga0207688_100617692 335
10 3300025986 Ga0207658_10095163 Ga0207658_100951632 335
11 3300026118 Ga0207675_100076325 Ga0207675_1000763252 335
12 3300026121 Ga0207683_10058139 Ga0207683_100581393 335
13 3300035085 Ga0373929_0015725 Ga0373929_0015725_32_1105 335
14 3300035114 Ga0373939_0042429 Ga0373939_0042429_253_1326 335
15 3300035691 Ga0373931_0051276 Ga0373931_0051276_813_1886 335
16 3300048915 Ga0496112_0256692 Ga0496112_0256692_453_1526 335
17 3300048916 Ga0496113_0203334 Ga0496113_0203334_353_1426 335
18 3300053085 Ga0495619_0041199 Ga0495619_0041199_614_1699 336
19 3300009176 Ga0105242_10123359 Ga0105242_101233592 337
20 3300009177 Ga0105248_10146055 Ga0105248_101460554 337
21 3300009551 Ga0105238_10298769 Ga0105238_102987691 337
22 3300013306 Ga0163162_10382928 Ga0163162_103829282 337
23 3300034957 Ga0373938_0005178 Ga0373938_0005178_219_1292 337
24 3300035114 Ga0373939_0006158 Ga0373939_0006158_1493_2566 337
25 3300035691 Ga0373931_0026950 Ga0373931_0026950_1234_2307 337
26 3300048088 Ga0495602_0114619 Ga0495602_0114619_557_1642 337
27 3300048903 Ga0496100_0148066 Ga0496100_0148066_83_1156 337
28 3300048904 Ga0496101_0041223 Ga0496101_0041223_759_1832 337
29 3300048905 Ga0496102_0069549 Ga0496102_0069549_1527_2627 337
30 3300048907 Ga0496104_0007852 Ga0496104_0007852_5528_6601 337
31 3300048908 Ga0496105_0059001 Ga0496105_0059001_1608_2681 337
32 3300048909 Ga0496106_0029579 Ga0496106_0029579_2140_3213 337
33 3300048910 Ga0496107_0019640 Ga0496107_0019640_2922_3995 337
34 3300048911 Ga0496108_0030216 Ga0496108_0030216_203_1276 337
35 3300048912 Ga0496109_0034072 Ga0496109_0034072_1014_2087 337
36 3300048913 Ga0496110_0018081 Ga0496110_0018081_3837_4910 337
37 3300048914 Ga0496111_0046921 Ga0496111_0046921_1537_2610 337
38 3300048915 Ga0496112_0111445 Ga0496112_0111445_263_1336 337
39 3300048917 Ga0496114_0011842 Ga0496114_0011842_5548_6621 337
40 3300035692 Ga0373935_0032185 Ga0373935_0032185_1680_2723 341
41 3300048918 Ga0496115_0124548 Ga0496115_0124548_1019_2095 345
42 3300025261 Ga0209233_1026553 Ga0209233_10265532 346
43 3300039437 Ga0436365_1795903 Ga0436365_1795903_108_1190 346
44 3300026041 Ga0207639_10124471 Ga0207639_101244712 347
45 3300053131 Ga0500652_041929 Ga0500652_041929_471_1547 348
46 iso_pu_bacteria 2738543031 2739348208 349
47 3300028800 Ga0265338_10088214 Ga0265338_100882142 350
48 3300031241 Ga0265325_10009871 Ga0265325_100098714 352
49 3300031712 Ga0265342_10014994 Ga0265342_100149942 352
50 3300025929 Ga0207664_10020295 Ga0207664_100202958 353
51 3300050509 nmdc:mga0qj67_17268_c1 nmdc:mga0qj67_17268_c1_4233_5306 353
52 3300060353 Ga0501082_0000012 Ga0501082_0000012_26727_27803 353
53 3300006852 Ga0075433_10032682 Ga0075433_100326823 354
54 3300006880 Ga0075429_100315959 Ga0075429_1003159592 354
55 3300006914 Ga0075436_100229322 Ga0075436_1002293221 354
56 3300035091 Ga0373951_0024061 Ga0373951_0024061_182_1252 354
57 3300035691 Ga0373931_0044485 Ga0373931_0044485_963_2033 354
58 3300048908 Ga0496105_0102488 Ga0496105_0102488_196_1266 354
59 3300049577 Ga0501041_0029860 Ga0501041_0029860_526_1629 354
60 3300049578 Ga0501042_0097217 Ga0501042_0097217_831_1934 354
61 3300049588 Ga0501072_0023012 Ga0501072_0023012_793_1896 354
62 3300049591 Ga0501075_0054133 Ga0501075_0054133_1660_2763 354
63 3300049743 Ga0501081_0030821 Ga0501081_0030821_688_1791 354
64 3300049824 Ga0501045_0178669 Ga0501045_0178669_195_1298 354
65 3300054114 Ga0501084_0014003 Ga0501084_0014003_1008_2111 354
66 3300005336 Ga0070680_100027419 Ga0070680_1000274193 355
67 3300005339 Ga0070660_100170271 Ga0070660_1001702712 355
68 3300005356 Ga0070674_100232351 Ga0070674_1002323512 355
69 3300005364 Ga0070673_100228694 Ga0070673_1002286941 355
70 3300005439 Ga0070711_100067472 Ga0070711_1000674723 355
71 3300005458 Ga0070681_10146561 Ga0070681_101465612 355
72 3300005983 Ga0081540_1000762 Ga0081540_100076223 355
73 3300005983 Ga0081540_1010588 Ga0081540_10105884 355
74 3300006038 Ga0075365_10034315 Ga0075365_100343153 355
75 3300006051 Ga0075364_10055588 Ga0075364_100555882 355
76 3300006175 Ga0070712_100036199 Ga0070712_1000361993 355
77 3300006178 Ga0075367_10086146 Ga0075367_100861462 355
78 3300006195 Ga0075366_10071641 Ga0075366_100716412 355
79 3300006844 Ga0075428_100151733 Ga0075428_1001517332 355
80 3300006846 Ga0075430_100057643 Ga0075430_1000576435 355
81 3300006847 Ga0075431_100104659 Ga0075431_1001046592 355
82 3300006871 Ga0075434_100023235 Ga0075434_1000232352 355
83 3300006871 Ga0075434_100180360 Ga0075434_1001803602 355
84 3300006871 Ga0075434_100236449 Ga0075434_1002364492 355
85 3300007076 Ga0075435_100211854 Ga0075435_1002118542 355
86 3300009094 Ga0111539_10094460 Ga0111539_100944606 355
87 3300009094 Ga0111539_10107927 Ga0111539_101079272 355
88 3300009147 Ga0114129_10097903 Ga0114129_100979031 355
89 3300014968 Ga0157379_10023810 Ga0157379_100238102 355
90 3300025909 Ga0207705_10033846 Ga0207705_100338462 355
91 3300025912 Ga0207707_10070603 Ga0207707_100706033 355
92 3300025915 Ga0207693_10064726 Ga0207693_100647263 355
93 3300025917 Ga0207660_10060813 Ga0207660_100608133 355
94 3300025919 Ga0207657_10061464 Ga0207657_100614644 355
95 3300025921 Ga0207652_10040109 Ga0207652_100401093 355
96 3300025937 Ga0207669_10035805 Ga0207669_100358053 355
97 3300026035 Ga0207703_10207185 Ga0207703_102071852 355
98 3300026075 Ga0207708_10210519 Ga0207708_102105192 355
99 3300026121 Ga0207683_10211819 Ga0207683_102118191 355
100 3300031241 Ga0265325_10002730 Ga0265325_1000273010 355
101 3300031711 Ga0265314_10135445 Ga0265314_101354452 355
102 3300035113 Ga0373936_0002391 Ga0373936_0002391_1888_2994 355
103 3300035113 Ga0373936_0033542 Ga0373936_0033542_910_1983 355
104 3300035116 Ga0373945_0005113 Ga0373945_0005113_1821_2927 355
105 3300035118 Ga0373954_0002383 Ga0373954_0002383_4550_5656 355
106 3300035120 Ga0373957_0010302 Ga0373957_0010302_472_1578 355
107 3300035170 Ga0373943_0036377 Ga0373943_0036377_1234_2340 355
108 3300035171 Ga0373946_0034498 Ga0373946_0034498_477_1583 355
109 3300035172 Ga0373955_0000399 Ga0373955_0000399_8009_9115 355
110 3300035410 Ga0373924_0001527 Ga0373924_0001527_4603_5709 355
111 3300035691 Ga0373931_0146765 Ga0373931_0146765_182_1255 355
112 3300035692 Ga0373935_0000286 Ga0373935_0000286_23664_24770 355
113 3300035692 Ga0373935_0159801 Ga0373935_0159801_81_1160 355
114 3300035695 Ga0373927_0005366 Ga0373927_0005366_355_1461 355
115 3300035695 Ga0373927_0040440 Ga0373927_0040440_320_1399 355
116 3300035724 Ga0373933_0005496 Ga0373933_0005496_1761_2867 355
117 3300035725 Ga0373947_0007690 Ga0373947_0007690_566_1672 355
118 3300036401 Ga0373937_0000695 Ga0373937_0000695_19869_20975 355
119 3300037068 Ga0373925_0000019 Ga0373925_0000019_73913_75019 355
120 3300045051 Ga0451576_0203921 Ga0451576_0203921_679_1758 355
121 3300046454 Ga0495592_0000005 Ga0495592_0000005_68876_69982 355
122 3300046459 Ga0495629_0037713 Ga0495629_0037713_1162_2268 355
123 3300046459 Ga0495629_0067171 Ga0495629_0067171_1252_2331 355
124 3300046462 Ga0495651_0014746 Ga0495651_0014746_4148_5254 355
125 3300046463 Ga0495653_0000017 Ga0495653_0000017_73978_75084 355
126 3300046473 Ga0495582_0044243 Ga0495582_0044243_914_2020 355
127 3300046476 Ga0495662_0000724 Ga0495662_0000724_1652_2758 355
128 3300046476 Ga0495662_0019870 Ga0495662_0019870_304_1383 355
129 3300046477 Ga0495664_0000014 Ga0495664_0000014_68393_69499 355
130 3300046477 Ga0495664_0001240 Ga0495664_0001240_9365_10444 355
131 3300046511 Ga0495608_0000034 Ga0495608_0000034_67517_68623 355
132 3300046514 Ga0495618_0000011 Ga0495618_0000011_124517_125623 355
133 3300046514 Ga0495618_0000925 Ga0495618_0000925_10461_11540 355
134 3300046516 Ga0495628_0000017 Ga0495628_0000017_95589_96695 355
135 3300046517 Ga0495630_0000472 Ga0495630_0000472_6121_7227 355
136 3300046529 Ga0495652_0000008 Ga0495652_0000008_143682_144788 355
137 3300046529 Ga0495652_0073238 Ga0495652_0073238_1309_2388 355
138 3300046531 Ga0495665_0106375 Ga0495665_0106375_167_1273 355
139 3300046533 Ga0495640_0000024 Ga0495640_0000024_2347_3453 355
140 3300046533 Ga0495640_0000947 Ga0495640_0000947_4365_5444 355
141 3300046536 Ga0495587_0000039 Ga0495587_0000039_47240_48346 355
142 3300046543 Ga0495645_0000006 Ga0495645_0000006_285363_286469 355
143 3300046543 Ga0495645_0031508 Ga0495645_0031508_1545_2624 355
144 3300046559 Ga0495667_0000026 Ga0495667_0000026_95573_96679 355
145 3300046642 Ga0495634_0000009 Ga0495634_0000009_86684_87790 355
146 3300046642 Ga0495634_0000941 Ga0495634_0000941_8829_9908 355
147 3300046663 Ga0495635_0000014 Ga0495635_0000014_143700_144806 355
148 3300046663 Ga0495635_0004745 Ga0495635_0004745_5688_6767 355
149 3300046675 Ga0495657_0000038 Ga0495657_0000038_14407_15513 355
150 3300046678 Ga0495599_0000010 Ga0495599_0000010_66721_67827 355
151 3300046679 Ga0495623_0000074 Ga0495623_0000074_49975_51081 355
152 3300046680 Ga0495646_0000008 Ga0495646_0000008_143800_144906 355
153 3300046689 Ga0495613_0022544 Ga0495613_0022544_870_1976 355
154 3300046809 Ga0495600_0000213 Ga0495600_0000213_24396_25502 355
155 3300047317 Ga0495604_0000006 Ga0495604_0000006_344249_345355 355
156 3300047319 Ga0495674_0000009 Ga0495674_0000009_95624_96730 355
157 3300047319 Ga0495674_0000859 Ga0495674_0000859_10194_11273 355
158 3300047322 Ga0495680_0008445 Ga0495680_0008445_6183_7289 355
159 3300047444 Ga0495675_0000044 Ga0495675_0000044_1682_2788 355
160 3300047471 Ga0495684_0000015 Ga0495684_0000015_44010_45116 355
161 3300047471 Ga0495684_0001275 Ga0495684_0001275_1569_2648 355
162 3300047673 Ga0495593_0000148 Ga0495593_0000148_33095_34201 355
163 3300048088 Ga0495602_0000006 Ga0495602_0000006_240426_241532 355
164 3300048903 Ga0496100_0243954 Ga0496100_0243954_227_1306 355
165 3300048904 Ga0496101_0016350 Ga0496101_0016350_1141_2232 355
166 3300048904 Ga0496101_0052923 Ga0496101_0052923_415_1491 355
167 3300048905 Ga0496102_0265132 Ga0496102_0265132_378_1454 355
168 3300048907 Ga0496104_0001526 Ga0496104_0001526_14062_15138 355
169 3300048907 Ga0496104_0007867 Ga0496104_0007867_3371_4447 355
170 3300048907 Ga0496104_0225193 Ga0496104_0225193_60_1142 355
171 3300048913 Ga0496110_0113717 Ga0496110_0113717_379_1455 355
172 3300048913 Ga0496110_0158966 Ga0496110_0158966_439_1521 355
173 3300048915 Ga0496112_0023334 Ga0496112_0023334_749_1825 355
174 3300048917 Ga0496114_0297582 Ga0496114_0297582_40_1161 355
175 3300049569 Ga0501032_0079600 Ga0501032_0079600_639_1718 355
176 3300049570 Ga0501033_0090109 Ga0501033_0090109_587_1666 355
177 3300049572 Ga0501036_0047191 Ga0501036_0047191_1940_3025 355
178 3300049573 Ga0501037_0008867 Ga0501037_0008867_2386_3465 355
179 3300049574 Ga0501038_0003209 Ga0501038_0003209_532_1611 355
180 3300049575 Ga0501039_0103952 Ga0501039_0103952_619_1698 355
181 3300049575 Ga0501039_0215836 Ga0501039_0215836_395_1480 355
182 3300049580 Ga0501046_0032243 Ga0501046_0032243_2621_3700 355
183 3300049582 Ga0501048_0002278 Ga0501048_0002278_644_1723 355
184 3300049583 Ga0501067_0022653 Ga0501067_0022653_1770_2849 355
185 3300049585 Ga0501069_0000984 Ga0501069_0000984_4934_6013 355
186 3300049588 Ga0501072_0180470 Ga0501072_0180470_277_1356 355
187 3300049589 Ga0501073_0019108 Ga0501073_0019108_261_1340 355
188 3300049742 Ga0501080_0274117 Ga0501080_0274117_277_1356 355
189 3300049823 Ga0501044_0001015 Ga0501044_0001015_13087_14166 355
190 3300049823 Ga0501044_0321162 Ga0501044_0321162_212_1291 355
191 3300049824 Ga0501045_0058478 Ga0501045_0058478_482_1561 355
192 3300049824 Ga0501045_0163637 Ga0501045_0163637_25_1110 355
193 3300050508 nmdc:mga09592_119911_c1 nmdc:mga09592_119911_c1_1027_2109 355
194 3300050509 nmdc:mga0qj67_86109_c1 nmdc:mga0qj67_86109_c1_183_1265 355
195 3300050510 nmdc:mga06r32_188814_c1 nmdc:mga06r32_188814_c1_165_1247 355
196 3300050513 nmdc:mga0rr50_138535_c1 nmdc:mga0rr50_138535_c1_322_1524 355
197 3300053077 Ga0495601_0000007 Ga0495601_0000007_124527_125633 355
198 3300053077 Ga0495601_0003709 Ga0495601_0003709_2661_3740 355
199 3300053078 Ga0495612_0000015 Ga0495612_0000015_71163_72269 355
200 3300053078 Ga0495612_0002398 Ga0495612_0002398_1442_2521 355
201 3300053084 Ga0495595_0000023 Ga0495595_0000023_95542_96648 355
202 3300053085 Ga0495619_0000017 Ga0495619_0000017_143977_145083 355
203 3300053085 Ga0495619_0003502 Ga0495619_0003502_377_1456 355
204 3300060353 Ga0501082_0041351 Ga0501082_0041351_1117_2202 355
205 3300005539 Ga0068853_100016114 Ga0068853_1000161147 356
206 3300005614 Ga0068856_100162187 Ga0068856_1001621873 356
207 3300006175 Ga0070712_100017748 Ga0070712_1000177485 356
208 3300006846 Ga0075430_100000184 Ga0075430_10000018416 356
209 3300006847 Ga0075431_100141016 Ga0075431_1001410163 356
210 3300009147 Ga0114129_10004024 Ga0114129_100040248 356
211 3300013100 Ga0157373_10007439 Ga0157373_100074398 356
212 3300013105 Ga0157369_10301019 Ga0157369_103010192 356
213 3300025898 Ga0207692_10022950 Ga0207692_100229502 356
214 3300025912 Ga0207707_10295676 Ga0207707_102956762 356
215 3300025915 Ga0207693_10009760 Ga0207693_100097605 356
216 3300026041 Ga0207639_10022411 Ga0207639_100224115 356
217 3300026078 Ga0207702_10253238 Ga0207702_102532382 356
218 3300031595 Ga0265313_10017035 Ga0265313_100170355 356
219 3300035083 Ga0373926_0000693 Ga0373926_0000693_5614_6690 356
220 3300035116 Ga0373945_0008225 Ga0373945_0008225_532_1608 356
221 3300035170 Ga0373943_0000268 Ga0373943_0000268_13386_14462 356
222 3300035692 Ga0373935_0026063 Ga0373935_0026063_608_1684 356
223 3300035692 Ga0373935_0274400 Ga0373935_0274400_66_1151 356
224 3300035695 Ga0373927_0001748 Ga0373927_0001748_13483_14559 356
225 3300035725 Ga0373947_0001270 Ga0373947_0001270_1568_2644 356
226 3300035725 Ga0373947_0010286 Ga0373947_0010286_1757_2842 356
227 3300037068 Ga0373925_0012774 Ga0373925_0012774_1461_2537 356
228 3300039437 Ga0436365_0734149 Ga0436365_0734149_280_1365 356
229 3300046454 Ga0495592_0167865 Ga0495592_0167865_13_1098 356
230 3300046472 Ga0495580_0101972 Ga0495580_0101972_265_1341 356
231 3300046517 Ga0495630_0296067 Ga0495630_0296067_100_1176 356
232 3300046531 Ga0495665_0016593 Ga0495665_0016593_1027_2103 356
233 3300046533 Ga0495640_0014456 Ga0495640_0014456_3555_4631 356
234 3300046642 Ga0495634_0011375 Ga0495634_0011375_2483_3568 356
235 3300046681 Ga0495647_0023940 Ga0495647_0023940_75_1151 356
236 3300046690 Ga0495624_0001454 Ga0495624_0001454_12826_13902 356
237 3300047321 Ga0495676_0144489 Ga0495676_0144489_474_1550 356
238 3300047471 Ga0495684_0002706 Ga0495684_0002706_1027_2103 356
239 3300050509 nmdc:mga0qj67_83_c1 nmdc:mga0qj67_83_c1_17856_18941 356
240 3300050510 nmdc:mga06r32_205795_c1 nmdc:mga06r32_205795_c1_313_1395 356
241 3300053084 Ga0495595_0102858 Ga0495595_0102858_96_1178 356
242 3300053108 Ga0500562_000175 Ga0500562_000175_4966_6042 356
243 3300005441 Ga0070700_100144883 Ga0070700_1001448831 357
244 3300005615 Ga0070702_100005628 Ga0070702_1000056282 357
245 3300005843 Ga0068860_100164978 Ga0068860_1001649782 357
246 3300005844 Ga0068862_100114361 Ga0068862_1001143612 357
247 3300006237 Ga0097621_100243010 Ga0097621_1002430102 357
248 3300006881 Ga0068865_100015795 Ga0068865_1000157953 357
249 3300009553 Ga0105249_10014958 Ga0105249_100149584 357
250 3300013308 Ga0157375_10246405 Ga0157375_102464052 357
251 3300017792 Ga0163161_10005377 Ga0163161_100053774 357
252 3300025908 Ga0207643_10056900 Ga0207643_100569002 357
253 3300025938 Ga0207704_10008153 Ga0207704_100081532 357
254 3300035695 Ga0373927_0036597 Ga0373927_0036597_801_1886 357
255 3300035725 Ga0373947_0007076 Ga0373947_0007076_1792_2877 357
256 3300037068 Ga0373925_0028134 Ga0373925_0028134_1839_2924 357
257 3300046455 Ga0495603_0000114 Ga0495603_0000114_9111_10196 357
258 3300046459 Ga0495629_0000430 Ga0495629_0000430_26146_27231 357
259 3300046461 Ga0495641_0006916 Ga0495641_0006916_5197_6282 357
260 3300046472 Ga0495580_0000080 Ga0495580_0000080_51273_52358 357
261 3300046473 Ga0495582_0002704 Ga0495582_0002704_3628_4713 357
262 3300046475 Ga0495639_0002522 Ga0495639_0002522_3469_4554 357
263 3300046499 Ga0495594_0005083 Ga0495594_0005083_4753_5838 357
264 3300046526 Ga0495666_0042384 Ga0495666_0042384_767_1852 357
265 3300046557 Ga0495622_0005445 Ga0495622_0005445_1195_2280 357
266 3300046642 Ga0495634_0010307 Ga0495634_0010307_5515_6600 357
267 3300046674 Ga0495588_0007588 Ga0495588_0007588_1629_2714 357
268 3300046681 Ga0495647_0001891 Ga0495647_0001891_4622_5707 357
269 3300046683 Ga0495658_0002490 Ga0495658_0002490_5201_6286 357
270 3300046689 Ga0495613_0000335 Ga0495613_0000335_11111_12196 357
271 3300047315 Ga0495581_0038077 Ga0495581_0038077_782_1867 357
272 3300047321 Ga0495676_0023022 Ga0495676_0023022_959_2044 357
273 3300047322 Ga0495680_0014658 Ga0495680_0014658_2304_3389 357
274 3300047673 Ga0495593_0000735 Ga0495593_0000735_10302_11387 357
275 3300048089 Ga0495614_0001428 Ga0495614_0001428_7781_8866 357
276 3300048907 Ga0496104_0131757 Ga0496104_0131757_623_1705 357
277 3300048912 Ga0496109_0014004 Ga0496109_0014004_73_1155 357
278 3300048918 Ga0496115_0161198 Ga0496115_0161198_738_1820 357
279 3300053085 Ga0495619_0001652 Ga0495619_0001652_5782_6867 357
280 3300005328 Ga0070676_10006454 Ga0070676_100064542 358
281 3300005330 Ga0070690_100000610 Ga0070690_10000061011 358
282 3300005331 Ga0070670_100001815 Ga0070670_10000181512 358
283 3300005335 Ga0070666_10002138 Ga0070666_100021382 358
284 3300005339 Ga0070660_100083717 Ga0070660_1000837173 358
285 3300005340 Ga0070689_100001684 Ga0070689_1000016849 358
286 3300005341 Ga0070691_10045255 Ga0070691_100452552 358
287 3300005344 Ga0070661_100004008 Ga0070661_1000040088 358
288 3300005345 Ga0070692_10003164 Ga0070692_100031644 358
289 3300005347 Ga0070668_100006577 Ga0070668_1000065774 358
290 3300005353 Ga0070669_100001652 Ga0070669_10000165211 358
291 3300005354 Ga0070675_100001837 Ga0070675_1000018376 358
292 3300005355 Ga0070671_100010824 Ga0070671_1000108242 358
293 3300005356 Ga0070674_100002900 Ga0070674_1000029006 358
294 3300005364 Ga0070673_100000178 Ga0070673_10000017824 358
295 3300005365 Ga0070688_100001229 Ga0070688_1000012299 358
296 3300005366 Ga0070659_100007056 Ga0070659_1000070567 358
297 3300005367 Ga0070667_100011689 Ga0070667_1000116893 358
298 3300005406 Ga0070703_10005299 Ga0070703_100052995 358
299 3300005434 Ga0070709_10016209 Ga0070709_100162092 358
300 3300005435 Ga0070714_100029999 Ga0070714_1000299994 358
301 3300005436 Ga0070713_100011743 Ga0070713_1000117435 358
302 3300005437 Ga0070710_10002055 Ga0070710_1000205510 358
303 3300005438 Ga0070701_10139826 Ga0070701_101398262 358
304 3300005439 Ga0070711_100014106 Ga0070711_1000141065 358
305 3300005440 Ga0070705_100001032 Ga0070705_10000103211 358
306 3300005441 Ga0070700_100044677 Ga0070700_1000446772 358
307 3300005444 Ga0070694_100000754 Ga0070694_10000075410 358
308 3300005455 Ga0070663_100001099 Ga0070663_1000010999 358
309 3300005456 Ga0070678_100002107 Ga0070678_10000210716 358
310 3300005457 Ga0070662_100003112 Ga0070662_10000311210 358
311 3300005459 Ga0068867_100056422 Ga0068867_1000564222 358
312 3300005535 Ga0070684_100013716 Ga0070684_1000137162 358
313 3300005536 Ga0070697_100002089 Ga0070697_10000208911 358
314 3300005539 Ga0068853_100002601 Ga0068853_1000026018 358
315 3300005543 Ga0070672_100004259 Ga0070672_1000042595 358
316 3300005544 Ga0070686_100028638 Ga0070686_1000286385 358
317 3300005545 Ga0070695_100001920 Ga0070695_1000019208 358
318 3300005546 Ga0070696_100001022 Ga0070696_1000010226 358
319 3300005547 Ga0070693_100002127 Ga0070693_1000021279 358
320 3300005548 Ga0070665_100022148 Ga0070665_1000221482 358
321 3300005549 Ga0070704_100000591 Ga0070704_1000005918 358
322 3300005563 Ga0068855_100046800 Ga0068855_1000468003 358
323 3300005564 Ga0070664_100016985 Ga0070664_1000169857 358
324 3300005577 Ga0068857_100006522 Ga0068857_1000065225 358
325 3300005578 Ga0068854_100012704 Ga0068854_1000127045 358
326 3300005614 Ga0068856_100019043 Ga0068856_1000190432 358
327 3300005615 Ga0070702_100000503 Ga0070702_1000005038 358
328 3300005616 Ga0068852_100005695 Ga0068852_1000056952 358
329 3300005617 Ga0068859_100006718 Ga0068859_1000067188 358
330 3300005618 Ga0068864_100054195 Ga0068864_1000541952 358
331 3300005718 Ga0068866_10001746 Ga0068866_100017469 358
332 3300005719 Ga0068861_100005178 Ga0068861_1000051789 358
333 3300005841 Ga0068863_100031708 Ga0068863_1000317085 358
334 3300005842 Ga0068858_100034409 Ga0068858_1000344095 358
335 3300005843 Ga0068860_100014904 Ga0068860_1000149049 358
336 3300005844 Ga0068862_100006841 Ga0068862_1000068415 358
337 3300005937 Ga0081455_10003512 Ga0081455_1000351221 358
338 3300006163 Ga0070715_10002047 Ga0070715_100020475 358
339 3300006173 Ga0070716_100000897 Ga0070716_1000008977 358
340 3300006175 Ga0070712_100004972 Ga0070712_1000049726 358
341 3300006358 Ga0068871_100134613 Ga0068871_1001346132 358
342 3300006847 Ga0075431_100193606 Ga0075431_1001936062 358
343 3300006852 Ga0075433_10324687 Ga0075433_103246872 358
344 3300006871 Ga0075434_100076270 Ga0075434_1000762702 358
345 3300006880 Ga0075429_100287795 Ga0075429_1002877952 358
346 3300006881 Ga0068865_100001831 Ga0068865_10000183111 358
347 3300006931 Ga0097620_100006718 Ga0097620_1000067188 358
348 3300009093 Ga0105240_10029175 Ga0105240_100291753 358
349 3300009101 Ga0105247_10001700 Ga0105247_1000170013 358
350 3300009148 Ga0105243_10006393 Ga0105243_100063939 358
351 3300009174 Ga0105241_10004531 Ga0105241_100045315 358
352 3300009176 Ga0105242_10003507 Ga0105242_100035079 358
353 3300009177 Ga0105248_10017589 Ga0105248_1001758911 358
354 3300009545 Ga0105237_10042872 Ga0105237_100428722 358
355 3300009551 Ga0105238_10047170 Ga0105238_100471702 358
356 3300009553 Ga0105249_10005672 Ga0105249_1000567212 358
357 3300011119 Ga0105246_10001845 Ga0105246_1000184510 358
358 3300013100 Ga0157373_10019877 Ga0157373_100198775 358
359 3300013102 Ga0157371_10004963 Ga0157371_100049635 358
360 3300013105 Ga0157369_10019012 Ga0157369_1001901210 358
361 3300013296 Ga0157374_10008799 Ga0157374_100087994 358
362 3300013306 Ga0163162_10005855 Ga0163162_100058556 358
363 3300013307 Ga0157372_10016968 Ga0157372_100169683 358
364 3300013308 Ga0157375_10002853 Ga0157375_100028539 358
365 3300014325 Ga0163163_10284633 Ga0163163_102846332 358
366 3300014745 Ga0157377_10056121 Ga0157377_100561213 358
367 3300014968 Ga0157379_10003063 Ga0157379_100030638 358
368 3300014969 Ga0157376_10000570 Ga0157376_1000057019 358
369 3300017792 Ga0163161_10004937 Ga0163161_100049379 358
370 3300025711 Ga0207696_1011469 Ga0207696_10114692 358
371 3300025898 Ga0207692_10004819 Ga0207692_100048193 358
372 3300025899 Ga0207642_10003910 Ga0207642_100039104 358
373 3300025901 Ga0207688_10006083 Ga0207688_100060839 358
374 3300025903 Ga0207680_10019280 Ga0207680_100192803 358
375 3300025904 Ga0207647_10009635 Ga0207647_100096353 358
376 3300025905 Ga0207685_10000315 Ga0207685_100003155 358
377 3300025906 Ga0207699_10056913 Ga0207699_100569133 358
378 3300025907 Ga0207645_10002711 Ga0207645_100027115 358
379 3300025911 Ga0207654_10020566 Ga0207654_100205662 358
380 3300025913 Ga0207695_10034247 Ga0207695_100342477 358
381 3300025915 Ga0207693_10005832 Ga0207693_100058325 358
382 3300025919 Ga0207657_10001866 Ga0207657_1000186610 358
383 3300025920 Ga0207649_10003925 Ga0207649_100039256 358
384 3300025921 Ga0207652_10113660 Ga0207652_101136603 358
385 3300025923 Ga0207681_10002877 Ga0207681_100028774 358
386 3300025924 Ga0207694_10118449 Ga0207694_101184492 358
387 3300025925 Ga0207650_10003214 Ga0207650_1000321412 358
388 3300025926 Ga0207659_10005097 Ga0207659_100050974 358
389 3300025927 Ga0207687_10006111 Ga0207687_100061116 358
390 3300025929 Ga0207664_10016876 Ga0207664_100168763 358
391 3300025931 Ga0207644_10036741 Ga0207644_100367413 358
392 3300025932 Ga0207690_10005451 Ga0207690_1000545110 358
393 3300025933 Ga0207706_10001431 Ga0207706_1000143119 358
394 3300025934 Ga0207686_10205753 Ga0207686_102057532 358
395 3300025935 Ga0207709_10011736 Ga0207709_100117363 358
396 3300025936 Ga0207670_10041153 Ga0207670_100411532 358
397 3300025939 Ga0207665_10002101 Ga0207665_1000210110 358
398 3300025941 Ga0207711_10107406 Ga0207711_101074062 358
399 3300025944 Ga0207661_10037213 Ga0207661_100372132 358
400 3300025945 Ga0207679_10140179 Ga0207679_101401792 358
401 3300025960 Ga0207651_10004133 Ga0207651_100041339 358
402 3300025972 Ga0207668_10186940 Ga0207668_101869402 358
403 3300025981 Ga0207640_10043745 Ga0207640_100437452 358
404 3300025986 Ga0207658_10007506 Ga0207658_1000750610 358
405 3300026023 Ga0207677_10271896 Ga0207677_102718962 358
406 3300026041 Ga0207639_10256449 Ga0207639_102564492 358
407 3300026067 Ga0207678_10002104 Ga0207678_1000210410 358
408 3300026075 Ga0207708_10001818 Ga0207708_1000181811 358
409 3300026078 Ga0207702_10008843 Ga0207702_100088432 358
410 3300026088 Ga0207641_10326889 Ga0207641_103268892 358
411 3300026089 Ga0207648_10011227 Ga0207648_100112278 358
412 3300026116 Ga0207674_10004952 Ga0207674_1000495212 358
413 3300026118 Ga0207675_100000249 Ga0207675_1000002492 358
414 3300026121 Ga0207683_10001156 Ga0207683_1000115610 358
415 3300026142 Ga0207698_10010099 Ga0207698_100100993 358
416 3300028379 Ga0268266_10023678 Ga0268266_100236783 358
417 3300028381 Ga0268264_10005008 Ga0268264_100050085 358
418 3300031691 Ga0316579_10115121 Ga0316579_101151211 358
419 3300035115 Ga0373941_0008486 Ga0373941_0008486_175_1263 358
420 3300035241 Ga0373961_0005801 Ga0373961_0005801_561_1652 358
421 3300035691 Ga0373931_0004198 Ga0373931_0004198_2403_3491 358
422 3300037418 Ga0395900_0005362 Ga0395900_0005362_9889_10977 358
423 3300037466 Ga0395898_0008423 Ga0395898_0008423_8771_9859 358
424 3300037471 Ga0395905_0002905 Ga0395905_0002905_9550_10638 358
425 3300038443 Ga0395901_0063898 Ga0395901_0063898_640_1728 358
426 3300045976 Ga0466967_0025986 Ga0466967_0025986_130_1221 358
427 3300048903 Ga0496100_0013285 Ga0496100_0013285_3510_4598 358
428 3300048904 Ga0496101_0208951 Ga0496101_0208951_278_1366 358
429 3300048906 Ga0496103_0006988 Ga0496103_0006988_278_1366 358
430 3300048907 Ga0496104_0147940 Ga0496104_0147940_275_1363 358
431 3300048908 Ga0496105_0173400 Ga0496105_0173400_534_1622 358
432 3300048909 Ga0496106_0011183 Ga0496106_0011183_893_1981 358
433 3300048910 Ga0496107_0125250 Ga0496107_0125250_661_1749 358
434 3300048914 Ga0496111_0089412 Ga0496111_0089412_893_1981 358
435 3300048917 Ga0496114_0002575 Ga0496114_0002575_6255_7343 358
436 3300049573 Ga0501037_0210518 Ga0501037_0210518_164_1303 358
437 3300049573 Ga0501037_0232490 Ga0501037_0232490_130_1269 358
438 3300049576 Ga0501040_0071969 Ga0501040_0071969_1036_2175 358
439 3300049576 Ga0501040_0131431 Ga0501040_0131431_59_1147 358
440 3300049577 Ga0501041_0107165 Ga0501041_0107165_71_1210 358
441 3300049578 Ga0501042_0069038 Ga0501042_0069038_56_1195 358
442 3300049582 Ga0501048_0021998 Ga0501048_0021998_1181_2320 358
443 3300049584 Ga0501068_0105728 Ga0501068_0105728_617_1732 358
444 3300049587 Ga0501071_0064982 Ga0501071_0064982_1194_2333 358
445 3300049591 Ga0501075_0027298 Ga0501075_0027298_306_1445 358
446 3300049591 Ga0501075_0075616 Ga0501075_0075616_1143_2231 358
447 3300049592 Ga0501076_0085755 Ga0501076_0085755_190_1278 358
448 3300049592 Ga0501076_0309565 Ga0501076_0309565_30_1118 358
449 3300049822 Ga0501035_0096414 Ga0501035_0096414_413_1552 358
450 3300049824 Ga0501045_0026056 Ga0501045_0026056_2532_3671 358
451 3300050510 nmdc:mga06r32_116322_c1 nmdc:mga06r32_116322_c1_981_2069 358
452 3300050510 nmdc:mga06r32_46212_c1 nmdc:mga06r32_46212_c1_1406_2494 358
453 3300050512 nmdc:mga0n895_260272_c1 nmdc:mga0n895_260272_c1_472_1560 358
454 3300050514 nmdc:mga08x19_214181_c1 nmdc:mga08x19_214181_c1_35_1123 358
455 3300053083 Ga0495655_0000341 Ga0495655_0000341_4919_6007 358
456 3300060353 Ga0501082_0051672 Ga0501082_0051672_30_1169 358
457 iso_pu_bacteria 2898329390 2898330907 358
458 3300031456 Ga0307513_10058634 Ga0307513_100586342 359
459 3300046460 Ga0495638_0141988 Ga0495638_0141988_153_1256 359
460 3300053090 Ga0500646_0024943 Ga0500646_0024943_248_1351 359
461 3300053131 Ga0500652_000214 Ga0500652_000214_13968_15062 359
462 3300005530 Ga0070679_100150659 Ga0070679_1001506593 360
463 3300013104 Ga0157370_10064469 Ga0157370_100644694 360
464 3300025921 Ga0207652_10121335 Ga0207652_101213353 360
465 3300026078 Ga0207702_10144045 Ga0207702_101440451 360
466 3300048903 Ga0496100_0079551 Ga0496100_0079551_861_1967 360
467 3300048904 Ga0496101_0090733 Ga0496101_0090733_121_1227 360
468 3300048907 Ga0496104_0062647 Ga0496104_0062647_533_1639 360
469 3300048909 Ga0496106_0002576 Ga0496106_0002576_9683_10789 360
470 3300048912 Ga0496109_0028071 Ga0496109_0028071_2066_3172 360
471 3300048913 Ga0496110_0002003 Ga0496110_0002003_4377_5483 360
472 3300048914 Ga0496111_0010887 Ga0496111_0010887_769_1875 360
473 3300048915 Ga0496112_0010822 Ga0496112_0010822_2031_3137 360
474 3300048916 Ga0496113_0032900 Ga0496113_0032900_2357_3463 360
475 3300048918 Ga0496115_0099282 Ga0496115_0099282_753_1859 360
476 iso_pu_bacteria 2884960567 2884963957 361
477 3300046518 Ga0495631_0003894 Ga0495631_0003894_1523_2620 362
478 iso_pu_bacteria 2582581279 2585149374 362
479 iso_pu_bacteria 2585428106 2587919721 362
480 iso_pu_bacteria 2643221640 2644226345 362
481 iso_pu_bacteria 2643221642 2644235833 362
482 iso_pu_bacteria 2851153111 2851155496 362
483 iso_pu_bacteria 2857504554 2857506656 362
484 iso_pu_bacteria 2928531327 2928533920 362
485 3300028794 Ga0307515_10056829 Ga0307515_100568293 365
486 3300048928 Ga0496125_0095679 Ga0496125_0095679_772_1869 365
487 3300048929 Ga0496126_0001922 Ga0496126_0001922_7265_8362 365
488 3300003781 Ga0055536_1000689 Ga0055536_100068922 366
489 3300003781 Ga0055536_1000750 Ga0055536_10007504 366
490 3300003791 Ga0055530_10001625 Ga0055530_100016253 366
491 3300003791 Ga0055530_10004094 Ga0055530_100040944 366
492 3300003794 Ga0055531_10000307 Ga0055531_1000030727 366
493 3300006186 Ga0075369_10002442 Ga0075369_100024422 366
494 3300025292 Ga0209676_1000136 Ga0209676_100013635 366
495 3300025292 Ga0209676_1000200 Ga0209676_100020028 366
496 3300025298 Ga0209050_1000057 Ga0209050_1000057145 366
497 3300025298 Ga0209050_1000568 Ga0209050_100056835 366
498 3300025303 Ga0209051_1000836 Ga0209051_100083628 366
499 3300025304 Ga0209257_1000142 Ga0209257_100014235 366
500 3300025304 Ga0209257_1008523 Ga0209257_10085232 366
501 3300046457 Ga0495590_0001808 Ga0495590_0001808_183_1292 366
502 3300046460 Ga0495638_0000600 Ga0495638_0000600_17818_18927 366
503 3300046460 Ga0495638_0017040 Ga0495638_0017040_600_1712 366
504 3300046471 Ga0495650_0067344 Ga0495650_0067344_203_1312 366
505 3300046512 Ga0495610_0065308 Ga0495610_0065308_319_1428 366
506 3300046524 Ga0495648_0001025 Ga0495648_0001025_27378_28487 366
507 3300046542 Ga0495597_0009230 Ga0495597_0009230_201_1301 366
508 3300046616 Ga0495668_0000014 Ga0495668_0000014_292025_293125 366
509 3300046616 Ga0495668_0006444 Ga0495668_0006444_3881_4981 366
510 3300046660 Ga0495625_0018457 Ga0495625_0018457_138_1250 366
511 3300047469 Ga0495673_0000123 Ga0495673_0000123_34236_35345 366
512 3300047472 Ga0495686_0003073 Ga0495686_0003073_5409_6518 366
513 3300047472 Ga0495686_0082493 Ga0495686_0082493_525_1625 366
514 3300048909 Ga0496106_0319982 Ga0496106_0319982_76_1176 366
515 3300048927 Ga0496124_0044024 Ga0496124_0044024_1129_2229 366
516 3300049459 Ga0495678_001696 Ga0495678_001696_5295_6404 366
517 3300050516 nmdc:mga0sz30_8523_c1 nmdc:mga0sz30_8523_c1_992_2092 366
518 3300053086 Ga0500578_0000005 Ga0500578_0000005_10008_11117 366
519 3300053088 Ga0500644_0000191 Ga0500644_0000191_5726_6835 366
520 3300053118 Ga0500594_0000329 Ga0500594_0000329_5125_6234 366
521 3300053122 Ga0500608_000093 Ga0500608_000093_23238_24338 366
522 3300053136 Ga0500559_0016342 Ga0500559_0016342_1768_2868 366
523 3300053138 Ga0500564_000070 Ga0500564_000070_3746_4855 366
524 3300053156 Ga0500622_0002118 Ga0500622_0002118_8253_9362 366
525 3300053156 Ga0500622_0005697 Ga0500622_0005697_3253_4353 366
526 3300053156 Ga0500622_0016249 Ga0500622_0016249_1748_2860 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02547

Queuosine_synth

Queuosine biosynthesis protein

45

397

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tjx-assembly1.cif.gz_D yeast atp synthase f1 region state 1binding(a-d) with 10 mm atp 0.7718 88 152
6j5i-assembly1.cif.gz_E cryo-em structure of the mammalian dp-state atp synthase 0.7701 88 147
3oaa-assembly4.cif.gz_b structure of the e.coli f1-atp synthase inhibited by subunit epsilon 0.7563 88 153
4q4l-assembly1.cif.gz_A crystal structure of an atp synthase subunit beta 1 (f1-b1) from burkholderia thailandensis 0.7525 86 151
6re2-assembly1.cif.gz_X cryo-em structure of polytomella f-atp synthase, rotary substate 2b, composite map 0.7292 88 150
ID Description Score Start End Superfamily
1vkyA01 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.9252 5 361 3.40.1780.10
1vkyA01 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.9164 5 361 3.40.1780.10
af_P0A7F9_64_163_3.40.1780.10 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.8249 63 181 3.40.1780.10
af_P0A7F9_64_163_3.40.1780.10 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.811 63 181 3.40.1780.10
1vkyA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;QueA-like 0.7801 63 155 2.40.10.240
ID Description Score Start End GO Terms
AF-A0A3M1A496-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9825 260 364 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A398DRM1-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9781 253 361 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A3D0QF68-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9685 244 361 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A660WTT4-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.968 185 361 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A7C1EK51-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9651 242 361 GO:0002099
GO:0005737
GO:0008616
GO:0051075

Feature Viewer

pLDDT pTM Quality
88.27 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map