metagRoot

F459270

General Info

Members	Datasets	Scaffolds	Average Seq Length
525	243	501	224

Family's Representative Sequence

Representative Sequence	3300013307\|Ga0157372_10066605\|Ga0157372_100666055
Length	232
Sequence	VRAQAGMKPLPPTLEGVLFDLDGTLLDSAPDLYAALKRQCEEEGAPVPPYAPVREVVSRGARAVLRCAFGQLGEPAVEARVDRYLELYGAVMGQATRPFEGIEPMLDQLEAAGVRWGIVTNKAGFLTDELLRRIGWAGRASAVVSGDTLPVKKPDPAPVRLACERAGIDPIRSLFVGDDRRDVMAGAAAGLYTVAVAWGYLDGGDPHEWNADAVLDTPDQFARWLRRGQAVA

Samples

	Sample ID	Description	Type	Environment
1	2537561836	Rhodanobacter spathiphylli B39	Isolate	Unclassified
2	2593339238	Luteibacter sp. UNCMF366Tsu5.1	Isolate	Unclassified
3	2593339239	Luteibacter sp. UNCMF331Sha3.1	Isolate	Unclassified
4	2643221562	Rhodanobacter sp. Root561	Isolate	Unclassified
5	2643221577	Rhodanobacter sp. Root627	Isolate	Unclassified
6	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
7	2643221685	Rhodanobacter sp. Root480	Isolate	Unclassified
8	2687453130	Dyella thiooxydans ATSB10	Isolate	Unclassified
9	2734482264	Dyella sp. AD052	Isolate	Unclassified
10	2738543009	Luteibacter sp. OK325	Isolate	Unclassified
11	2739367700	Dyella sp. YR388	Isolate	Unclassified
12	2818991440	Luteibacter yeojuensis 583	Isolate	Unclassified
13	2842914999	Luteibacter sp. R-72151	Isolate	Unclassified
14	2842918807	Luteibacter sp. R-73110	Isolate	Unclassified
15	2884338543	Luteibacter pinisoli MAH-14	Isolate	Rhizosphere
16	2884411467	Dyella sp. AD56	Isolate	Rhizosphere
17	2895395659	Rhodanobacter sp. T12-5	Isolate	Unclassified
18	2904463128	Luteibacter yeojuensis 3191	Isolate	Unclassified
19	2919085039	Luteibacter sp. 1214	Isolate	Unclassified
20	2919404418	Luteibacter sp. 3190	Isolate	Unclassified
21	2928963466	Dyella japonica 1073	Isolate	Unclassified
22	2939611941	Rhodanobacter soli 1757	Isolate	Rhizosphere
23	2941471342	Luteibacter sp. 621	Isolate	Unclassified
24	2953994433	Luteibacter sp. W1I16	Isolate	Rhizosphere
25	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
26	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
27	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
28	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
29	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
30	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
31	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
32	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
33	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
34	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
35	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
36	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
37	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
38	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
39	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
40	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
41	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
42	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
43	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
44	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
45	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
46	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
47	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
48	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
49	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
50	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
51	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
52	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
53	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
54	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
55	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
56	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
57	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
58	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
59	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
60	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
61	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
62	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
63	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
64	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
65	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
66	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
67	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
68	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
69	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
70	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
71	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
72	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
73	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
74	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
75	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
76	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
77	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
78	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
79	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
80	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
81	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
82	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
84	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
85	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
88	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
89	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
90	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
91	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
92	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
95	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
96	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
97	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
98	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
99	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
100	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
101	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
102	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
103	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
104	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
105	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
115	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
116	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
119	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
120	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
155	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
156	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
157	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
158	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
159	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
160	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
161	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
162	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
163	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
164	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
165	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
166	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
167	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
168	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
169	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
170	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
171	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
172	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
173	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
174	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
175	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
176	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
177	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
178	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
179	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
180	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
181	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
182	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
183	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
184	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
185	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
186	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
187	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
188	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
189	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
190	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
191	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
192	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
193	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
194	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
195	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
196	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
197	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
198	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
199	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
200	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
201	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
202	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
203	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
204	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
205	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
206	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
207	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
208	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
209	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
210	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
211	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
212	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
213	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
214	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
215	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
216	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
217	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
218	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
219	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
220	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
221	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
222	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
223	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
224	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
225	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
226	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
227	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
228	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
231	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
232	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
234	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
237	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
238	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
239	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
243	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.67
Metatranscriptomes	0.76
Isolates	4.57

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	18.29
Nodule	0
Rhizoplane	3.24
Rhizosphere	59.81
Stem	0
Stem Tuber	0
Unclassified	18.67

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10006098	3300001989	Bacteria	4555
2	JGI24737J22298_10003212	3300001990	Bacteria	5799
3	JGI25156J39149_1001926	3300002705	Bacteria	8053
4	JGI25156J39149_1004139	3300002705	Bacteria	4503
5	JGI25162J39368_1000163	3300002737	Bacteria	74121
6	JGI25162J39368_1000895	3300002737	Bacteria	19431
7	JGI25162J39368_1001009	3300002737	Bacteria	17538
8	JGI25162J39368_1001817	3300002737	Bacteria	10019
9	JGI25162J39368_1002271	3300002737	Bacteria	7765
10	JGI25154J39366_1002584	3300002738	Bacteria	4548
11	JGI25157J39369_1000229	3300002741	Bacteria	43921
12	JGI25157J39369_1000804	3300002741	Bacteria	15869
13	JGI25157J39369_1000996	3300002741	Bacteria	13204
14	JGI25157J39369_1001518	3300002741	Bacteria	8435
15	JGI25157J39369_1001578	3300002741	Bacteria	8041
16	JGI25163J39215_1001619	3300002771	Bacteria	3366
17	JGI25164J39214_1000045	3300002772	Bacteria	125909
18	JGI25164J39214_1000285	3300002772	Bacteria	35663
19	JGI25164J39214_1000895	3300002772	Bacteria	10019
20	JGI25164J39214_1001103	3300002772	Bacteria	7765
21	JGI25165J46597_1000072	3300003214	Bacteria	192184
22	JGI25165J46597_1000215	3300003214	Bacteria	81941
23	JGI25165J46597_1001691	3300003214	Bacteria	9962
24	JGI25153J46596_10055055	3300003215	Bacteria	1115
25	rootH1_10012190	3300003316	Bacteria	3610
26	rootH1_10058214	3300003316	Bacteria	2566
27	rootH2_10012587	3300003320	Bacteria	26291
28	rootH2_10076181	3300003320	Bacteria	1354
29	rootH2_10107780	3300003320	Bacteria	1811
30	rootH2_10157713	3300003320	Bacteria	1267
31	rootH2_10157714	3300003320	Bacteria	1384
32	rootL2_10172163	3300003322	Bacteria	2894
33	Ga0006562J51391_1014503	3300003578	Bacteria	8470
34	Ga0006562J51391_1014506	3300003578	Bacteria	6840
35	Ga0006562J51391_1182275	3300003578	Bacteria	5201
36	Ga0006562J51391_1182276	3300003578	Bacteria	3790
37	Ga0055538_1001562	3300003751	Bacteria	4207
38	Ga0055539_1002669	3300003752	Bacteria	2653
39	Ga0055539_1011031	3300003752	Bacteria	1116
40	Ga0055533_1000617	3300003756	Bacteria	12010
41	Ga0055533_1001642	3300003756	Bacteria	5755
42	Ga0055525_1000027	3300003759	Bacteria	340506
43	Ga0055527_1000082	3300003760	Bacteria	75048
44	Ga0055527_1000209	3300003760	Bacteria	37913
45	Ga0055527_1001667	3300003760	Bacteria	4381
46	Ga0055535_1000124	3300003761	Bacteria	81941
47	Ga0055535_1000143	3300003761	Bacteria	75049
48	Ga0055535_1000451	3300003761	Bacteria	37913
49	Ga0055535_1001467	3300003761	Bacteria	11877
50	Ga0055535_1001833	3300003761	Bacteria	9117
51	Ga0055542_1000190	3300003762	Bacteria	75049
52	Ga0055542_1000197	3300003762	Bacteria	74121
53	Ga0055542_1000466	3300003762	Bacteria	37913
54	Ga0055542_1001205	3300003762	Bacteria	14614
55	Ga0055542_1001440	3300003762	Bacteria	11865
56	Ga0055542_1001764	3300003762	Bacteria	9117
57	Ga0055542_1010406	3300003762	Bacteria	1700
58	Ga0055529_1000197	3300003763	Bacteria	81941
59	Ga0055529_1000204	3300003763	Bacteria	78293
60	Ga0055529_1000217	3300003763	Bacteria	75049
61	Ga0055529_1000671	3300003763	Bacteria	23784
62	Ga0065165_1000587	3300005262	Bacteria	53507
63	Ga0065165_1003615	3300005262	Bacteria	10615
64	Ga0070670_100062735	3300005331	Bacteria	3190
65	Ga0070666_10000005	3300005335	Bacteria	343092
66	Ga0070682_100005295	3300005337	Bacteria	7180
67	Ga0070682_100011835	3300005337	Bacteria	4991
68	Ga0070682_100635572	3300005337	Bacteria	848
69	Ga0070660_100015081	3300005339	Bacteria	5576
70	Ga0070660_100015362	3300005339	Bacteria	5525
71	Ga0070689_100000503	3300005340	Bacteria	23097
72	Ga0070661_100007160	3300005344	Bacteria	7692
73	Ga0070661_100019917	3300005344	Bacteria	4782
74	Ga0070661_100027284	3300005344	Bacteria	4110
75	Ga0070692_10017423	3300005345	Bacteria	3435
76	Ga0070688_100406052	3300005365	Bacteria	1009
77	Ga0070659_100008535	3300005366	Bacteria	7486
78	Ga0070659_100045224	3300005366	Bacteria	3448
79	Ga0070659_100250726	3300005366	Bacteria	1467
80	Ga0070659_100486487	3300005366	Bacteria	1050
81	Ga0070709_10408452	3300005434	Bacteria	1015
82	Ga0070714_100002041	3300005435	Bacteria	14793
83	Ga0070714_100003673	3300005435	Bacteria	11488
84	Ga0070713_100002146	3300005436	Bacteria	12752
85	Ga0070710_10076724	3300005437	Bacteria	1940
86	Ga0070694_100074176	3300005444	Bacteria	2351
87	Ga0070694_100428025	3300005444	Bacteria	1041
88	Ga0070663_100024906	3300005455	Bacteria	4034
89	Ga0070663_100114572	3300005455	Bacteria	2030
90	Ga0070662_100097095	3300005457	Bacteria	2223
91	Ga0070662_100193969	3300005457	Bacteria	1608
92	Ga0070681_10033942	3300005458	Bacteria	5122
93	Ga0070681_10313268	3300005458	Bacteria	1479
94	Ga0070685_10002217	3300005466	Bacteria	10022
95	Ga0070679_100447160	3300005530	Bacteria	1237
96	Ga0068853_100002365	3300005539	Bacteria	14105
97	Ga0070696_100002542	3300005546	Bacteria	12087
98	Ga0070693_100020439	3300005547	Bacteria	3491
99	Ga0070665_100031284	3300005548	Bacteria	5356
100	Ga0068855_100020454	3300005563	Bacteria	7937
101	Ga0068855_100031508	3300005563	Bacteria	6331
102	Ga0070664_100056433	3300005564	Bacteria	3337
103	Ga0068857_100000591	3300005577	Bacteria	26568
104	Ga0068854_100001805	3300005578	Bacteria	13020
105	Ga0068856_100008712	3300005614	Bacteria	9869
106	Ga0068852_100321382	3300005616	Bacteria	1503
107	Ga0068859_100526224	3300005617	Bacteria	1277
108	Ga0068858_100026962	3300005842	Bacteria	5337
109	Ga0068858_100074036	3300005842	Bacteria	3162
110	Ga0068860_100777556	3300005843	Bacteria	970
111	Ga0070712_100347410	3300006175	Bacteria	1213
112	Ga0075369_10046397	3300006186	Bacteria	1871
113	Ga0097620_100526179	3300006931	Bacteria	1277
114	Ga0105240_10017472	3300009093	Bacteria	9666
115	Ga0105240_10017515	3300009093	Bacteria	9652
116	Ga0105240_10025699	3300009093	Bacteria	7736
117	Ga0105240_10032828	3300009093	Bacteria	6715
118	Ga0105241_10038015	3300009174	Bacteria	3629
119	Ga0105241_10527186	3300009174	Bacteria	1057
120	Ga0105237_10000064	3300009545	Bacteria	139463
121	Ga0105237_10104031	3300009545	Bacteria	2831
122	Ga0105238_10000924	3300009551	Bacteria	30076
123	Ga0105238_10012802	3300009551	Bacteria	8465
124	Ga0105239_10000030	3300010375	Bacteria	233669
125	Ga0105239_10010561	3300010375	Bacteria	10324
126	Ga0105239_10181121	3300010375	Bacteria	2357
127	Ga0157314_1000130	3300012500	Bacteria	8211
128	Ga0157373_10037776	3300013100	Bacteria	3460
129	Ga0157373_10309838	3300013100	Bacteria	1122
130	Ga0157373_10342836	3300013100	Bacteria	1065
131	Ga0157371_10007084	3300013102	Bacteria	9118
132	Ga0157370_10000293	3300013104	Bacteria	63396
133	Ga0157370_10001525	3300013104	Bacteria	28645
134	Ga0157370_10019471	3300013104	Bacteria	6807
135	Ga0157370_10044325	3300013104	Bacteria	4276
136	Ga0157370_10070652	3300013104	Bacteria	3295
137	Ga0157370_10075220	3300013104	Bacteria	3184
138	Ga0157370_10080786	3300013104	Bacteria	3061
139	Ga0157369_10000509	3300013105	Bacteria	51146
140	Ga0157369_10053631	3300013105	Bacteria	4357
141	Ga0163162_10048390	3300013306	Bacteria	4260
142	Ga0163162_10250103	3300013306	Bacteria	1904
143	Ga0157372_10001376	3300013307	Bacteria	26252
144	Ga0157372_10066605	3300013307	Bacteria	4046
145	Ga0182008_10002353	3300014497	Bacteria	11897
146	Ga0182008_10004608	3300014497	Bacteria	8025
147	Ga0182008_10021939	3300014497	Bacteria	3274
148	Ga0182008_10068585	3300014497	Bacteria	1745
149	Ga0182008_10091421	3300014497	Bacteria	1500
150	Ga0157379_10378592	3300014968	Bacteria	1298
151	Ga0157376_10041966	3300014969	Bacteria	3748
152	Ga0182006_1000085	3300015261	Bacteria	117595
153	Ga0182006_1001993	3300015261	Bacteria	11510
154	Ga0182006_1009764	3300015261	Bacteria	4292
155	Ga0182007_10023128	3300015262	Bacteria	2188
156	Ga0182007_10025262	3300015262	Bacteria	2070
157	Ga0182005_1000028	3300015265	Bacteria	221889
158	Ga0182005_1001312	3300015265	Bacteria	10188
159	Ga0182005_1040505	3300015265	Bacteria	1267
160	Ga0183369_1007	3300015685	Bacteria	414878
161	Ga0183368_1003	3300015687	Bacteria	1276390
162	Ga0163161_10001533	3300017792	Bacteria	17070
163	Ga0209435_103139	3300025206	Bacteria	1895
164	Ga0209760_100451	3300025207	Bacteria	9390
165	Ga0209784_100120	3300025224	Bacteria	82684
166	Ga0209566_106276	3300025225	Bacteria	1418
167	Ga0209674_100012	3300025226	Bacteria	950162
168	Ga0209674_100119	3300025226	Bacteria	135468
169	Ga0209674_101621	3300025226	Bacteria	5639
170	Ga0209674_101928	3300025226	Bacteria	4869
171	Ga0209672_100005	3300025228	Bacteria	1069303
172	Ga0209672_100016	3300025228	Bacteria	522604
173	Ga0209672_100277	3300025228	Bacteria	37238
174	Ga0209672_100887	3300025228	Bacteria	13631
175	Ga0209672_101154	3300025228	Bacteria	10845
176	Ga0209672_103907	3300025228	Bacteria	2918
177	Ga0209563_100023	3300025230	Bacteria	636844
178	Ga0207427_100013	3300025231	Bacteria	581419
179	Ga0207427_100055	3300025231	Bacteria	209093
180	Ga0207427_100244	3300025231	Bacteria	43765
181	Ga0207427_100248	3300025231	Bacteria	42623
182	Ga0207427_102252	3300025231	Bacteria	5410
183	Ga0209437_100015	3300025233	Bacteria	713457
184	Ga0209437_100020	3300025233	Bacteria	656374
185	Ga0209437_100079	3300025233	Bacteria	275948
186	Ga0209437_100161	3300025233	Bacteria	148264
187	Ga0209437_100224	3300025233	Bacteria	101515
188	Ga0209437_100476	3300025233	Bacteria	30448
189	Ga0209258_100006	3300025242	Bacteria	1069303
190	Ga0209258_100012	3300025242	Bacteria	825544
191	Ga0209258_100049	3300025242	Bacteria	358328
192	Ga0209258_100064	3300025242	Bacteria	293837
193	Ga0209258_100186	3300025242	Bacteria	132381
194	Ga0209258_101044	3300025242	Bacteria	12271
195	Ga0209646_1001157	3300025246	Bacteria	7711
196	Ga0209646_1001176	3300025246	Bacteria	7603
197	Ga0209646_1023248	3300025246	Bacteria	880
198	Ga0209026_1000037	3300025250	Bacteria	282562
199	Ga0209026_1000204	3300025250	Bacteria	81999
200	Ga0209026_1000375	3300025250	Bacteria	41000
201	Ga0209026_1000541	3300025250	Bacteria	26051
202	Ga0209026_1002787	3300025250	Bacteria	6225
203	Ga0209677_111543	3300025253	Bacteria	1371
204	Ga0209148_1000005	3300025254	Bacteria	1806504
205	Ga0209148_1000010	3300025254	Bacteria	1265567
206	Ga0209148_1000012	3300025254	Bacteria	1069303
207	Ga0209148_1000014	3300025254	Bacteria	925277
208	Ga0209148_1000073	3300025254	Bacteria	320851
209	Ga0209148_1000142	3300025254	Bacteria	163404
210	Ga0209148_1004544	3300025254	Bacteria	3388
211	Ga0209759_1000103	3300025256	Bacteria	153195
212	Ga0209759_1000672	3300025256	Bacteria	31426
213	Ga0209759_1000792	3300025256	Bacteria	25985
214	Ga0209759_1014900	3300025256	Bacteria	2031
215	Ga0209129_1001735	3300025258	Bacteria	11717
216	Ga0209129_1005774	3300025258	Bacteria	4240
217	Ga0209233_1000009	3300025261	Bacteria	1265567
218	Ga0209233_1000020	3300025261	Bacteria	798224
219	Ga0209233_1000063	3300025261	Bacteria	395810
220	Ga0209233_1000147	3300025261	Bacteria	186517
221	Ga0209233_1006986	3300025261	Bacteria	3605
222	Ga0209233_1026589	3300025261	Bacteria	1412
223	Ga0209455_1000008	3300025272	Bacteria	1069303
224	Ga0209455_1000014	3300025272	Bacteria	806601
225	Ga0209455_1000082	3300025272	Bacteria	257909
226	Ga0209455_1000177	3300025272	Bacteria	106026
227	Ga0209455_1002695	3300025272	Bacteria	6684
228	Ga0209758_1003436	3300025297	Bacteria	14415
229	Ga0209051_1034134	3300025303	Bacteria	1912
230	Ga0207692_10052783	3300025898	Bacteria	2067
231	Ga0207710_10009627	3300025900	Bacteria	4058
232	Ga0207680_10000005	3300025903	Bacteria	660983
233	Ga0207647_10000512	3300025904	Bacteria	30880
234	Ga0207647_10001940	3300025904	Bacteria	15811
235	Ga0207647_10014059	3300025904	Bacteria	5533
236	Ga0207647_10022890	3300025904	Bacteria	4143
237	Ga0207705_10002446	3300025909	Bacteria	14328
238	Ga0207705_10013387	3300025909	Bacteria	5917
239	Ga0207707_10008818	3300025912	Bacteria	8757
240	Ga0207707_10720695	3300025912	Bacteria	836
241	Ga0207695_10003105	3300025913	Bacteria	23782
242	Ga0207695_10004047	3300025913	Bacteria	20165
243	Ga0207695_10004907	3300025913	Bacteria	18022
244	Ga0207695_10050523	3300025913	Bacteria	4373
245	Ga0207671_10000061	3300025914	Bacteria	175061
246	Ga0207671_10275600	3300025914	Bacteria	1326
247	Ga0207663_10311405	3300025916	Bacteria	1180
248	Ga0207657_10028402	3300025919	Bacteria	5103
249	Ga0207657_10035345	3300025919	Bacteria	4482
250	Ga0207649_10011726	3300025920	Bacteria	4844
251	Ga0207649_10016581	3300025920	Bacteria	4158
252	Ga0207649_10033090	3300025920	Bacteria	3087
253	Ga0207694_10001362	3300025924	Bacteria	21050
254	Ga0207694_10029488	3300025924	Bacteria	4187
255	Ga0207694_10341797	3300025924	Bacteria	1238
256	Ga0207650_10034988	3300025925	Bacteria	3645
257	Ga0207650_10406289	3300025925	Bacteria	1128
258	Ga0207700_10057819	3300025928	Bacteria	2926
259	Ga0207664_10000026	3300025929	Bacteria	194571
260	Ga0207664_10001714	3300025929	Bacteria	14452
261	Ga0207664_10203153	3300025929	Bacteria	1711
262	Ga0207690_10002499	3300025932	Bacteria	11123
263	Ga0207690_10003314	3300025932	Bacteria	9634
264	Ga0207690_10003820	3300025932	Bacteria	8911
265	Ga0207690_10062025	3300025932	Bacteria	2543
266	Ga0207690_10200575	3300025932	Bacteria	1515
267	Ga0207706_10077962	3300025933	Bacteria	2914
268	Ga0207670_10000709	3300025936	Bacteria	17570
269	Ga0207679_10284779	3300025945	Bacteria	1419
270	Ga0207667_10000119	3300025949	Bacteria	124365
271	Ga0207667_10003156	3300025949	Bacteria	20387
272	Ga0207667_10005743	3300025949	Bacteria	15144
273	Ga0207640_10000797	3300025981	Bacteria	17930
274	Ga0207640_10009780	3300025981	Bacteria	5377
275	Ga0207658_10861819	3300025986	Bacteria	824
276	Ga0207703_10029561	3300026035	Bacteria	4325
277	Ga0207703_10058077	3300026035	Bacteria	3157
278	Ga0207639_10013353	3300026041	Bacteria	5748
279	Ga0207678_10016567	3300026067	Bacteria	6472
280	Ga0207678_10080190	3300026067	Bacteria	2795
281	Ga0207678_10119809	3300026067	Bacteria	2246
282	Ga0207678_10362607	3300026067	Bacteria	1251
283	Ga0207678_10422438	3300026067	Bacteria	1156
284	Ga0207702_10000937	3300026078	Bacteria	30118
285	Ga0207674_10000226	3300026116	Bacteria	70605
286	Ga0207674_10020397	3300026116	Bacteria	7160
287	Ga0207698_10421184	3300026142	Bacteria	1281
288	Ga0268266_10000004	3300028379	Bacteria	1495817
289	Ga0268264_10703055	3300028381	Bacteria	1004
290	Ga0307405_10052926	3300031731	Bacteria	2527
291	Ga0307412_10002224	3300031911	Bacteria	10775
292	Ga0307510_10006545	3300033180	Bacteria	13894
293	Ga0307510_10142629	3300033180	Bacteria	2035
294	Ga0395899_0000108	3300037312	Bacteria	142347
295	Ga0395899_0003966	3300037312	Bacteria	11658
296	Ga0395899_0025215	3300037312	Bacteria	4489
297	Ga0395899_0041216	3300037312	Bacteria	3450
298	Ga0395899_0151192	3300037312	Bacteria	1645
299	Ga0395900_0000144	3300037418	Bacteria	119971
300	Ga0395900_0002611	3300037418	Bacteria	19685
301	Ga0395900_0004074	3300037418	Bacteria	15582
302	Ga0395900_0094595	3300037418	Bacteria	3069
303	Ga0395900_0311818	3300037418	Bacteria	1556
304	Ga0395898_0000018	3300037466	Bacteria	418600
305	Ga0395898_0000049	3300037466	Bacteria	284792
306	Ga0395898_0010041	3300037466	Bacteria	9910
307	Ga0395898_0010070	3300037466	Bacteria	9895
308	Ga0395898_0095680	3300037466	Bacteria	2853
309	Ga0395905_0147239	3300037471	Bacteria	2216
310	Ga0395901_0007439	3300038443	Bacteria	11052
311	Ga0395901_0007941	3300038443	Bacteria	10703
312	Ga0395901_0026088	3300038443	Bacteria	6000
313	Ga0395901_0046899	3300038443	Bacteria	4489
314	Ga0395901_0068848	3300038443	Bacteria	3686
315	Ga0395901_0077574	3300038443	Bacteria	3467
316	Ga0395901_0161973	3300038443	Bacteria	2349
317	Ga0395901_0209993	3300038443	Bacteria	2038
318	Ga0395901_0370010	3300038443	Bacteria	1476
319	Ga0439436_0000030	3300041404	Bacteria	48429
320	Ga0439465_0005693	3300041413	Bacteria	3965
321	Ga0451793_1722862	3300041452	Bacteria	1187
322	Ga0439437_004686	3300042000	Bacteria	1495
323	Ga0439432_034934	3300042006	Bacteria	1612
324	Ga0450908_000350	3300042184	Bacteria	8908
325	Ga0439459_0014893	3300042438	Bacteria	1419
326	Ga0439459_0021406	3300042438	Bacteria	1241
327	Ga0466969_0001731	3300044656	Bacteria	11648
328	Ga0466969_0006502	3300044656	Bacteria	6219
329	Ga0466969_0006507	3300044656	Bacteria	6214
330	Ga0466982_0000003	3300044672	Bacteria	417243
331	Ga0466982_0000612	3300044672	Bacteria	10925
332	Ga0466965_0032619	3300044683	Bacteria	2543
333	Ga0466965_0386360	3300044683	Bacteria	771
334	Ga0466966_0003978	3300044684	Bacteria	9768
335	Ga0466966_0009639	3300044684	Bacteria	6390
336	Ga0466961_0008586	3300044693	Bacteria	6509
337	Ga0466961_0009792	3300044693	Bacteria	6099
338	Ga0466961_0075908	3300044693	Bacteria	2130
339	Ga0466961_0156412	3300044693	Bacteria	1422
340	Ga0466961_0168091	3300044693	Bacteria	1364
341	Ga0466963_0110486	3300044694	Bacteria	1887
342	Ga0466971_0001052	3300044719	Bacteria	11434
343	Ga0466971_0003433	3300044719	Bacteria	6777
344	Ga0466971_0009181	3300044719	Bacteria	4324
345	Ga0466968_0001048	3300044735	Bacteria	9788
346	Ga0466968_0002071	3300044735	Bacteria	7302
347	Ga0466970_0014209	3300044765	Bacteria	4083
348	Ga0466970_0033957	3300044765	Bacteria	2698
349	Ga0466970_0063659	3300044765	Bacteria	1977
350	Ga0466970_0069613	3300044765	Bacteria	1891
351	Ga0466970_0118079	3300044765	Bacteria	1451
352	Ga0466957_0007781	3300044842	Bacteria	6067
353	Ga0466957_0237061	3300044842	Bacteria	1209
354	Ga0466959_0000194	3300045049	Bacteria	39999
355	Ga0466959_0043088	3300045049	Bacteria	3328
356	Ga0466959_0088600	3300045049	Bacteria	2224
357	Ga0466959_0348059	3300045049	Bacteria	1010
358	Ga0466958_0125933	3300045836	Bacteria	1606
359	Ga0466958_0170890	3300045836	Bacteria	1376
360	Ga0466958_0246863	3300045836	Bacteria	1141
361	Ga0466967_0094326	3300045976	Bacteria	2725
362	Ga0466967_0454074	3300045976	Bacteria	1253
363	Ga0466967_0598586	3300045976	Bacteria	1088
364	Ga0466967_0868115	3300045976	Bacteria	897
365	Ga0495617_002295	3300046452	Bacteria	7723
366	Ga0495638_0000038	3300046460	Bacteria	249534
367	Ga0495638_0000234	3300046460	Bacteria	75860
368	Ga0495638_0001171	3300046460	Bacteria	25181
369	Ga0495650_0000337	3300046471	Bacteria	83530
370	Ga0495650_0001325	3300046471	Bacteria	24874
371	Ga0495584_0122061	3300046491	Bacteria	1319
372	Ga0495585_0000104	3300046492	Bacteria	90097
373	Ga0495585_0024980	3300046492	Bacteria	3424
374	Ga0495607_0120125	3300046501	Bacteria	1381
375	Ga0495606_0000338	3300046507	Bacteria	80898
376	Ga0495606_0000401	3300046507	Bacteria	73149
377	Ga0495606_0012374	3300046507	Bacteria	6848
378	Ga0495606_0262276	3300046507	Bacteria	953
379	Ga0495610_0000482	3300046512	Bacteria	41191
380	Ga0495616_0000086	3300046513	Bacteria	78187
381	Ga0495620_0001045	3300046515	Bacteria	16982
382	Ga0495631_0000974	3300046518	Bacteria	17774
383	Ga0495632_0000004	3300046519	Bacteria	381372
384	Ga0495632_0014432	3300046519	Bacteria	4469
385	Ga0495648_0000914	3300046524	Bacteria	30767
386	Ga0495597_0062199	3300046542	Bacteria	1625
387	Ga0495622_0019037	3300046557	Bacteria	3198
388	Ga0495668_0007971	3300046616	Bacteria	6677
389	Ga0495625_0013223	3300046660	Bacteria	6645
390	Ga0495625_0015363	3300046660	Bacteria	6067
391	Ga0495625_0051026	3300046660	Bacteria	2967
392	Ga0495661_0000199	3300046665	Bacteria	69536
393	Ga0495670_0003561	3300046691	Bacteria	7651
394	Ga0495670_0010407	3300046691	Bacteria	4569
395	Ga0495649_0000553	3300046694	Bacteria	31708
396	Ga0495660_0005305	3300046810	Bacteria	7719
397	Ga0495683_0001981	3300047323	Bacteria	12761
398	Ga0495673_0000004	3300047469	Bacteria	1354526
399	Ga0495673_0192013	3300047469	Bacteria	768
400	Ga0495686_0000017	3300047472	Bacteria	435554
401	Ga0495686_0001206	3300047472	Bacteria	29747
402	Ga0495686_0018752	3300047472	Bacteria	4635
403	Ga0495686_0047312	3300047472	Bacteria	2716
404	Ga0496100_0001852	3300048903	Bacteria	10584
405	Ga0496100_0069201	3300048903	Bacteria	2350
406	Ga0496100_0187343	3300048903	Bacteria	1500
407	Ga0496101_0000776	3300048904	Bacteria	18897
408	Ga0496101_0147317	3300048904	Bacteria	1798
409	Ga0496104_0158978	3300048907	Bacteria	2168
410	Ga0496105_0008971	3300048908	Bacteria	7801
411	Ga0496106_0001299	3300048909	Bacteria	18754
412	Ga0496107_0015203	3300048910	Bacteria	5392
413	Ga0496112_0163509	3300048915	Bacteria	2192
414	Ga0496113_0007592	3300048916	Bacteria	6996
415	Ga0496114_0555487	3300048917	Bacteria	1014
416	Ga0496115_0000503	3300048918	Bacteria	30610
417	Ga0496115_0002471	3300048918	Bacteria	13281
418	Ga0496115_0012375	3300048918	Bacteria	6418
419	Ga0496115_0076332	3300048918	Bacteria	2723
420	Ga0496116_0170615	3300048919	Bacteria	1179
421	Ga0496117_0002308	3300048920	Bacteria	24516
422	Ga0496117_0022702	3300048920	Bacteria	5025
423	Ga0496117_0096322	3300048920	Bacteria	1888
424	Ga0496118_0001694	3300048921	Bacteria	32220
425	Ga0496118_0005974	3300048921	Bacteria	13580
426	Ga0496118_0018381	3300048921	Bacteria	6310
427	Ga0496118_0018478	3300048921	Bacteria	6288
428	Ga0496118_0075542	3300048921	Bacteria	2402
429	Ga0496118_0079530	3300048921	Bacteria	2313
430	Ga0496119_0000430	3300048922	Bacteria	57802
431	Ga0496119_0008458	3300048922	Bacteria	9034
432	Ga0496119_0031460	3300048922	Bacteria	3558
433	Ga0496120_0001482	3300048923	Bacteria	27908
434	Ga0496120_0002085	3300048923	Bacteria	21429
435	Ga0496121_0000743	3300048924	Bacteria	59998
436	Ga0496121_0000878	3300048924	Bacteria	54427
437	Ga0496121_0013621	3300048924	Bacteria	8719
438	Ga0496121_0015192	3300048924	Bacteria	8094
439	Ga0496121_0015809	3300048924	Bacteria	7856
440	Ga0496121_0034829	3300048924	Bacteria	4524
441	Ga0496121_0045856	3300048924	Bacteria	3750
442	Ga0496121_0111283	3300048924	Bacteria	2088
443	Ga0496121_0182438	3300048924	Bacteria	1513
444	Ga0496122_0021496	3300048925	Bacteria	5774
445	Ga0496122_0025814	3300048925	Bacteria	5088
446	Ga0496122_0120671	3300048925	Bacteria	1691
447	Ga0496123_0044054	3300048926	Bacteria	3055
448	Ga0496123_0053361	3300048926	Bacteria	2672
449	Ga0496123_0126132	3300048926	Bacteria	1428
450	Ga0496124_0001044	3300048927	Bacteria	43754
451	Ga0496124_0007573	3300048927	Bacteria	11514
452	Ga0496125_0000330	3300048928	Bacteria	91043
453	Ga0496126_0003181	3300048929	Bacteria	21118
454	Ga0496126_0013428	3300048929	Bacteria	8330
455	Ga0496126_0039582	3300048929	Bacteria	4373
456	Ga0496126_0040236	3300048929	Bacteria	4334
457	Ga0496126_0150674	3300048929	Bacteria	1994
458	Ga0496126_0166085	3300048929	Bacteria	1883
459	Ga0496126_0258780	3300048929	Bacteria	1448
460	Ga0495682_0012370	3300049460	Bacteria	3272
461	Ga0495682_0017100	3300049460	Bacteria	2741
462	Ga0501031_0177696	3300049568	Bacteria	1391
463	Ga0501031_0220780	3300049568	Bacteria	1234
464	Ga0501032_0016603	3300049569	Bacteria	5176
465	Ga0501032_0063787	3300049569	Bacteria	2466
466	Ga0501032_0350047	3300049569	Bacteria	952
467	Ga0501033_0010485	3300049570	Bacteria	7109
468	Ga0501033_0245882	3300049570	Bacteria	1269
469	Ga0501034_0004365	3300049571	Bacteria	15758
470	Ga0501034_0171258	3300049571	Bacteria	2138
471	Ga0501034_0271332	3300049571	Bacteria	1637
472	Ga0501036_0033958	3300049572	Bacteria	4315
473	Ga0501036_0166283	3300049572	Bacteria	1859
474	Ga0501037_0005496	3300049573	Bacteria	9239
475	Ga0501037_0081979	3300049573	Bacteria	2338
476	Ga0501037_0177519	3300049573	Bacteria	1512
477	Ga0501038_0044973	3300049574	Bacteria	3834
478	Ga0501038_0309519	3300049574	Bacteria	1238
479	Ga0501043_0019217	3300049579	Bacteria	5364
480	Ga0501043_0058545	3300049579	Bacteria	3024
481	Ga0501043_0059933	3300049579	Bacteria	2987
482	Ga0501043_0185975	3300049579	Bacteria	1617
483	Ga0501046_0050304	3300049580	Bacteria	3293
484	Ga0501046_0189508	3300049580	Bacteria	1535
485	Ga0501046_0341911	3300049580	Bacteria	1087
486	Ga0501047_0006844	3300049581	Bacteria	10712
487	Ga0501047_0014768	3300049581	Bacteria	7432
488	Ga0501047_0205077	3300049581	Bacteria	1831
489	Ga0501070_0050335	3300049586	Bacteria	3459
490	Ga0501077_0145042	3300049593	Bacteria	1506
491	Ga0501035_0001816	3300049822	Bacteria	21577
492	Ga0501035_0005013	3300049822	Bacteria	12539
493	Ga0501044_0013654	3300049823	Bacteria	8777
494	Ga0501044_0045810	3300049823	Bacteria	4530
495	Ga0501044_0054482	3300049823	Bacteria	4110
496	Ga0501044_0058971	3300049823	Bacteria	3934
497	Ga0501044_0163622	3300049823	Bacteria	2200
498	nmdc:mga0qj67_116912_c1	3300050509	Bacteria	2155
499	Ga0466962_0009172	3300061719	Bacteria	4738
500	Ga0466962_0019279	3300061719	Bacteria	3276
501	Ga0466962_0182492	3300061719	Bacteria	1023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049569	Ga0501032_0350047	Ga0501032_0350047_37_651	192
2	3300048927	Ga0496124_0001044	Ga0496124_0001044_7992_8672	201
3	iso_pu_bacteria	2643221654	2644305764	202
4	3300045836	Ga0466958_0246863	Ga0466958_0246863_510_1130	203
5	3300048909	Ga0496106_0001299	Ga0496106_0001299_13023_13703	206
6	3300048924	Ga0496121_0182438	Ga0496121_0182438_91_771	206
7	3300050509	nmdc:mga0qj67_116912_c1	nmdc:mga0qj67_116912_c1_1468_2115	206
8	3300045049	Ga0466959_0348059	Ga0466959_0348059_348_989	207
9	3300037312	Ga0395899_0000108	Ga0395899_0000108_78061_78705	208
10	3300037466	Ga0395898_0000018	Ga0395898_0000018_335905_336549	208
11	3300038443	Ga0395901_0370010	Ga0395901_0370010_612_1256	208
12	3300044656	Ga0466969_0006507	Ga0466969_0006507_2689_3333	208
13	3300044693	Ga0466961_0168091	Ga0466961_0168091_273_917	208
14	3300044765	Ga0466970_0118079	Ga0466970_0118079_466_1110	208
15	3300045976	Ga0466967_0094326	Ga0466967_0094326_1665_2309	208
16	3300044672	Ga0466982_0000003	Ga0466982_0000003_334236_334916	211
17	3300044683	Ga0466965_0386360	Ga0466965_0386360_51_731	211
18	3300044684	Ga0466966_0003978	Ga0466966_0003978_3403_4083	211
19	3300044693	Ga0466961_0075908	Ga0466961_0075908_913_1593	211
20	3300044719	Ga0466971_0001052	Ga0466971_0001052_9996_10676	211
21	3300044735	Ga0466968_0001048	Ga0466968_0001048_2683_3363	211
22	3300044765	Ga0466970_0033957	Ga0466970_0033957_1309_1989	211
23	3300045836	Ga0466958_0170890	Ga0466958_0170890_235_915	211
24	3300048924	Ga0496121_0015192	Ga0496121_0015192_2950_3621	211
25	3300061719	Ga0466962_0009172	Ga0466962_0009172_463_1143	211
26	3300049580	Ga0501046_0189508	Ga0501046_0189508_832_1515	212
27	3300049823	Ga0501044_0013654	Ga0501044_0013654_1651_2307	212
28	3300049574	Ga0501038_0309519	Ga0501038_0309519_10_669	213
29	iso_pu_bacteria	2739367700	2739730264	213
30	iso_pu_bacteria	2884411467	2884412140	213
31	iso_pu_bacteria	2928963466	2928967700	213
32	iso_pu_bacteria	2687453130	2687583764	215
33	iso_pu_bacteria	2593339238	2595446794	216
34	iso_pu_bacteria	2593339239	2595449557	216
35	iso_pu_bacteria	2643221577	2643896776	216
36	iso_pu_bacteria	2643221685	2644478981	216
37	iso_pu_bacteria	2734482264	2735833473	216
38	iso_pu_bacteria	2738543009	2739229473	216
39	iso_pu_bacteria	2818991440	2819563948	216
40	iso_pu_bacteria	2842914999	2842918509	216
41	iso_pu_bacteria	2842918807	2842919868	216
42	iso_pu_bacteria	2884338543	2884341467	216
43	iso_pu_bacteria	2895395659	2895397674	216
44	iso_pu_bacteria	2904463128	2904464584	216
45	iso_pu_bacteria	2919085039	2919088332	216
46	iso_pu_bacteria	2919404418	2919406086	216
47	iso_pu_bacteria	2939611941	2939612511	216
48	iso_pu_bacteria	2941471342	2941472916	216
49	iso_pu_bacteria	2953994433	2953995165	216
50	3300002737	JGI25162J39368_1000163	JGI25162J39368_100016370	217
51	3300002737	JGI25162J39368_1001009	JGI25162J39368_10010098	217
52	3300002741	JGI25157J39369_1000804	JGI25157J39369_10008048	217
53	3300002741	JGI25157J39369_1001518	JGI25157J39369_10015182	217
54	3300002771	JGI25163J39215_1001619	JGI25163J39215_10016192	217
55	3300002772	JGI25164J39214_1000285	JGI25164J39214_100028531	217
56	3300003214	JGI25165J46597_1000215	JGI25165J46597_10002158	217
57	3300003320	rootH2_10157713	rootH2_101577132	217
58	3300003320	rootH2_10157714	rootH2_101577142	217
59	3300003751	Ga0055538_1001562	Ga0055538_10015625	217
60	3300003756	Ga0055533_1000617	Ga0055533_100061713	217
61	3300003761	Ga0055535_1000124	Ga0055535_10001248	217
62	3300003762	Ga0055542_1000197	Ga0055542_10001978	217
63	3300003762	Ga0055542_1001205	Ga0055542_10012057	217
64	3300003763	Ga0055529_1000197	Ga0055529_100019774	217
65	3300005340	Ga0070689_100000503	Ga0070689_10000050316	217
66	3300005344	Ga0070661_100007160	Ga0070661_1000071606	217
67	3300005365	Ga0070688_100406052	Ga0070688_1004060522	217
68	3300005455	Ga0070663_100114572	Ga0070663_1001145722	217
69	3300005466	Ga0070685_10002217	Ga0070685_100022178	217
70	3300013105	Ga0157369_10053631	Ga0157369_100536315	217
71	3300013306	Ga0163162_10250103	Ga0163162_102501033	217
72	3300014497	Ga0182008_10091421	Ga0182008_100914212	217
73	3300014969	Ga0157376_10041966	Ga0157376_100419665	217
74	3300015687	Ga0183368_1003	Ga0183368_1003731	217
75	3300025206	Ga0209435_103139	Ga0209435_1031393	217
76	3300025207	Ga0209760_100451	Ga0209760_1004517	217
77	3300025224	Ga0209784_100120	Ga0209784_1001207	217
78	3300025225	Ga0209566_106276	Ga0209566_1062762	217
79	3300025226	Ga0209674_100012	Ga0209674_100012482	217
80	3300025228	Ga0209672_101154	Ga0209672_1011545	217
81	3300025228	Ga0209672_103907	Ga0209672_1039074	217
82	3300025231	Ga0207427_100013	Ga0207427_100013529	217
83	3300025231	Ga0207427_102252	Ga0207427_1022523	217
84	3300025233	Ga0209437_100015	Ga0209437_1000157	217
85	3300025233	Ga0209437_100224	Ga0209437_10022436	217
86	3300025242	Ga0209258_100049	Ga0209258_100049114	217
87	3300025242	Ga0209258_101044	Ga0209258_10104410	217
88	3300025246	Ga0209646_1001176	Ga0209646_10011764	217
89	3300025246	Ga0209646_1023248	Ga0209646_10232482	217
90	3300025250	Ga0209026_1000204	Ga0209026_10002047	217
91	3300025250	Ga0209026_1002787	Ga0209026_10027877	217
92	3300025254	Ga0209148_1000005	Ga0209148_1000005982	217
93	3300025254	Ga0209148_1000010	Ga0209148_1000010906	217
94	3300025256	Ga0209759_1000672	Ga0209759_10006727	217
95	3300025256	Ga0209759_1014900	Ga0209759_10149002	217
96	3300025261	Ga0209233_1000009	Ga0209233_1000009264	217
97	3300025261	Ga0209233_1006986	Ga0209233_10069864	217
98	3300025261	Ga0209233_1026589	Ga0209233_10265892	217
99	3300025272	Ga0209455_1000082	Ga0209455_10000827	217
100	3300025904	Ga0207647_10022890	Ga0207647_100228902	217
101	3300025920	Ga0207649_10033090	Ga0207649_100330903	217
102	3300025924	Ga0207694_10029488	Ga0207694_100294885	217
103	3300025936	Ga0207670_10000709	Ga0207670_100007099	217
104	3300026067	Ga0207678_10080190	Ga0207678_100801902	217
105	3300026067	Ga0207678_10422438	Ga0207678_104224382	217
106	3300042438	Ga0439459_0014893	Ga0439459_0014893_672_1343	217
107	3300046460	Ga0495638_0000234	Ga0495638_0000234_67726_68397	217
108	3300046460	Ga0495638_0001171	Ga0495638_0001171_4367_5038	217
109	3300046471	Ga0495650_0000337	Ga0495650_0000337_67303_67974	217
110	3300046507	Ga0495606_0000401	Ga0495606_0000401_43648_44319	217
111	3300046507	Ga0495606_0262276	Ga0495606_0262276_195_866	217
112	3300046524	Ga0495648_0000914	Ga0495648_0000914_27099_27770	217
113	3300046542	Ga0495597_0062199	Ga0495597_0062199_817_1488	217
114	3300046557	Ga0495622_0019037	Ga0495622_0019037_853_1524	217
115	3300046616	Ga0495668_0007971	Ga0495668_0007971_4027_4698	217
116	3300046660	Ga0495625_0015363	Ga0495625_0015363_3349_4020	217
117	3300046665	Ga0495661_0000199	Ga0495661_0000199_47525_48196	217
118	3300046694	Ga0495649_0000553	Ga0495649_0000553_24325_24996	217
119	3300046810	Ga0495660_0005305	Ga0495660_0005305_2971_3642	217
120	3300048907	Ga0496104_0158978	Ga0496104_0158978_488_1159	217
121	3300048915	Ga0496112_0163509	Ga0496112_0163509_224_895	217
122	3300048916	Ga0496113_0007592	Ga0496113_0007592_2848_3519	217
123	3300048917	Ga0496114_0555487	Ga0496114_0555487_69_740	217
124	3300048918	Ga0496115_0000503	Ga0496115_0000503_2489_3160	217
125	3300048918	Ga0496115_0002471	Ga0496115_0002471_7226_7897	217
126	3300048918	Ga0496115_0012375	Ga0496115_0012375_2956_3627	217
127	3300048924	Ga0496121_0045856	Ga0496121_0045856_1528_2199	217
128	3300048929	Ga0496126_0039582	Ga0496126_0039582_2662_3333	217
129	3300048929	Ga0496126_0040236	Ga0496126_0040236_2981_3652	217
130	3300048929	Ga0496126_0150674	Ga0496126_0150674_1215_1886	217
131	3300048929	Ga0496126_0166085	Ga0496126_0166085_644_1315	217
132	3300049460	Ga0495682_0012370	Ga0495682_0012370_504_1175	217
133	3300049460	Ga0495682_0017100	Ga0495682_0017100_947_1618	217
134	iso_pu_bacteria	2643221562	2643830287	217
135	3300002705	JGI25156J39149_1001926	JGI25156J39149_10019262	218
136	3300002705	JGI25156J39149_1004139	JGI25156J39149_10041392	218
137	3300002737	JGI25162J39368_1000895	JGI25162J39368_10008952	218
138	3300002738	JGI25154J39366_1002584	JGI25154J39366_10025841	218
139	3300002741	JGI25157J39369_1000229	JGI25157J39369_10002299	218
140	3300002741	JGI25157J39369_1001578	JGI25157J39369_10015788	218
141	3300002772	JGI25164J39214_1000045	JGI25164J39214_100004585	218
142	3300003214	JGI25165J46597_1000072	JGI25165J46597_100007285	218
143	3300003752	Ga0055539_1002669	Ga0055539_10026692	218
144	3300003752	Ga0055539_1011031	Ga0055539_10110312	218
145	3300003756	Ga0055533_1001642	Ga0055533_10016425	218
146	3300003759	Ga0055525_1000027	Ga0055525_1000027182	218
147	3300003760	Ga0055527_1000082	Ga0055527_100008271	218
148	3300003760	Ga0055527_1000209	Ga0055527_10002095	218
149	3300003760	Ga0055527_1001667	Ga0055527_10016675	218
150	3300003761	Ga0055535_1000143	Ga0055535_100014371	218
151	3300003761	Ga0055535_1000451	Ga0055535_10004515	218
152	3300003761	Ga0055535_1001467	Ga0055535_10014676	218
153	3300003761	Ga0055535_1001833	Ga0055535_10018337	218
154	3300003762	Ga0055542_1000190	Ga0055542_10001905	218
155	3300003762	Ga0055542_1000466	Ga0055542_10004665	218
156	3300003762	Ga0055542_1001440	Ga0055542_10014408	218
157	3300003762	Ga0055542_1001764	Ga0055542_10017645	218
158	3300003763	Ga0055529_1000204	Ga0055529_10002048	218
159	3300003763	Ga0055529_1000217	Ga0055529_10002175	218
160	3300003763	Ga0055529_1000671	Ga0055529_100067122	218
161	3300005563	Ga0068855_100031508	Ga0068855_1000315085	218
162	3300005578	Ga0068854_100001805	Ga0068854_1000018057	218
163	3300005614	Ga0068856_100008712	Ga0068856_1000087129	218
164	3300009093	Ga0105240_10032828	Ga0105240_100328284	218
165	3300025226	Ga0209674_100119	Ga0209674_10011999	218
166	3300025228	Ga0209672_100005	Ga0209672_100005684	218
167	3300025228	Ga0209672_100016	Ga0209672_100016331	218
168	3300025228	Ga0209672_100277	Ga0209672_10027740	218
169	3300025228	Ga0209672_100887	Ga0209672_10088714	218
170	3300025230	Ga0209563_100023	Ga0209563_100023343	218
171	3300025231	Ga0207427_100055	Ga0207427_100055126	218
172	3300025233	Ga0209437_100161	Ga0209437_100161103	218
173	3300025242	Ga0209258_100006	Ga0209258_100006684	218
174	3300025242	Ga0209258_100012	Ga0209258_100012472	218
175	3300025242	Ga0209258_100064	Ga0209258_100064212	218
176	3300025242	Ga0209258_100186	Ga0209258_10018641	218
177	3300025246	Ga0209646_1001157	Ga0209646_10011572	218
178	3300025250	Ga0209026_1000375	Ga0209026_100037528	218
179	3300025250	Ga0209026_1000541	Ga0209026_100054119	218
180	3300025253	Ga0209677_111543	Ga0209677_1115432	218
181	3300025254	Ga0209148_1000012	Ga0209148_1000012684	218
182	3300025254	Ga0209148_1000014	Ga0209148_1000014184	218
183	3300025254	Ga0209148_1000073	Ga0209148_1000073101	218
184	3300025254	Ga0209148_1000142	Ga0209148_100014275	218
185	3300025256	Ga0209759_1000103	Ga0209759_1000103104	218
186	3300025256	Ga0209759_1000792	Ga0209759_100079219	218
187	3300025261	Ga0209233_1000063	Ga0209233_1000063276	218
188	3300025272	Ga0209455_1000008	Ga0209455_1000008684	218
189	3300025272	Ga0209455_1000014	Ga0209455_100001472	218
190	3300025272	Ga0209455_1000177	Ga0209455_100017741	218
191	3300025272	Ga0209455_1002695	Ga0209455_10026956	218
192	3300025913	Ga0207695_10050523	Ga0207695_100505234	218
193	3300025949	Ga0207667_10000119	Ga0207667_100001195	218
194	3300025981	Ga0207640_10000797	Ga0207640_1000079714	218
195	3300026078	Ga0207702_10000937	Ga0207702_100009375	218
196	3300037418	Ga0395900_0000144	Ga0395900_0000144_25112_25786	218
197	3300037466	Ga0395898_0000049	Ga0395898_0000049_200881_201555	218
198	3300038443	Ga0395901_0077574	Ga0395901_0077574_84_758	218
199	3300038443	Ga0395901_0209993	Ga0395901_0209993_846_1520	218
200	3300044656	Ga0466969_0001731	Ga0466969_0001731_3256_3930	218
201	3300044656	Ga0466969_0006502	Ga0466969_0006502_2657_3331	218
202	3300044683	Ga0466965_0032619	Ga0466965_0032619_1763_2437	218
203	3300044684	Ga0466966_0009639	Ga0466966_0009639_3251_3925	218
204	3300044693	Ga0466961_0008586	Ga0466961_0008586_5235_5909	218
205	3300044693	Ga0466961_0009792	Ga0466961_0009792_5331_6005	218
206	3300044693	Ga0466961_0156412	Ga0466961_0156412_675_1349	218
207	3300044694	Ga0466963_0110486	Ga0466963_0110486_280_954	218
208	3300044719	Ga0466971_0003433	Ga0466971_0003433_2969_3643	218
209	3300044719	Ga0466971_0009181	Ga0466971_0009181_3132_3806	218
210	3300044765	Ga0466970_0014209	Ga0466970_0014209_3318_3992	218
211	3300044765	Ga0466970_0063659	Ga0466970_0063659_850_1524	218
212	3300044765	Ga0466970_0069613	Ga0466970_0069613_752_1426	218
213	3300044842	Ga0466957_0007781	Ga0466957_0007781_473_1147	218
214	3300044842	Ga0466957_0237061	Ga0466957_0237061_284_958	218
215	3300045049	Ga0466959_0000194	Ga0466959_0000194_14952_15626	218
216	3300045049	Ga0466959_0043088	Ga0466959_0043088_322_996	218
217	3300045049	Ga0466959_0088600	Ga0466959_0088600_609_1283	218
218	3300045836	Ga0466958_0125933	Ga0466958_0125933_855_1529	218
219	3300049586	Ga0501070_0050335	Ga0501070_0050335_1563_2237	218
220	3300049823	Ga0501044_0058971	Ga0501044_0058971_2006_2683	218
221	3300061719	Ga0466962_0019279	Ga0466962_0019279_2393_3067	218
222	3300061719	Ga0466962_0182492	Ga0466962_0182492_220_894	218
223	3300005335	Ga0070666_10000005	Ga0070666_10000005118	219
224	3300005337	Ga0070682_100011835	Ga0070682_1000118353	219
225	3300005339	Ga0070660_100015362	Ga0070660_1000153624	219
226	3300005344	Ga0070661_100019917	Ga0070661_1000199175	219
227	3300005366	Ga0070659_100045224	Ga0070659_1000452243	219
228	3300005457	Ga0070662_100193969	Ga0070662_1001939692	219
229	3300005458	Ga0070681_10033942	Ga0070681_100339424	219
230	3300005548	Ga0070665_100031284	Ga0070665_1000312844	219
231	3300005842	Ga0068858_100026962	Ga0068858_1000269625	219
232	3300005843	Ga0068860_100777556	Ga0068860_1007775562	219
233	3300009551	Ga0105238_10000924	Ga0105238_100009243	219
234	3300015685	Ga0183369_1007	Ga0183369_1007382	219
235	3300025903	Ga0207680_10000005	Ga0207680_10000005476	219
236	3300025909	Ga0207705_10002446	Ga0207705_100024465	219
237	3300025912	Ga0207707_10008818	Ga0207707_100088188	219
238	3300025919	Ga0207657_10028402	Ga0207657_100284024	219
239	3300025920	Ga0207649_10016581	Ga0207649_100165812	219
240	3300025924	Ga0207694_10001362	Ga0207694_100013629	219
241	3300025925	Ga0207650_10406289	Ga0207650_104062892	219
242	3300025932	Ga0207690_10002499	Ga0207690_100024995	219
243	3300025986	Ga0207658_10861819	Ga0207658_108618192	219
244	3300026035	Ga0207703_10029561	Ga0207703_100295613	219
245	3300028379	Ga0268266_10000004	Ga0268266_100000041057	219
246	3300028381	Ga0268264_10703055	Ga0268264_107030552	219
247	3300033180	Ga0307510_10006545	Ga0307510_100065456	219
248	3300033180	Ga0307510_10142629	Ga0307510_101426292	219
249	3300041452	Ga0451793_1722862	Ga0451793_1722862_384_1061	219
250	3300042438	Ga0439459_0021406	Ga0439459_0021406_53_730	219
251	3300046460	Ga0495638_0000038	Ga0495638_0000038_164212_164889	219
252	3300046471	Ga0495650_0001325	Ga0495650_0001325_14221_14898	219
253	3300046519	Ga0495632_0000004	Ga0495632_0000004_162045_162722	219
254	3300046660	Ga0495625_0051026	Ga0495625_0051026_1907_2584	219
255	3300049570	Ga0501033_0245882	Ga0501033_0245882_579_1259	219
256	3300049579	Ga0501043_0185975	Ga0501043_0185975_496_1173	219
257	3300049823	Ga0501044_0163622	Ga0501044_0163622_1418_2098	219
258	3300001989	JGI24739J22299_10006098	JGI24739J22299_100060983	220
259	3300001990	JGI24737J22298_10003212	JGI24737J22298_100032122	220
260	3300002737	JGI25162J39368_1001817	JGI25162J39368_10018174	220
261	3300002737	JGI25162J39368_1002271	JGI25162J39368_10022718	220
262	3300002741	JGI25157J39369_1000996	JGI25157J39369_10009962	220
263	3300002772	JGI25164J39214_1000895	JGI25164J39214_10008954	220
264	3300002772	JGI25164J39214_1001103	JGI25164J39214_10011038	220
265	3300003214	JGI25165J46597_1001691	JGI25165J46597_10016913	220
266	3300003215	JGI25153J46596_10055055	JGI25153J46596_100550552	220
267	3300003316	rootH1_10012190	rootH1_100121903	220
268	3300003316	rootH1_10058214	rootH1_100582143	220
269	3300003320	rootH2_10012587	rootH2_1001258719	220
270	3300003320	rootH2_10076181	rootH2_100761812	220
271	3300003320	rootH2_10107780	rootH2_101077802	220
272	3300003322	rootL2_10172163	rootL2_101721633	220
273	3300003578	Ga0006562J51391_1014503	Ga0006562J51391_10145031	220
274	3300003578	Ga0006562J51391_1014506	Ga0006562J51391_10145067	220
275	3300003578	Ga0006562J51391_1182275	Ga0006562J51391_11822754	220
276	3300003578	Ga0006562J51391_1182276	Ga0006562J51391_11822763	220
277	3300003762	Ga0055542_1010406	Ga0055542_10104062	220
278	3300005262	Ga0065165_1000587	Ga0065165_100058753	220
279	3300005262	Ga0065165_1003615	Ga0065165_100361510	220
280	3300005331	Ga0070670_100062735	Ga0070670_1000627353	220
281	3300005337	Ga0070682_100005295	Ga0070682_1000052955	220
282	3300005337	Ga0070682_100635572	Ga0070682_1006355721	220
283	3300005339	Ga0070660_100015081	Ga0070660_1000150814	220
284	3300005344	Ga0070661_100027284	Ga0070661_1000272844	220
285	3300005345	Ga0070692_10017423	Ga0070692_100174234	220
286	3300005366	Ga0070659_100008535	Ga0070659_1000085354	220
287	3300005366	Ga0070659_100250726	Ga0070659_1002507262	220
288	3300005366	Ga0070659_100486487	Ga0070659_1004864871	220
289	3300005434	Ga0070709_10408452	Ga0070709_104084522	220
290	3300005435	Ga0070714_100002041	Ga0070714_1000020418	220
291	3300005435	Ga0070714_100003673	Ga0070714_1000036736	220
292	3300005436	Ga0070713_100002146	Ga0070713_10000214611	220
293	3300005437	Ga0070710_10076724	Ga0070710_100767242	220
294	3300005444	Ga0070694_100074176	Ga0070694_1000741762	220
295	3300005444	Ga0070694_100428025	Ga0070694_1004280252	220
296	3300005455	Ga0070663_100024906	Ga0070663_1000249064	220
297	3300005457	Ga0070662_100097095	Ga0070662_1000970953	220
298	3300005458	Ga0070681_10313268	Ga0070681_103132682	220
299	3300005530	Ga0070679_100447160	Ga0070679_1004471602	220
300	3300005539	Ga0068853_100002365	Ga0068853_1000023659	220
301	3300005546	Ga0070696_100002542	Ga0070696_10000254212	220
302	3300005547	Ga0070693_100020439	Ga0070693_1000204393	220
303	3300005563	Ga0068855_100020454	Ga0068855_1000204545	220
304	3300005564	Ga0070664_100056433	Ga0070664_1000564332	220
305	3300005577	Ga0068857_100000591	Ga0068857_10000059118	220
306	3300005616	Ga0068852_100321382	Ga0068852_1003213822	220
307	3300005617	Ga0068859_100526224	Ga0068859_1005262242	220
308	3300005842	Ga0068858_100074036	Ga0068858_1000740364	220
309	3300006175	Ga0070712_100347410	Ga0070712_1003474102	220
310	3300006186	Ga0075369_10046397	Ga0075369_100463972	220
311	3300006931	Ga0097620_100526179	Ga0097620_1005261792	220
312	3300009093	Ga0105240_10017472	Ga0105240_100174726	220
313	3300009093	Ga0105240_10017515	Ga0105240_100175155	220
314	3300009093	Ga0105240_10025699	Ga0105240_100256995	220
315	3300009174	Ga0105241_10038015	Ga0105241_100380152	220
316	3300009174	Ga0105241_10527186	Ga0105241_105271862	220
317	3300009545	Ga0105237_10000064	Ga0105237_1000006440	220
318	3300009545	Ga0105237_10104031	Ga0105237_101040314	220
319	3300009551	Ga0105238_10012802	Ga0105238_1001280210	220
320	3300010375	Ga0105239_10000030	Ga0105239_10000030160	220
321	3300010375	Ga0105239_10010561	Ga0105239_1001056112	220
322	3300010375	Ga0105239_10181121	Ga0105239_101811213	220
323	3300012500	Ga0157314_1000130	Ga0157314_10001304	220
324	3300013100	Ga0157373_10037776	Ga0157373_100377763	220
325	3300013100	Ga0157373_10309838	Ga0157373_103098382	220
326	3300013100	Ga0157373_10342836	Ga0157373_103428362	220
327	3300013102	Ga0157371_10007084	Ga0157371_100070847	220
328	3300013104	Ga0157370_10000293	Ga0157370_1000029356	220
329	3300013104	Ga0157370_10001525	Ga0157370_100015254	220
330	3300013104	Ga0157370_10019471	Ga0157370_100194716	220
331	3300013104	Ga0157370_10044325	Ga0157370_100443254	220
332	3300013104	Ga0157370_10070652	Ga0157370_100706523	220
333	3300013104	Ga0157370_10075220	Ga0157370_100752204	220
334	3300013104	Ga0157370_10080786	Ga0157370_100807862	220
335	3300013105	Ga0157369_10000509	Ga0157369_1000050910	220
336	3300013306	Ga0163162_10048390	Ga0163162_100483905	220
337	3300013307	Ga0157372_10001376	Ga0157372_1000137621	220
338	3300013307	Ga0157372_10066605	Ga0157372_100666055	220
339	3300014497	Ga0182008_10002353	Ga0182008_1000235311	220
340	3300014497	Ga0182008_10004608	Ga0182008_100046082	220
341	3300014497	Ga0182008_10021939	Ga0182008_100219392	220
342	3300014497	Ga0182008_10068585	Ga0182008_100685853	220
343	3300014968	Ga0157379_10378592	Ga0157379_103785922	220
344	3300015261	Ga0182006_1000085	Ga0182006_100008564	220
345	3300015261	Ga0182006_1001993	Ga0182006_100199310	220
346	3300015261	Ga0182006_1009764	Ga0182006_10097645	220
347	3300015262	Ga0182007_10023128	Ga0182007_100231283	220
348	3300015262	Ga0182007_10025262	Ga0182007_100252622	220
349	3300015265	Ga0182005_1000028	Ga0182005_1000028149	220
350	3300015265	Ga0182005_1001312	Ga0182005_10013124	220
351	3300015265	Ga0182005_1040505	Ga0182005_10405052	220
352	3300017792	Ga0163161_10001533	Ga0163161_100015339	220
353	3300025226	Ga0209674_101621	Ga0209674_1016215	220
354	3300025226	Ga0209674_101928	Ga0209674_1019282	220
355	3300025231	Ga0207427_100244	Ga0207427_10024438	220
356	3300025231	Ga0207427_100248	Ga0207427_10024836	220
357	3300025233	Ga0209437_100020	Ga0209437_100020397	220
358	3300025233	Ga0209437_100079	Ga0209437_1000798	220
359	3300025233	Ga0209437_100476	Ga0209437_10047634	220
360	3300025250	Ga0209026_1000037	Ga0209026_1000037118	220
361	3300025254	Ga0209148_1004544	Ga0209148_10045443	220
362	3300025258	Ga0209129_1001735	Ga0209129_10017358	220
363	3300025258	Ga0209129_1005774	Ga0209129_10057742	220
364	3300025261	Ga0209233_1000020	Ga0209233_1000020229	220
365	3300025261	Ga0209233_1000147	Ga0209233_100014736	220
366	3300025297	Ga0209758_1003436	Ga0209758_10034368	220
367	3300025303	Ga0209051_1034134	Ga0209051_10341343	220
368	3300025898	Ga0207692_10052783	Ga0207692_100527832	220
369	3300025900	Ga0207710_10009627	Ga0207710_100096274	220
370	3300025904	Ga0207647_10000512	Ga0207647_1000051210	220
371	3300025904	Ga0207647_10001940	Ga0207647_1000194017	220
372	3300025904	Ga0207647_10014059	Ga0207647_100140592	220
373	3300025909	Ga0207705_10013387	Ga0207705_100133876	220
374	3300025912	Ga0207707_10720695	Ga0207707_107206952	220
375	3300025913	Ga0207695_10003105	Ga0207695_1000310513	220
376	3300025913	Ga0207695_10004047	Ga0207695_100040479	220
377	3300025913	Ga0207695_10004907	Ga0207695_100049075	220
378	3300025914	Ga0207671_10000061	Ga0207671_1000006196	220
379	3300025914	Ga0207671_10275600	Ga0207671_102756002	220
380	3300025916	Ga0207663_10311405	Ga0207663_103114052	220
381	3300025919	Ga0207657_10035345	Ga0207657_100353453	220
382	3300025920	Ga0207649_10011726	Ga0207649_100117265	220
383	3300025924	Ga0207694_10341797	Ga0207694_103417972	220
384	3300025925	Ga0207650_10034988	Ga0207650_100349883	220
385	3300025928	Ga0207700_10057819	Ga0207700_100578194	220
386	3300025929	Ga0207664_10000026	Ga0207664_100000268	220
387	3300025929	Ga0207664_10001714	Ga0207664_100017148	220
388	3300025929	Ga0207664_10203153	Ga0207664_102031532	220
389	3300025932	Ga0207690_10003314	Ga0207690_100033147	220
390	3300025932	Ga0207690_10003820	Ga0207690_100038204	220
391	3300025932	Ga0207690_10062025	Ga0207690_100620252	220
392	3300025932	Ga0207690_10200575	Ga0207690_102005752	220
393	3300025933	Ga0207706_10077962	Ga0207706_100779622	220
394	3300025945	Ga0207679_10284779	Ga0207679_102847792	220
395	3300025949	Ga0207667_10003156	Ga0207667_1000315619	220
396	3300025949	Ga0207667_10005743	Ga0207667_1000574310	220
397	3300025981	Ga0207640_10009780	Ga0207640_100097805	220
398	3300026035	Ga0207703_10058077	Ga0207703_100580772	220
399	3300026041	Ga0207639_10013353	Ga0207639_100133534	220
400	3300026067	Ga0207678_10016567	Ga0207678_100165677	220
401	3300026067	Ga0207678_10119809	Ga0207678_101198093	220
402	3300026067	Ga0207678_10362607	Ga0207678_103626072	220
403	3300026116	Ga0207674_10000226	Ga0207674_1000022651	220
404	3300026116	Ga0207674_10020397	Ga0207674_100203974	220
405	3300026142	Ga0207698_10421184	Ga0207698_104211842	220
406	3300031731	Ga0307405_10052926	Ga0307405_100529262	220
407	3300031911	Ga0307412_10002224	Ga0307412_100022248	220
408	3300037312	Ga0395899_0003966	Ga0395899_0003966_6766_7446	220
409	3300037312	Ga0395899_0025215	Ga0395899_0025215_2132_2812	220
410	3300037312	Ga0395899_0041216	Ga0395899_0041216_1250_1930	220
411	3300037312	Ga0395899_0151192	Ga0395899_0151192_657_1337	220
412	3300037418	Ga0395900_0002611	Ga0395900_0002611_9498_10178	220
413	3300037418	Ga0395900_0004074	Ga0395900_0004074_6892_7572	220
414	3300037418	Ga0395900_0094595	Ga0395900_0094595_869_1549	220
415	3300037418	Ga0395900_0311818	Ga0395900_0311818_803_1483	220
416	3300037466	Ga0395898_0010041	Ga0395898_0010041_1912_2592	220
417	3300037466	Ga0395898_0010070	Ga0395898_0010070_2463_3143	220
418	3300037466	Ga0395898_0095680	Ga0395898_0095680_67_747	220
419	3300037471	Ga0395905_0147239	Ga0395905_0147239_1466_2146	220
420	3300038443	Ga0395901_0007439	Ga0395901_0007439_639_1319	220
421	3300038443	Ga0395901_0007941	Ga0395901_0007941_2561_3241	220
422	3300038443	Ga0395901_0026088	Ga0395901_0026088_3078_3758	220
423	3300038443	Ga0395901_0046899	Ga0395901_0046899_300_980	220
424	3300038443	Ga0395901_0068848	Ga0395901_0068848_883_1563	220
425	3300038443	Ga0395901_0161973	Ga0395901_0161973_420_1100	220
426	3300041404	Ga0439436_0000030	Ga0439436_0000030_39407_40087	220
427	3300041413	Ga0439465_0005693	Ga0439465_0005693_2161_2841	220
428	3300042000	Ga0439437_004686	Ga0439437_004686_452_1132	220
429	3300042006	Ga0439432_034934	Ga0439432_034934_806_1486	220
430	3300042184	Ga0450908_000350	Ga0450908_000350_6175_6855	220
431	3300044672	Ga0466982_0000612	Ga0466982_0000612_6310_6990	220
432	3300044735	Ga0466968_0002071	Ga0466968_0002071_6351_7031	220
433	3300045976	Ga0466967_0454074	Ga0466967_0454074_170_850	220
434	3300045976	Ga0466967_0598586	Ga0466967_0598586_61_741	220
435	3300045976	Ga0466967_0868115	Ga0466967_0868115_57_737	220
436	3300046452	Ga0495617_002295	Ga0495617_002295_4375_5055	220
437	3300046491	Ga0495584_0122061	Ga0495584_0122061_543_1223	220
438	3300046492	Ga0495585_0000104	Ga0495585_0000104_52147_52827	220
439	3300046492	Ga0495585_0024980	Ga0495585_0024980_2704_3384	220
440	3300046501	Ga0495607_0120125	Ga0495607_0120125_121_801	220
441	3300046507	Ga0495606_0000338	Ga0495606_0000338_7393_8073	220
442	3300046507	Ga0495606_0012374	Ga0495606_0012374_2899_3579	220
443	3300046512	Ga0495610_0000482	Ga0495610_0000482_32190_32870	220
444	3300046513	Ga0495616_0000086	Ga0495616_0000086_20392_21072	220
445	3300046515	Ga0495620_0001045	Ga0495620_0001045_8794_9474	220
446	3300046518	Ga0495631_0000974	Ga0495631_0000974_10318_10998	220
447	3300046519	Ga0495632_0014432	Ga0495632_0014432_1219_1899	220
448	3300046660	Ga0495625_0013223	Ga0495625_0013223_3398_4078	220
449	3300046691	Ga0495670_0003561	Ga0495670_0003561_6367_7047	220
450	3300046691	Ga0495670_0010407	Ga0495670_0010407_3694_4374	220
451	3300047323	Ga0495683_0001981	Ga0495683_0001981_4781_5461	220
452	3300047469	Ga0495673_0000004	Ga0495673_0000004_105627_106307	220
453	3300047469	Ga0495673_0192013	Ga0495673_0192013_75_755	220
454	3300047472	Ga0495686_0000017	Ga0495686_0000017_189869_190549	220
455	3300047472	Ga0495686_0001206	Ga0495686_0001206_7528_8208	220
456	3300047472	Ga0495686_0018752	Ga0495686_0018752_2884_3564	220
457	3300047472	Ga0495686_0047312	Ga0495686_0047312_1558_2238	220
458	3300048903	Ga0496100_0001852	Ga0496100_0001852_9797_10477	220
459	3300048903	Ga0496100_0069201	Ga0496100_0069201_1155_1835	220
460	3300048903	Ga0496100_0187343	Ga0496100_0187343_791_1471	220
461	3300048904	Ga0496101_0000776	Ga0496101_0000776_9947_10627	220
462	3300048904	Ga0496101_0147317	Ga0496101_0147317_686_1366	220
463	3300048908	Ga0496105_0008971	Ga0496105_0008971_6513_7193	220
464	3300048910	Ga0496107_0015203	Ga0496107_0015203_4391_5071	220
465	3300048918	Ga0496115_0076332	Ga0496115_0076332_1614_2294	220
466	3300048919	Ga0496116_0170615	Ga0496116_0170615_285_965	220
467	3300048920	Ga0496117_0002308	Ga0496117_0002308_15759_16439	220
468	3300048920	Ga0496117_0022702	Ga0496117_0022702_178_858	220
469	3300048920	Ga0496117_0096322	Ga0496117_0096322_741_1421	220
470	3300048921	Ga0496118_0001694	Ga0496118_0001694_9563_10243	220
471	3300048921	Ga0496118_0005974	Ga0496118_0005974_4525_5205	220
472	3300048921	Ga0496118_0018381	Ga0496118_0018381_1263_1943	220
473	3300048921	Ga0496118_0018478	Ga0496118_0018478_4346_5026	220
474	3300048921	Ga0496118_0075542	Ga0496118_0075542_1683_2363	220
475	3300048921	Ga0496118_0079530	Ga0496118_0079530_730_1410	220
476	3300048922	Ga0496119_0000430	Ga0496119_0000430_50701_51381	220
477	3300048922	Ga0496119_0008458	Ga0496119_0008458_3389_4069	220
478	3300048922	Ga0496119_0031460	Ga0496119_0031460_2251_2931	220
479	3300048923	Ga0496120_0001482	Ga0496120_0001482_5791_6471	220
480	3300048923	Ga0496120_0002085	Ga0496120_0002085_8832_9512	220
481	3300048924	Ga0496121_0000743	Ga0496121_0000743_13340_14020	220
482	3300048924	Ga0496121_0000878	Ga0496121_0000878_10440_11120	220
483	3300048924	Ga0496121_0013621	Ga0496121_0013621_4035_4715	220
484	3300048924	Ga0496121_0015809	Ga0496121_0015809_5087_5767	220
485	3300048924	Ga0496121_0034829	Ga0496121_0034829_135_815	220
486	3300048924	Ga0496121_0111283	Ga0496121_0111283_732_1412	220
487	3300048925	Ga0496122_0021496	Ga0496122_0021496_3872_4552	220
488	3300048925	Ga0496122_0025814	Ga0496122_0025814_2703_3383	220
489	3300048925	Ga0496122_0120671	Ga0496122_0120671_415_1095	220
490	3300048926	Ga0496123_0044054	Ga0496123_0044054_1192_1872	220
491	3300048926	Ga0496123_0053361	Ga0496123_0053361_1744_2424	220
492	3300048926	Ga0496123_0126132	Ga0496123_0126132_276_956	220
493	3300048927	Ga0496124_0007573	Ga0496124_0007573_2229_2909	220
494	3300048928	Ga0496125_0000330	Ga0496125_0000330_68063_68743	220
495	3300048929	Ga0496126_0003181	Ga0496126_0003181_13947_14627	220
496	3300048929	Ga0496126_0013428	Ga0496126_0013428_2804_3484	220
497	3300048929	Ga0496126_0258780	Ga0496126_0258780_312_992	220
498	3300049568	Ga0501031_0177696	Ga0501031_0177696_122_802	220
499	3300049568	Ga0501031_0220780	Ga0501031_0220780_84_764	220
500	3300049569	Ga0501032_0016603	Ga0501032_0016603_2682_3362	220
501	3300049569	Ga0501032_0063787	Ga0501032_0063787_1671_2351	220
502	3300049570	Ga0501033_0010485	Ga0501033_0010485_25_705	220
503	3300049571	Ga0501034_0004365	Ga0501034_0004365_9377_10060	220
504	3300049571	Ga0501034_0171258	Ga0501034_0171258_1291_1971	220
505	3300049571	Ga0501034_0271332	Ga0501034_0271332_490_1170	220
506	3300049572	Ga0501036_0033958	Ga0501036_0033958_3395_4075	220
507	3300049572	Ga0501036_0166283	Ga0501036_0166283_36_719	220
508	3300049573	Ga0501037_0005496	Ga0501037_0005496_1117_1800	220
509	3300049573	Ga0501037_0081979	Ga0501037_0081979_700_1380	220
510	3300049573	Ga0501037_0177519	Ga0501037_0177519_344_1024	220
511	3300049574	Ga0501038_0044973	Ga0501038_0044973_709_1389	220
512	3300049579	Ga0501043_0019217	Ga0501043_0019217_2140_2820	220
513	3300049579	Ga0501043_0058545	Ga0501043_0058545_217_900	220
514	3300049579	Ga0501043_0059933	Ga0501043_0059933_1994_2674	220
515	3300049580	Ga0501046_0050304	Ga0501046_0050304_1971_2651	220
516	3300049580	Ga0501046_0341911	Ga0501046_0341911_159_839	220
517	3300049581	Ga0501047_0006844	Ga0501047_0006844_7647_8327	220
518	3300049581	Ga0501047_0014768	Ga0501047_0014768_55_735	220
519	3300049581	Ga0501047_0205077	Ga0501047_0205077_505_1185	220
520	3300049593	Ga0501077_0145042	Ga0501077_0145042_417_1100	220
521	3300049822	Ga0501035_0001816	Ga0501035_0001816_2238_2918	220
522	3300049822	Ga0501035_0005013	Ga0501035_0005013_4621_5304	220
523	3300049823	Ga0501044_0045810	Ga0501044_0045810_3136_3819	220
524	3300049823	Ga0501044_0054482	Ga0501044_0054482_1337_2017	220
525	iso_pu_bacteria	2537561836	2538832277	220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

17

196

0.97 PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

14

190

0.89 PF13242

Hydrolase_like

HAD-hyrolase-like

150

220

0.87 PF12710

HAD

haloacid dehalogenase-like hydrolase

17

186

0.72 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2mu1-assembly1.cif.gz_A	nmr structure of the core domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4	0.834	87	214
3l8f-assembly1.cif.gz_A	crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate	0.8155	81	215
2fi1-assembly1.cif.gz_A	the crystal structure of a hydrolase from streptococcus pneumoniae tigr4	0.8102	7	181
2oda-assembly1.cif.gz_A	crystal structure of pspto_2114	0.8081	85	218
1u7p-assembly4.cif.gz_D	x-ray crystal structure of the hypothetical phosphotyrosine phosphatase mdp-1 of the haloacid dehalogenase superfamily	0.8017	84	217

ID	Description	Score	Start	End	Superfamily
af_P32662_111_227_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.95	85	200	3.40.50.1000
af_P32662_111_227_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9345	85	200	3.40.50.1000
2hdoA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9081	85	212	3.40.50.1000
2yy6B01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9057	80	212	3.40.50.1000
2fi1A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.901	87	181	3.40.50.1000

ID	Description	Score	Start	End	GO Terms
AF-A0A4P7CU27-F1-model_v4	phosphoglycolate phosphatase (EC 3.1.3.18)	0.8543	1	213	GO:0005829 GO:0006281 GO:0008967
AF-A0A2E7RP04-F1-model_v4	Phosphoglycolate phosphatase	0.8517	7	213	GO:0005829 GO:0006281 GO:0008967
AF-A0A7V1FTE6-F1-model_v4	HAD family hydrolase	0.8282	8	215	GO:0005829 GO:0006281 GO:0008967
AF-A0A1V5G053-F1-model_v4	Phosphoglycolate phosphatase (EC 3.1.3.18)	0.8279	54	210	GO:0005829 GO:0006281 GO:0008967
AF-A0A099PAU7-F1-model_v4	Phosphoglycolate phosphatase	0.824	3	215	GO:0005829 GO:0006281 GO:0008967

Feature Viewer

pLDDT	pTM	Quality
91.37	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459270

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

17

196

0.97

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

14

190

0.89

PF13242

Hydrolase_like

HAD-hyrolase-like

150

220

0.87

PF12710

HAD

haloacid dehalogenase-like hydrolase

17

186

0.72

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map