F459262

General Info

Members Datasets Scaffolds Average Seq Length
525 266 516 416

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10124436|Ga0105242_101244362
Length 453
Sequence VQVLNFALALAKSSCCFVFKIDLFNPGHKNNMKASTRGRVKIKRFFSILGPGLVTGASDDDPSGIATYSQAGAQFGIATLWTALITFPLMAAVQEMCARIGIVTSQGLTSTIRNNYPRPVLYIIIALTFPAVILNIGADIAGMGAVANLIFPAVHPIFFTVAFTFILMVLIIYLPYQKIAAILKYLCIFLLLYLVVPFLSKQDWLDILKHTFVPTVHLNKAFIGILVAILGTTISPYLFFWQATMEAEDQQHKKRKLVVNKRIIHKMDLDVDFGMLFSNIVMFFIILTAGTVLHNSGIRQIDTVEQAAKALEPVAGKLAYQLFAIGVLGTGLLAIPVLSGSLSYMLSDTFGWGGNLDKKYYEAKPFYWVIIISLIIGLGINYLGISPIQALIYTSILYGITSPVLIAVILHVSNNKKIMGGFTNGKWSNILGCITLVLMTAAACTLLYFQFKG

Samples

Sample ID Description Type Environment
1 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
5 2914759650 Rhizosphaericola mali Isolate Rhizosphere
6 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
102 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 0.57
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005045 3300001979 Bacteria 5607
2 JGI25162J39368_1000046 3300002737 Bacteria 169695
3 JGI25154J39366_1000016 3300002738 Bacteria 255057
4 rootH1_10036836 3300003316 Unclassified 2998
5 rootH1_10052212 3300003316 Bacteria 9725
6 rootH1_10160141 3300003316 Bacteria 2246
7 rootH2_10005192 3300003320 Bacteria 30420
8 rootH2_10133397 3300003320 Unclassified 2993
9 rootL2_10024198 3300003322 Bacteria 3542
10 rootL2_10124837 3300003322 Bacteria 2638
11 rootH1_10011789 3300003323 Bacteria 124621
12 rootH1_10025617 3300003323 Bacteria 4977
13 rootH1_10071014 3300003323 Bacteria 6457
14 rootH1_10122889 3300003323 Bacteria 6771
15 rootH1_10289623 3300003323 Bacteria 2353
16 JGI25160J50197_1004864 3300003354 Bacteria 5720
17 Ga0055535_1002736 3300003761 Bacteria 5679
18 Ga0065712_10000853 3300005290 Bacteria 8590
19 Ga0070658_10012491 3300005327 Bacteria 6814
20 Ga0070658_10124481 3300005327 Bacteria 2145
21 Ga0070683_100085077 3300005329 Bacteria 2964
22 Ga0070690_100017902 3300005330 Bacteria 4271
23 Ga0070670_100081108 3300005331 Unclassified 2788
24 Ga0070670_100203315 3300005331 Bacteria 1721
25 Ga0070670_100230979 3300005331 Bacteria 1610
26 Ga0068869_100004103 3300005334 Bacteria 9024
27 Ga0068869_100040291 3300005334 Bacteria 3340
28 Ga0070666_10006658 3300005335 Bacteria 7104
29 Ga0070666_10016644 3300005335 Unclassified 4705
30 Ga0070666_10147434 3300005335 Bacteria 1641
31 Ga0070680_100005777 3300005336 Bacteria 9391
32 Ga0070680_100188428 3300005336 Bacteria 1738
33 Ga0070682_100000044 3300005337 Bacteria 133653
34 Ga0070682_100055890 3300005337 Bacteria 2481
35 Ga0068868_100004562 3300005338 Bacteria 9723
36 Ga0068868_100037277 3300005338 Bacteria 3768
37 Ga0068868_100065260 3300005338 Bacteria 2892
38 Ga0068868_100193686 3300005338 Bacteria 1691
39 Ga0070689_100024974 3300005340 Bacteria 4485
40 Ga0070661_100069081 3300005344 Bacteria 2597
41 Ga0070668_100018484 3300005347 Bacteria 5233
42 Ga0070669_100234259 3300005353 Bacteria 1456
43 Ga0070671_100013350 3300005355 Bacteria 6621
44 Ga0070671_100067357 3300005355 Bacteria 2985
45 Ga0070671_100137679 3300005355 Bacteria 2059
46 Ga0070659_100023554 3300005366 Unclassified 4713
47 Ga0070659_100030049 3300005366 Bacteria 4203
48 Ga0070659_100138129 3300005366 Bacteria 1983
49 Ga0070667_100006235 3300005367 Bacteria 9921
50 Ga0070667_100016560 3300005367 Bacteria 6101
51 Ga0070667_100075515 3300005367 Unclassified 2877
52 Ga0070701_10060408 3300005438 Bacteria 1996
53 Ga0070700_100095390 3300005441 Unclassified 1950
54 Ga0070663_100004297 3300005455 Bacteria 8343
55 Ga0070662_100006091 3300005457 Bacteria 7748
56 Ga0070681_10127478 3300005458 Bacteria 2478
57 Ga0068867_100006003 3300005459 Bacteria 8611
58 Ga0070685_10036922 3300005466 Bacteria 2764
59 Ga0070706_100291078 3300005467 Bacteria 1524
60 Ga0070698_100000965 3300005471 Bacteria 31529
61 Ga0070698_100010578 3300005471 Bacteria 9833
62 Ga0070698_100018700 3300005471 Bacteria 7294
63 Ga0070679_100113333 3300005530 Bacteria 2697
64 Ga0070684_100007071 3300005535 Bacteria 8726
65 Ga0070684_100107562 3300005535 Bacteria 2498
66 Ga0068853_100027829 3300005539 Bacteria 4753
67 Ga0068853_100089691 3300005539 Bacteria 2701
68 Ga0068853_100108201 3300005539 Bacteria 2466
69 Ga0068853_100140806 3300005539 Bacteria 2165
70 Ga0068853_100145150 3300005539 Bacteria 2132
71 Ga0070672_100050413 3300005543 Bacteria 3241
72 Ga0070672_100246699 3300005543 Bacteria 1503
73 Ga0070686_100041578 3300005544 Bacteria 2874
74 Ga0070665_100000031 3300005548 Bacteria 333365
75 Ga0070665_100001604 3300005548 Bacteria 26025
76 Ga0070665_100009726 3300005548 Bacteria 9721
77 Ga0068855_100006093 3300005563 Bacteria 14708
78 Ga0068855_100012369 3300005563 Bacteria 10309
79 Ga0068855_100034944 3300005563 Bacteria 5990
80 Ga0068855_100040421 3300005563 Bacteria 5535
81 Ga0068855_100049935 3300005563 Bacteria 4932
82 Ga0068855_100142712 3300005563 Unclassified 2728
83 Ga0070664_100039923 3300005564 Unclassified 3957
84 Ga0070664_100077781 3300005564 Bacteria 2853
85 Ga0068857_100000697 3300005577 Bacteria 24969
86 Ga0068857_100013784 3300005577 Bacteria 7042
87 Ga0068854_100014269 3300005578 Bacteria 5234
88 Ga0068854_100029837 3300005578 Bacteria 3779
89 Ga0068856_100007044 3300005614 Bacteria 10983
90 Ga0068856_100044869 3300005614 Bacteria 4351
91 Ga0068856_100113296 3300005614 Bacteria 2710
92 Ga0068856_100276727 3300005614 Bacteria 1695
93 Ga0068852_100002245 3300005616 Bacteria 13263
94 Ga0068852_100004323 3300005616 Bacteria 10030
95 Ga0068852_100082712 3300005616 Bacteria 2853
96 Ga0068852_100154023 3300005616 Bacteria 2140
97 Ga0068859_100000012 3300005617 Bacteria 300376
98 Ga0068859_100015275 3300005617 Bacteria 7711
99 Ga0068859_100055472 3300005617 Bacteria 3987
100 Ga0068859_100256245 3300005617 Bacteria 1840
101 Ga0068864_100002123 3300005618 Bacteria 16390
102 Ga0068864_100254504 3300005618 Unclassified 1631
103 Ga0068864_100290137 3300005618 Bacteria 1529
104 Ga0068851_10001521 3300005834 Bacteria 10173
105 Ga0068870_10095406 3300005840 Unclassified 1671
106 Ga0068863_100004636 3300005841 Bacteria 13548
107 Ga0068863_100074144 3300005841 Bacteria 3219
108 Ga0068858_100003981 3300005842 Bacteria 14582
109 Ga0068858_100012915 3300005842 Bacteria 7875
110 Ga0068858_100145367 3300005842 Bacteria 2227
111 Ga0068860_100000072 3300005843 Bacteria 174997
112 Ga0068860_100002371 3300005843 Bacteria 19784
113 Ga0068860_100006064 3300005843 Bacteria 12167
114 Ga0068860_100038917 3300005843 Bacteria 4549
115 Ga0068862_100006143 3300005844 Bacteria 9996
116 Ga0068862_100179091 3300005844 Unclassified 1901
117 Ga0081540_1003369 3300005983 Bacteria 12666
118 Ga0070717_10157567 3300006028 Bacteria 1968
119 Ga0075366_10010456 3300006195 Bacteria 5211
120 Ga0097621_100006903 3300006237 Bacteria 8079
121 Ga0097621_100041401 3300006237 Bacteria 3708
122 Ga0097621_100058223 3300006237 Unclassified 3161
123 Ga0097621_100070399 3300006237 Bacteria 2888
124 Ga0068871_100000737 3300006358 Bacteria 22233
125 Ga0068871_100013343 3300006358 Bacteria 6098
126 Ga0068871_100032988 3300006358 Bacteria 4095
127 Ga0068871_100060893 3300006358 Unclassified 3080
128 Ga0068871_100086313 3300006358 Bacteria 2607
129 Ga0068871_100269906 3300006358 Bacteria 1486
130 Ga0075428_100007967 3300006844 Bacteria 11752
131 Ga0075428_100129367 3300006844 Bacteria 2747
132 Ga0075430_100155797 3300006846 Bacteria 1902
133 Ga0075431_100269718 3300006847 Bacteria 1725
134 Ga0075429_100006484 3300006880 Bacteria 10137
135 Ga0068865_100085899 3300006881 Unclassified 2270
136 Ga0068865_100177730 3300006881 Bacteria 1637
137 Ga0097620_100000012 3300006931 Bacteria 300376
138 Ga0097620_100015275 3300006931 Bacteria 7711
139 Ga0097620_100055467 3300006931 Bacteria 3987
140 Ga0097620_100256234 3300006931 Bacteria 1840
141 Ga0105240_10000011 3300009093 Bacteria 523646
142 Ga0105240_10000100 3300009093 Bacteria 176640
143 Ga0105240_10000319 3300009093 Bacteria 91429
144 Ga0105240_10007530 3300009093 Bacteria 15793
145 Ga0105240_10009710 3300009093 Bacteria 13586
146 Ga0105240_10015435 3300009093 Bacteria 10386
147 Ga0105240_10041200 3300009093 Bacteria 5897
148 Ga0105240_10315718 3300009093 Unclassified 1783
149 Ga0111539_10065798 3300009094 Bacteria 4282
150 Ga0111539_10120492 3300009094 Bacteria 3074
151 Ga0111539_10172101 3300009094 Unclassified 2530
152 Ga0111539_10574902 3300009094 Bacteria 1312
153 Ga0105245_10096582 3300009098 Unclassified 2727
154 Ga0105247_10035764 3300009101 Bacteria 3029
155 Ga0114129_10110056 3300009147 Bacteria 3802
156 Ga0105241_10002514 3300009174 Bacteria 13768
157 Ga0105241_10004826 3300009174 Bacteria 9936
158 Ga0105241_10009603 3300009174 Bacteria 7112
159 Ga0105241_10012031 3300009174 Bacteria 6356
160 Ga0105241_10121574 3300009174 Bacteria 2103
161 Ga0105242_10044006 3300009176 Bacteria 3613
162 Ga0105242_10058834 3300009176 Bacteria 3152
163 Ga0105242_10079329 3300009176 Bacteria 2742
164 Ga0105242_10124436 3300009176 Bacteria 2218
165 Ga0105242_10165000 3300009176 Bacteria 1942
166 Ga0105248_10306905 3300009177 Bacteria 1787
167 Ga0105248_10308066 3300009177 Bacteria 1783
168 Ga0105237_10000256 3300009545 Bacteria 75634
169 Ga0105237_10001107 3300009545 Bacteria 36103
170 Ga0105237_10001705 3300009545 Bacteria 28418
171 Ga0105237_10003457 3300009545 Bacteria 18748
172 Ga0105237_10006687 3300009545 Bacteria 12743
173 Ga0105237_10046780 3300009545 Bacteria 4351
174 Ga0105237_10146708 3300009545 Bacteria 2354
175 Ga0105237_10206312 3300009545 Bacteria 1965
176 Ga0105237_10206410 3300009545 Bacteria 1965
177 Ga0105238_10084732 3300009551 Bacteria 3159
178 Ga0105238_10134033 3300009551 Unclassified 2455
179 Ga0105249_10003245 3300009553 Bacteria 14094
180 Ga0105249_10006757 3300009553 Bacteria 9995
181 Ga0105249_10047239 3300009553 Bacteria 3922
182 Ga0105249_10100591 3300009553 Bacteria 2718
183 Ga0105249_10139141 3300009553 Bacteria 2326
184 Ga0105239_10000176 3300010375 Bacteria 92577
185 Ga0105239_10001802 3300010375 Bacteria 28139
186 Ga0105239_10023740 3300010375 Bacteria 6752
187 Ga0105239_10024961 3300010375 Bacteria 6584
188 Ga0105239_10038296 3300010375 Bacteria 5254
189 Ga0105239_10071322 3300010375 Bacteria 3817
190 Ga0105239_10101177 3300010375 Bacteria 3188
191 Ga0105239_10114888 3300010375 Bacteria 2986
192 Ga0105239_10124651 3300010375 Bacteria 2862
193 Ga0105239_10147418 3300010375 Bacteria 2626
194 Ga0105239_10383440 3300010375 Bacteria 1589
195 Ga0105246_10069887 3300011119 Bacteria 2468
196 Ga0105246_10073579 3300011119 Unclassified 2413
197 Ga0157373_10004048 3300013100 Bacteria 11044
198 Ga0157373_10007633 3300013100 Bacteria 8033
199 Ga0157373_10028684 3300013100 Unclassified 4014
200 Ga0157373_10130317 3300013100 Unclassified 1769
201 Ga0157371_10003427 3300013102 Bacteria 14396
202 Ga0157371_10106257 3300013102 Bacteria 1992
203 Ga0157371_10110133 3300013102 Bacteria 1955
204 Ga0157370_10012521 3300013104 Bacteria 8793
205 Ga0157369_10000742 3300013105 Bacteria 42082
206 Ga0157369_10015108 3300013105 Bacteria 8713
207 Ga0157369_10027556 3300013105 Bacteria 6296
208 Ga0157369_10107283 3300013105 Bacteria 2971
209 Ga0157374_10005877 3300013296 Bacteria 10366
210 Ga0157374_10048822 3300013296 Bacteria 3928
211 Ga0157374_10060745 3300013296 Bacteria 3538
212 Ga0157374_10105853 3300013296 Bacteria 2702
213 Ga0157378_10003535 3300013297 Bacteria 13847
214 Ga0157378_10004919 3300013297 Bacteria 11710
215 Ga0157378_10061863 3300013297 Bacteria 3343
216 Ga0157378_10102262 3300013297 Bacteria 2617
217 Ga0157378_10136684 3300013297 Bacteria 2273
218 Ga0157378_10205006 3300013297 Unclassified 1867
219 Ga0157378_10267236 3300013297 Bacteria 1643
220 Ga0163162_10000140 3300013306 Bacteria 65811
221 Ga0163162_10001646 3300013306 Bacteria 20940
222 Ga0163162_10004336 3300013306 Bacteria 13656
223 Ga0163162_10009385 3300013306 Bacteria 9517
224 Ga0163162_10014680 3300013306 Bacteria 7655
225 Ga0163162_10074681 3300013306 Unclassified 3449
226 Ga0163162_10102461 3300013306 Bacteria 2956
227 Ga0163162_10112283 3300013306 Unclassified 2824
228 Ga0163162_10117717 3300013306 Bacteria 2758
229 Ga0163162_10134747 3300013306 Bacteria 2580
230 Ga0157372_10000048 3300013307 Bacteria 142757
231 Ga0157372_10001517 3300013307 Bacteria 25239
232 Ga0157372_10003940 3300013307 Bacteria 15946
233 Ga0157372_10008533 3300013307 Bacteria 10879
234 Ga0157372_10018325 3300013307 Bacteria 7525
235 Ga0157372_10107012 3300013307 Bacteria 3199
236 Ga0157372_10116201 3300013307 Bacteria 3068
237 Ga0157375_10006874 3300013308 Bacteria 9923
238 Ga0157375_10029284 3300013308 Bacteria 5176
239 Ga0157375_10099478 3300013308 Unclassified 2987
240 Ga0157375_10154262 3300013308 Bacteria 2434
241 Ga0157375_10161077 3300013308 Bacteria 2385
242 Ga0163163_10000407 3300014325 Bacteria 40536
243 Ga0163163_10002931 3300014325 Bacteria 14436
244 Ga0163163_10224338 3300014325 Bacteria 1928
245 Ga0157380_10000068 3300014326 Bacteria 58289
246 Ga0157380_10013195 3300014326 Bacteria 6016
247 Ga0157380_10081207 3300014326 Bacteria 2651
248 Ga0157379_10121216 3300014968 Bacteria 2352
249 Ga0157379_10162617 3300014968 Unclassified 2015
250 Ga0157376_10012138 3300014969 Bacteria 6382
251 Ga0157376_10025569 3300014969 Bacteria 4652
252 Ga0157376_10038993 3300014969 Bacteria 3870
253 Ga0157376_10060121 3300014969 Bacteria 3189
254 Ga0183373_1003 3300015682 Bacteria 558813
255 Ga0183365_10004 3300015684 Bacteria 333304
256 Ga0163161_10000823 3300017792 Bacteria 24283
257 Ga0163161_10033293 3300017792 Bacteria 3683
258 Ga0209437_100070 3300025233 Bacteria 306718
259 Ga0209258_100159 3300025242 Bacteria 155141
260 Ga0207425_1017189 3300025245 Bacteria 1594
261 Ga0209646_1000003 3300025246 Bacteria 1160860
262 Ga0209646_1000746 3300025246 Bacteria 11373
263 Ga0209026_1000202 3300025250 Bacteria 82517
264 Ga0209026_1003860 3300025250 Bacteria 4726
265 Ga0209148_1000156 3300025254 Bacteria 142889
266 Ga0209758_1013892 3300025297 Unclassified 4340
267 Ga0207426_1001047 3300025302 Bacteria 26255
268 Ga0207656_10000641 3300025321 Bacteria 11433
269 Ga0207656_10003051 3300025321 Bacteria 5722
270 Ga0207656_10051422 3300025321 Unclassified 1782
271 Ga0207682_10019689 3300025893 Bacteria 2644
272 Ga0207680_10000031 3300025903 Bacteria 77871
273 Ga0207680_10025221 3300025903 Unclassified 3277
274 Ga0207647_10000347 3300025904 Bacteria 37523
275 Ga0207647_10001274 3300025904 Bacteria 19392
276 Ga0207645_10000542 3300025907 Bacteria 31431
277 Ga0207645_10008116 3300025907 Bacteria 7358
278 Ga0207643_10011962 3300025908 Unclassified 4686
279 Ga0207705_10255641 3300025909 Bacteria 1337
280 Ga0207654_10002706 3300025911 Bacteria 8996
281 Ga0207654_10007850 3300025911 Bacteria 5380
282 Ga0207654_10015076 3300025911 Bacteria 4003
283 Ga0207654_10023653 3300025911 Bacteria 3294
284 Ga0207654_10123716 3300025911 Bacteria 1628
285 Ga0207707_10002565 3300025912 Bacteria 16286
286 Ga0207695_10000010 3300025913 Bacteria 981919
287 Ga0207695_10000027 3300025913 Bacteria 612456
288 Ga0207695_10011387 3300025913 Bacteria 10781
289 Ga0207695_10024762 3300025913 Bacteria 6740
290 Ga0207695_10076180 3300025913 Bacteria 3411
291 Ga0207695_10090010 3300025913 Bacteria 3085
292 Ga0207695_10113424 3300025913 Unclassified 2687
293 Ga0207695_10115455 3300025913 Bacteria 2659
294 Ga0207671_10000067 3300025914 Bacteria 162184
295 Ga0207671_10000730 3300025914 Bacteria 41672
296 Ga0207671_10001908 3300025914 Bacteria 23135
297 Ga0207671_10002014 3300025914 Bacteria 22347
298 Ga0207671_10007673 3300025914 Bacteria 9317
299 Ga0207671_10015552 3300025914 Bacteria 5952
300 Ga0207671_10150228 3300025914 Bacteria 1799
301 Ga0207671_10162927 3300025914 Bacteria 1728
302 Ga0207660_10008582 3300025917 Bacteria 6611
303 Ga0207662_10043611 3300025918 Bacteria 2646
304 Ga0207649_10001036 3300025920 Bacteria 17088
305 Ga0207652_10014719 3300025921 Bacteria 6339
306 Ga0207681_10024417 3300025923 Unclassified 3880
307 Ga0207694_10031636 3300025924 Bacteria 4044
308 Ga0207694_10112734 3300025924 Unclassified 2164
309 Ga0207650_10111263 3300025925 Unclassified 2120
310 Ga0207659_10016338 3300025926 Bacteria 4828
311 Ga0207659_10109060 3300025926 Bacteria 2101
312 Ga0207659_10249120 3300025926 Bacteria 1441
313 Ga0207644_10035378 3300025931 Unclassified 3499
314 Ga0207690_10026989 3300025932 Unclassified 3624
315 Ga0207706_10004070 3300025933 Bacteria 13820
316 Ga0207686_10014112 3300025934 Bacteria 4439
317 Ga0207686_10159257 3300025934 Bacteria 1580
318 Ga0207670_10005273 3300025936 Bacteria 7078
319 Ga0207670_10023522 3300025936 Bacteria 3837
320 Ga0207704_10081839 3300025938 Unclassified 2090
321 Ga0207691_10101662 3300025940 Bacteria 2565
322 Ga0207689_10003365 3300025942 Bacteria 14638
323 Ga0207689_10063393 3300025942 Bacteria 3041
324 Ga0207689_10175789 3300025942 Bacteria 1765
325 Ga0207661_10279866 3300025944 Bacteria 1491
326 Ga0207667_10005062 3300025949 Bacteria 16104
327 Ga0207667_10006552 3300025949 Bacteria 14084
328 Ga0207667_10010151 3300025949 Bacteria 11030
329 Ga0207667_10023006 3300025949 Bacteria 6870
330 Ga0207651_10022577 3300025960 Bacteria 3851
331 Ga0207712_10003064 3300025961 Bacteria 10667
332 Ga0207712_10003234 3300025961 Bacteria 10351
333 Ga0207712_10061500 3300025961 Unclassified 2665
334 Ga0207668_10078491 3300025972 Unclassified 2384
335 Ga0207640_10108851 3300025981 Unclassified 1959
336 Ga0207640_10139635 3300025981 Bacteria 1764
337 Ga0207640_10166797 3300025981 Bacteria 1636
338 Ga0207658_10001199 3300025986 Bacteria 20672
339 Ga0207658_10017731 3300025986 Bacteria 4907
340 Ga0207658_10020810 3300025986 Bacteria 4545
341 Ga0207658_10025403 3300025986 Bacteria 4149
342 Ga0207677_10070042 3300026023 Unclassified 2469
343 Ga0207677_10112147 3300026023 Unclassified 2033
344 Ga0207703_10009965 3300026035 Bacteria 7453
345 Ga0207639_10035170 3300026041 Bacteria 3706
346 Ga0207639_10094138 3300026041 Bacteria 2404
347 Ga0207678_10027997 3300026067 Bacteria 4921
348 Ga0207708_10094803 3300026075 Unclassified 2304
349 Ga0207702_10031068 3300026078 Bacteria 4452
350 Ga0207702_10050474 3300026078 Bacteria 3513
351 Ga0207641_10000048 3300026088 Bacteria 178206
352 Ga0207641_10008548 3300026088 Bacteria 8457
353 Ga0207641_10027604 3300026088 Bacteria 4688
354 Ga0207641_10031708 3300026088 Bacteria 4384
355 Ga0207648_10046869 3300026089 Unclassified 3789
356 Ga0207648_10065383 3300026089 Bacteria 3171
357 Ga0207648_10078126 3300026089 Bacteria 2887
358 Ga0207648_10119285 3300026089 Unclassified 2318
359 Ga0207676_10013618 3300026095 Bacteria 5838
360 Ga0207674_10000487 3300026116 Bacteria 52391
361 Ga0207674_10013017 3300026116 Bacteria 9268
362 Ga0207675_100018877 3300026118 Bacteria 6435
363 Ga0207675_100045784 3300026118 Bacteria 4087
364 Ga0207683_10003268 3300026121 Bacteria 14130
365 Ga0207683_10308275 3300026121 Bacteria 1449
366 Ga0207683_10309274 3300026121 Unclassified 1446
367 Ga0207698_10007703 3300026142 Bacteria 6756
368 Ga0207698_10031428 3300026142 Bacteria 3832
369 Ga0268266_10000088 3300028379 Bacteria 199029
370 Ga0268266_10001424 3300028379 Bacteria 28538
371 Ga0268266_10083145 3300028379 Unclassified 2794
372 Ga0268265_10012870 3300028380 Bacteria 5678
373 Ga0268264_10000201 3300028381 Bacteria 122060
374 Ga0268264_10003372 3300028381 Bacteria 13801
375 Ga0268264_10006728 3300028381 Bacteria 9660
376 Ga0268264_10091484 3300028381 Bacteria 2624
377 Ga0265319_1003241 3300028563 Bacteria 8565
378 Ga0265334_10000602 3300028573 Bacteria 18167
379 Ga0265318_10002173 3300028577 Bacteria 10628
380 Ga0265322_10000143 3300028654 Bacteria 33417
381 Ga0265336_10000991 3300028666 Bacteria 13994
382 Ga0265336_10012918 3300028666 Bacteria 2796
383 Ga0265338_10003310 3300028800 Bacteria 22826
384 Ga0265338_10042158 3300028800 Bacteria 4256
385 Ga0265324_10020522 3300029957 Bacteria 2373
386 Ga0265330_10012178 3300031235 Unclassified 4024
387 Ga0265320_10007117 3300031240 Bacteria 6975
388 Ga0265340_10014462 3300031247 Bacteria 4119
389 Ga0265327_10000055 3300031251 Bacteria 247188
390 Ga0265327_10000368 3300031251 Bacteria 85604
391 Ga0265327_10003723 3300031251 Bacteria 14194
392 Ga0265327_10014414 3300031251 Bacteria 5173
393 Ga0265327_10061068 3300031251 Unclassified 1924
394 Ga0265316_10021419 3300031344 Bacteria 5474
395 Ga0265316_10037463 3300031344 Bacteria 3913
396 Ga0265316_10078079 3300031344 Bacteria 2542
397 Ga0265316_10149644 3300031344 Bacteria 1749
398 Ga0307509_10034551 3300031507 Bacteria 5555
399 Ga0265313_10054808 3300031595 Bacteria 1891
400 Ga0307508_10003562 3300031616 Bacteria 15680
401 Ga0307508_10030681 3300031616 Bacteria 4859
402 Ga0307516_10003131 3300031730 Bacteria 21513
403 Ga0307516_10021590 3300031730 Bacteria 6620
404 Ga0373944_0013904 3300035089 Bacteria 2239
405 Ga0373936_0016512 3300035113 Bacteria 2840
406 Ga0373956_0041878 3300035119 Bacteria 2035
407 Ga0373946_0001073 3300035171 Bacteria 9421
408 Ga0373935_0035396 3300035692 Bacteria 3116
409 Ga0373927_0000413 3300035695 Bacteria 32824
410 Ga0373927_0010990 3300035695 Bacteria 6029
411 Ga0373947_0000599 3300035725 Bacteria 21255
412 Ga0373947_0041463 3300035725 Bacteria 2744
413 Ga0373937_0156005 3300036401 Bacteria 2139
414 Ga0373925_0037676 3300037068 Bacteria 3571
415 Ga0395899_0000522 3300037312 Bacteria 42283
416 Ga0395905_0006828 3300037471 Bacteria 11423
417 Ga0395905_0054490 3300037471 Bacteria 3743
418 Ga0436365_1837098 3300039437 Bacteria 29699
419 Ga0451807_0982136 3300041486 Bacteria 2817
420 Ga0451577_0000034 3300042876 Bacteria 376183
421 Ga0466969_0000556 3300044656 Bacteria 20505
422 Ga0466969_0000925 3300044656 Bacteria 15832
423 Ga0466972_0000120 3300044658 Bacteria 66494
424 Ga0466972_0013257 3300044658 Bacteria 4139
425 Ga0453683_0000057 3300044673 Bacteria 190239
426 Ga0466966_0000127 3300044684 Bacteria 48556
427 Ga0466966_0000393 3300044684 Bacteria 28294
428 Ga0466961_0002668 3300044693 Bacteria 11070
429 Ga0466963_0169316 3300044694 Bacteria 1522
430 Ga0453684_0000098 3300044712 Bacteria 376183
431 Ga0453684_0011148 3300044712 Bacteria 15154
432 Ga0453684_0051097 3300044712 Bacteria 5426
433 Ga0466971_0005111 3300044719 Bacteria 5682
434 Ga0466957_0029344 3300044842 Bacteria 3279
435 Ga0466959_0000083 3300045049 Bacteria 59623
436 Ga0466959_0009087 3300045049 Bacteria 7054
437 Ga0451576_0000036 3300045051 Bacteria 376183
438 Ga0451576_0000080 3300045051 Bacteria 242782
439 Ga0451576_0000739 3300045051 Bacteria 65393
440 Ga0466958_0006547 3300045836 Bacteria 6347
441 Ga0466958_0129372 3300045836 Bacteria 1585
442 Ga0495629_0038731 3300046459 Bacteria 3357
443 Ga0495653_0109366 3300046463 Bacteria 1989
444 Ga0495580_0026634 3300046472 Bacteria 4214
445 Ga0495662_0000683 3300046476 Bacteria 16037
446 Ga0495662_0010605 3300046476 Bacteria 4507
447 Ga0495664_0000090 3300046477 Bacteria 44350
448 Ga0495608_0036383 3300046511 Bacteria 3315
449 Ga0495618_0001865 3300046514 Bacteria 13891
450 Ga0495628_0045566 3300046516 Bacteria 3486
451 Ga0495630_0025881 3300046517 Bacteria 4341
452 Ga0495630_0045433 3300046517 Bacteria 3282
453 Ga0495648_0015330 3300046524 Bacteria 5571
454 Ga0495652_0125453 3300046529 Bacteria 2040
455 Ga0495665_0063320 3300046531 Bacteria 1952
456 Ga0495640_0014492 3300046533 Bacteria 5961
457 Ga0495621_0032213 3300046539 Bacteria 1801
458 Ga0495621_0053423 3300046539 Unclassified 1450
459 Ga0495621_0073294 3300046539 Unclassified 1265
460 Ga0495645_0010498 3300046543 Bacteria 6495
461 Ga0495634_0005829 3300046642 Bacteria 9402
462 Ga0495634_0007208 3300046642 Bacteria 8382
463 Ga0495611_0018429 3300046648 Bacteria 2994
464 Ga0495635_0010273 3300046663 Bacteria 6545
465 Ga0495635_0058775 3300046663 Bacteria 2645
466 Ga0495658_0016170 3300046683 Bacteria 3840
467 Ga0495669_0038164 3300046684 Bacteria 2127
468 Ga0495613_0020841 3300046689 Bacteria 4887
469 Ga0495624_0013454 3300046690 Bacteria 5579
470 Ga0495670_0015714 3300046691 Bacteria 3721
471 Ga0495600_0144390 3300046809 Bacteria 1543
472 Ga0495581_0001641 3300047315 Bacteria 12467
473 Ga0495674_0001316 3300047319 Bacteria 24174
474 Ga0495674_0097442 3300047319 Bacteria 2505
475 Ga0495672_0036494 3300047320 Bacteria 3018
476 Ga0495687_000010 3300047443 Bacteria 413735
477 Ga0495684_0031342 3300047471 Bacteria 4081
478 Ga0495593_0012267 3300047673 Bacteria 4898
479 Ga0496108_0087848 3300048911 Unclassified 2641
480 Ga0496114_0000414 3300048917 Bacteria 31641
481 Ga0501032_0010255 3300049569 Bacteria 6760
482 Ga0501034_0000043 3300049571 Bacteria 229049
483 Ga0501034_0046235 3300049571 Bacteria 4398
484 Ga0501034_0327558 3300049571 Bacteria 1464
485 Ga0501036_0047216 3300049572 Bacteria 3647
486 Ga0501039_0023050 3300049575 Bacteria 4776
487 Ga0501043_0001605 3300049579 Bacteria 19666
488 Ga0501043_0110255 3300049579 Bacteria 2161
489 Ga0501046_0001390 3300049580 Bacteria 23300
490 Ga0501047_0003344 3300049581 Bacteria 15194
491 Ga0501047_0021592 3300049581 Bacteria 6183
492 Ga0501048_0018277 3300049582 Bacteria 5157
493 Ga0501070_0029788 3300049586 Bacteria 4574
494 Ga0501073_0011587 3300049589 Bacteria 6445
495 Ga0501074_0005404 3300049590 Bacteria 9196
496 Ga0501077_0124194 3300049593 Bacteria 1636
497 Ga0501257_005232 3300049686 Bacteria 2855
498 Ga0501079_0025378 3300049741 Bacteria 4546
499 Ga0501035_0042329 3300049822 Bacteria 4108
500 Ga0501044_0005070 3300049823 Bacteria 14702
501 nmdc:mga0k408_8547_c1 3300050493 Bacteria 5499
502 nmdc:mga05p37_89356_c1 3300050507 Bacteria 3796
503 nmdc:mga09592_17647_c1 3300050508 Bacteria 5850
504 nmdc:mga06r32_268875_c1 3300050510 Bacteria 1692
505 nmdc:mga08y16_154716_c1 3300050511 Bacteria 2383
506 Ga0495601_0008643 3300053077 Bacteria 6010
507 Ga0495612_0000207 3300053078 Bacteria 25049
508 Ga0495619_0004861 3300053085 Bacteria 8526
509 Ga0495619_0091014 3300053085 Bacteria 2065
510 Ga0500578_0096752 3300053086 Bacteria 1871
511 Ga0500583_0029101 3300053092 Bacteria 2404
512 Ga0500608_000835 3300053122 Bacteria 11138
513 Ga0500622_0002993 3300053156 Bacteria 11711
514 Ga0500636_0021307 3300053177 Unclassified 3836
515 Ga0500636_0085756 3300053177 Bacteria 1809
516 Ga0466962_0003613 3300061719 Bacteria 7372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006358 Ga0068871_100060893 Ga0068871_1000608933 340
2 3300035695 Ga0373927_0010990 Ga0373927_0010990_3714_5030 352
3 3300035725 Ga0373947_0041463 Ga0373947_0041463_523_1839 352
4 3300046459 Ga0495629_0038731 Ga0495629_0038731_916_2232 352
5 3300046476 Ga0495662_0000683 Ga0495662_0000683_13587_14903 352
6 3300046477 Ga0495664_0000090 Ga0495664_0000090_16360_17676 352
7 3300046514 Ga0495618_0001865 Ga0495618_0001865_3587_4903 352
8 3300046517 Ga0495630_0025881 Ga0495630_0025881_1550_2866 352
9 3300046529 Ga0495652_0125453 Ga0495652_0125453_693_2009 352
10 3300046531 Ga0495665_0063320 Ga0495665_0063320_254_1570 352
11 3300046533 Ga0495640_0014492 Ga0495640_0014492_1792_3108 352
12 3300046543 Ga0495645_0010498 Ga0495645_0010498_1791_3107 352
13 3300046642 Ga0495634_0005829 Ga0495634_0005829_3028_4344 352
14 3300046663 Ga0495635_0010273 Ga0495635_0010273_1792_3108 352
15 3300046689 Ga0495613_0020841 Ga0495613_0020841_3153_4454 352
16 3300047319 Ga0495674_0001316 Ga0495674_0001316_8292_9608 352
17 3300047471 Ga0495684_0031342 Ga0495684_0031342_1640_2956 352
18 3300053077 Ga0495601_0008643 Ga0495601_0008643_1390_2706 352
19 3300053078 Ga0495612_0000207 Ga0495612_0000207_10888_12204 352
20 3300053085 Ga0495619_0004861 Ga0495619_0004861_4510_5826 352
21 3300037068 Ga0373925_0037676 Ga0373925_0037676_1126_2442 353
22 3300009093 Ga0105240_10000011 Ga0105240_10000011311 354
23 3300025913 Ga0207695_10000010 Ga0207695_10000010701 354
24 3300046539 Ga0495621_0073294 Ga0495621_0073294_176_1252 357
25 3300006237 Ga0097621_100070399 Ga0097621_1000703992 363
26 3300009094 Ga0111539_10574902 Ga0111539_105749022 363
27 3300009177 Ga0105248_10306905 Ga0105248_103069052 363
28 3300053086 Ga0500578_0096752 Ga0500578_0096752_11_1159 363
29 3300035089 Ga0373944_0013904 Ga0373944_0013904_834_2135 365
30 3300035113 Ga0373936_0016512 Ga0373936_0016512_1164_2465 365
31 3300035171 Ga0373946_0001073 Ga0373946_0001073_1822_3123 365
32 3300035692 Ga0373935_0035396 Ga0373935_0035396_1038_2339 365
33 3300035695 Ga0373927_0000413 Ga0373927_0000413_7122_8423 365
34 3300035725 Ga0373947_0000599 Ga0373947_0000599_15935_17236 365
35 3300046472 Ga0495580_0026634 Ga0495580_0026634_1169_2470 365
36 3300046476 Ga0495662_0010605 Ga0495662_0010605_1112_2413 365
37 3300046663 Ga0495635_0058775 Ga0495635_0058775_703_2004 365
38 3300046683 Ga0495658_0016170 Ga0495658_0016170_515_1816 365
39 3300046690 Ga0495624_0013454 Ga0495624_0013454_3775_5076 365
40 3300047315 Ga0495581_0001641 Ga0495581_0001641_3405_4706 365
41 3300047319 Ga0495674_0097442 Ga0495674_0097442_920_2221 365
42 3300047673 Ga0495593_0012267 Ga0495593_0012267_2211_3512 365
43 3300046539 Ga0495621_0053423 Ga0495621_0053423_46_1311 366
44 3300046809 Ga0495600_0144390 Ga0495600_0144390_10_1326 366
45 3300010375 Ga0105239_10001802 Ga0105239_100018022 367
46 3300005457 Ga0070662_100006091 Ga0070662_1000060915 369
47 3300005564 Ga0070664_100039923 Ga0070664_1000399232 369
48 3300025933 Ga0207706_10004070 Ga0207706_100040705 369
49 3300053085 Ga0495619_0091014 Ga0495619_0091014_268_1581 371
50 3300005338 Ga0068868_100193686 Ga0068868_1001936862 374
51 3300048917 Ga0496114_0000414 Ga0496114_0000414_21355_22704 375
52 3300025907 Ga0207645_10008116 Ga0207645_100081163 376
53 3300025913 Ga0207695_10113424 Ga0207695_101134242 376
54 3300025986 Ga0207658_10025403 Ga0207658_100254033 377
55 3300044712 Ga0453684_0011148 Ga0453684_0011148_13121_14389 378
56 3300037471 Ga0395905_0006828 Ga0395905_0006828_4726_5976 383
57 3300009545 Ga0105237_10000256 Ga0105237_1000025635 385
58 3300025914 Ga0207671_10000730 Ga0207671_1000073014 385
59 3300045051 Ga0451576_0000080 Ga0451576_0000080_63987_65237 390
60 3300028654 Ga0265322_10000143 Ga0265322_1000014333 391
61 3300014326 Ga0157380_10000068 Ga0157380_1000006834 392
62 3300005983 Ga0081540_1003369 Ga0081540_100336912 396
63 3300046463 Ga0495653_0109366 Ga0495653_0109366_237_1553 396
64 3300046684 Ga0495669_0038164 Ga0495669_0038164_358_1563 397
65 3300035119 Ga0373956_0041878 Ga0373956_0041878_696_1964 399
66 3300036401 Ga0373937_0156005 Ga0373937_0156005_850_2118 399
67 3300046511 Ga0495608_0036383 Ga0495608_0036383_1254_2522 399
68 3300046516 Ga0495628_0045566 Ga0495628_0045566_1832_3100 399
69 3300046517 Ga0495630_0045433 Ga0495630_0045433_1246_2514 399
70 3300005338 Ga0068868_100037277 Ga0068868_1000372773 400
71 3300005843 Ga0068860_100006064 Ga0068860_1000060645 400
72 3300009093 Ga0105240_10000100 Ga0105240_1000010057 400
73 3300009093 Ga0105240_10009710 Ga0105240_100097103 400
74 3300009093 Ga0105240_10015435 Ga0105240_1001543510 400
75 3300009545 Ga0105237_10001107 Ga0105237_1000110728 400
76 3300009551 Ga0105238_10134033 Ga0105238_101340332 400
77 3300010375 Ga0105239_10114888 Ga0105239_101148882 400
78 3300010375 Ga0105239_10124651 Ga0105239_101246512 400
79 3300013100 Ga0157373_10130317 Ga0157373_101303172 400
80 3300013307 Ga0157372_10001517 Ga0157372_100015177 400
81 3300025913 Ga0207695_10000027 Ga0207695_10000027394 400
82 3300028381 Ga0268264_10003372 Ga0268264_100033723 400
83 3300031251 Ga0265327_10000368 Ga0265327_1000036850 400
84 3300031507 Ga0307509_10034551 Ga0307509_100345515 400
85 3300013307 Ga0157372_10008533 Ga0157372_100085334 401
86 3300015682 Ga0183373_1003 Ga0183373_1003132 401
87 3300046642 Ga0495634_0007208 Ga0495634_0007208_2953_4266 401
88 3300049571 Ga0501034_0000043 Ga0501034_0000043_226594_227853 401
89 3300006028 Ga0070717_10157567 Ga0070717_101575672 402
90 3300013306 Ga0163162_10001646 Ga0163162_100016466 402
91 3300026088 Ga0207641_10008548 Ga0207641_100085489 402
92 3300005327 Ga0070658_10012491 Ga0070658_100124915 403
93 3300005335 Ga0070666_10006658 Ga0070666_100066583 403
94 3300005336 Ga0070680_100188428 Ga0070680_1001884282 403
95 3300005347 Ga0070668_100018484 Ga0070668_1000184841 403
96 3300005355 Ga0070671_100137679 Ga0070671_1001376792 403
97 3300005367 Ga0070667_100075515 Ga0070667_1000755151 403
98 3300005459 Ga0068867_100006003 Ga0068867_1000060035 403
99 3300005539 Ga0068853_100027829 Ga0068853_1000278293 403
100 3300005543 Ga0070672_100050413 Ga0070672_1000504131 403
101 3300005548 Ga0070665_100001604 Ga0070665_10000160414 403
102 3300005563 Ga0068855_100040421 Ga0068855_1000404214 403
103 3300005578 Ga0068854_100029837 Ga0068854_1000298372 403
104 3300005614 Ga0068856_100276727 Ga0068856_1002767271 403
105 3300005618 Ga0068864_100254504 Ga0068864_1002545041 403
106 3300005841 Ga0068863_100074144 Ga0068863_1000741443 403
107 3300005842 Ga0068858_100003981 Ga0068858_1000039814 403
108 3300006358 Ga0068871_100013343 Ga0068871_1000133432 403
109 3300006881 Ga0068865_100085899 Ga0068865_1000858992 403
110 3300009174 Ga0105241_10012031 Ga0105241_100120314 403
111 3300009545 Ga0105237_10146708 Ga0105237_101467082 403
112 3300010375 Ga0105239_10024961 Ga0105239_100249614 403
113 3300010375 Ga0105239_10038296 Ga0105239_100382965 403
114 3300013100 Ga0157373_10004048 Ga0157373_100040486 403
115 3300013102 Ga0157371_10110133 Ga0157371_101101331 403
116 3300013105 Ga0157369_10015108 Ga0157369_100151085 403
117 3300013306 Ga0163162_10102461 Ga0163162_101024612 403
118 3300013307 Ga0157372_10107012 Ga0157372_101070122 403
119 3300014325 Ga0163163_10002931 Ga0163163_100029313 403
120 3300014969 Ga0157376_10060121 Ga0157376_100601212 403
121 3300025321 Ga0207656_10051422 Ga0207656_100514221 403
122 3300025903 Ga0207680_10025221 Ga0207680_100252212 403
123 3300025907 Ga0207645_10000542 Ga0207645_100005426 403
124 3300025911 Ga0207654_10015076 Ga0207654_100150761 403
125 3300025913 Ga0207695_10024762 Ga0207695_100247622 403
126 3300025972 Ga0207668_10078491 Ga0207668_100784912 403
127 3300025986 Ga0207658_10001199 Ga0207658_1000119912 403
128 3300026088 Ga0207641_10031708 Ga0207641_100317084 403
129 3300026089 Ga0207648_10119285 Ga0207648_101192852 403
130 3300028379 Ga0268266_10083145 Ga0268266_100831452 403
131 3300028381 Ga0268264_10091484 Ga0268264_100914843 403
132 3300048911 Ga0496108_0087848 Ga0496108_0087848_1000_2247 403
133 3300005366 Ga0070659_100030049 Ga0070659_1000300496 404
134 3300005535 Ga0070684_100007071 Ga0070684_1000070717 404
135 3300005539 Ga0068853_100140806 Ga0068853_1001408062 404
136 3300005577 Ga0068857_100000697 Ga0068857_10000069721 404
137 3300005842 Ga0068858_100145367 Ga0068858_1001453673 404
138 3300009553 Ga0105249_10100591 Ga0105249_101005911 404
139 3300013100 Ga0157373_10028684 Ga0157373_100286842 404
140 3300025920 Ga0207649_10001036 Ga0207649_100010364 404
141 3300025932 Ga0207690_10026989 Ga0207690_100269893 404
142 3300025934 Ga0207686_10159257 Ga0207686_101592571 404
143 3300025961 Ga0207712_10061500 Ga0207712_100615001 404
144 3300026041 Ga0207639_10094138 Ga0207639_100941383 404
145 3300026116 Ga0207674_10013017 Ga0207674_100130177 404
146 3300041486 Ga0451807_0982136 Ga0451807_0982136_755_2032 404
147 3300044656 Ga0466969_0000925 Ga0466969_0000925_11187_12470 404
148 3300044684 Ga0466966_0000127 Ga0466966_0000127_41856_43139 404
149 3300044693 Ga0466961_0002668 Ga0466961_0002668_4480_5763 404
150 3300044694 Ga0466963_0169316 Ga0466963_0169316_162_1445 404
151 3300044719 Ga0466971_0005111 Ga0466971_0005111_282_1565 404
152 3300045049 Ga0466959_0009087 Ga0466959_0009087_3650_4933 404
153 3300045836 Ga0466958_0006547 Ga0466958_0006547_2442_3725 404
154 3300047320 Ga0495672_0036494 Ga0495672_0036494_1009_2295 404
155 3300061719 Ga0466962_0003613 Ga0466962_0003613_3835_5118 404
156 3300049569 Ga0501032_0010255 Ga0501032_0010255_645_1916 405
157 3300049571 Ga0501034_0046235 Ga0501034_0046235_1014_2285 405
158 3300049572 Ga0501036_0047216 Ga0501036_0047216_212_1483 405
159 3300049575 Ga0501039_0023050 Ga0501039_0023050_322_1593 405
160 3300049579 Ga0501043_0001605 Ga0501043_0001605_5325_6596 405
161 3300049580 Ga0501046_0001390 Ga0501046_0001390_5767_7038 405
162 3300049581 Ga0501047_0003344 Ga0501047_0003344_10290_11561 405
163 3300049582 Ga0501048_0018277 Ga0501048_0018277_786_2057 405
164 3300049586 Ga0501070_0029788 Ga0501070_0029788_2550_3821 405
165 3300049589 Ga0501073_0011587 Ga0501073_0011587_1668_2939 405
166 3300049590 Ga0501074_0005404 Ga0501074_0005404_5828_7099 405
167 3300049593 Ga0501077_0124194 Ga0501077_0124194_251_1522 405
168 3300049741 Ga0501079_0025378 Ga0501079_0025378_3253_4524 405
169 3300049823 Ga0501044_0005070 Ga0501044_0005070_3513_4784 405
170 3300009545 Ga0105237_10003457 Ga0105237_1000345710 406
171 3300025914 Ga0207671_10000067 Ga0207671_1000006734 406
172 3300045836 Ga0466958_0129372 Ga0466958_0129372_65_1297 406
173 3300003761 Ga0055535_1002736 Ga0055535_10027363 407
174 3300005331 Ga0070670_100203315 Ga0070670_1002033152 407
175 3300014325 Ga0163163_10000407 Ga0163163_1000040720 407
176 3300025242 Ga0209258_100159 Ga0209258_10015918 407
177 3300025246 Ga0209646_1000746 Ga0209646_10007463 407
178 3300025254 Ga0209148_1000156 Ga0209148_1000156118 407
179 3300005355 Ga0070671_100013350 Ga0070671_1000133502 408
180 3300006237 Ga0097621_100058223 Ga0097621_1000582232 408
181 3300006358 Ga0068871_100000737 Ga0068871_1000007373 408
182 3300006881 Ga0068865_100177730 Ga0068865_1001777302 408
183 3300009176 Ga0105242_10165000 Ga0105242_101650001 408
184 3300013297 Ga0157378_10003535 Ga0157378_1000353512 408
185 3300013297 Ga0157378_10061863 Ga0157378_100618632 408
186 3300013306 Ga0163162_10074681 Ga0163162_100746812 408
187 3300013308 Ga0157375_10099478 Ga0157375_100994782 408
188 3300014969 Ga0157376_10025569 Ga0157376_100255692 408
189 3300017792 Ga0163161_10000823 Ga0163161_100008239 408
190 3300025913 Ga0207695_10115455 Ga0207695_101154552 408
191 3300025931 Ga0207644_10035378 Ga0207644_100353782 408
192 3300025938 Ga0207704_10081839 Ga0207704_100818392 408
193 3300026121 Ga0207683_10309274 Ga0207683_103092742 408
194 3300031251 Ga0265327_10061068 Ga0265327_100610682 408
195 3300053177 Ga0500636_0021307 Ga0500636_0021307_1806_3032 408
196 3300005338 Ga0068868_100004562 Ga0068868_1000045622 409
197 3300005367 Ga0070667_100006235 Ga0070667_1000062352 409
198 3300005617 Ga0068859_100015275 Ga0068859_1000152754 409
199 3300005843 Ga0068860_100038917 Ga0068860_1000389175 409
200 3300006931 Ga0097620_100015275 Ga0097620_1000152754 409
201 3300011119 Ga0105246_10073579 Ga0105246_100735792 409
202 3300013296 Ga0157374_10105853 Ga0157374_101058532 409
203 3300013297 Ga0157378_10004919 Ga0157378_100049193 409
204 3300025960 Ga0207651_10022577 Ga0207651_100225772 409
205 3300025986 Ga0207658_10017731 Ga0207658_100177312 409
206 3300026023 Ga0207677_10070042 Ga0207677_100700421 409
207 3300005535 Ga0070684_100107562 Ga0070684_1001075622 410
208 3300005563 Ga0068855_100012369 Ga0068855_1000123694 410
209 3300005614 Ga0068856_100113296 Ga0068856_1001132961 410
210 3300005616 Ga0068852_100082712 Ga0068852_1000827121 410
211 3300009093 Ga0105240_10041200 Ga0105240_100412004 410
212 3300010375 Ga0105239_10023740 Ga0105239_100237407 410
213 3300013100 Ga0157373_10007633 Ga0157373_100076332 410
214 3300013105 Ga0157369_10027556 Ga0157369_100275564 410
215 3300025949 Ga0207667_10006552 Ga0207667_100065526 410
216 3300026041 Ga0207639_10035170 Ga0207639_100351702 410
217 3300026121 Ga0207683_10003268 Ga0207683_100032688 412
218 3300005335 Ga0070666_10016644 Ga0070666_100166443 413
219 3300005335 Ga0070666_10147434 Ga0070666_101474342 413
220 3300005338 Ga0068868_100065260 Ga0068868_1000652602 413
221 3300005618 Ga0068864_100290137 Ga0068864_1002901371 413
222 3300009177 Ga0105248_10308066 Ga0105248_103080661 413
223 3300010375 Ga0105239_10383440 Ga0105239_103834401 413
224 3300011119 Ga0105246_10069887 Ga0105246_100698871 413
225 3300013102 Ga0157371_10106257 Ga0157371_101062572 413
226 3300013308 Ga0157375_10006874 Ga0157375_100068747 413
227 3300014325 Ga0163163_10224338 Ga0163163_102243381 413
228 3300014969 Ga0157376_10012138 Ga0157376_100121385 413
229 3300025913 Ga0207695_10076180 Ga0207695_100761803 413
230 3300025914 Ga0207671_10015552 Ga0207671_100155525 413
231 3300026121 Ga0207683_10308275 Ga0207683_103082751 413
232 3300031235 Ga0265330_10012178 Ga0265330_100121782 413
233 3300031344 Ga0265316_10078079 Ga0265316_100780791 413
234 iso_pu_bacteria 2914759650 2914762263 413
235 3300005330 Ga0070690_100017902 Ga0070690_1000179024 414
236 3300005366 Ga0070659_100023554 Ga0070659_1000235542 414
237 3300005616 Ga0068852_100004323 Ga0068852_10000432310 414
238 3300005617 Ga0068859_100256245 Ga0068859_1002562451 414
239 3300005834 Ga0068851_10001521 Ga0068851_1000152110 414
240 3300006237 Ga0097621_100041401 Ga0097621_1000414013 414
241 3300006358 Ga0068871_100086313 Ga0068871_1000863132 414
242 3300006931 Ga0097620_100256234 Ga0097620_1002562342 414
243 3300013296 Ga0157374_10005877 Ga0157374_100058775 414
244 3300013306 Ga0163162_10014680 Ga0163162_100146807 414
245 3300013307 Ga0157372_10116201 Ga0157372_101162012 414
246 3300013308 Ga0157375_10029284 Ga0157375_100292845 414
247 3300014969 Ga0157376_10038993 Ga0157376_100389933 414
248 3300025321 Ga0207656_10000641 Ga0207656_100006417 414
249 3300025904 Ga0207647_10001274 Ga0207647_100012749 414
250 3300025926 Ga0207659_10109060 Ga0207659_101090602 414
251 3300026023 Ga0207677_10112147 Ga0207677_101121472 414
252 3300026142 Ga0207698_10031428 Ga0207698_100314283 414
253 3300006195 Ga0075366_10010456 Ga0075366_100104563 415
254 3300013307 Ga0157372_10003940 Ga0157372_1000394014 415
255 3300050493 nmdc:mga0k408_8547_c1 nmdc:mga0k408_8547_c1_2849_4165 415
256 iso_pu_bacteria 2929177148 2929179330 415
257 iso_pu_bacteria 2946013367 2946018857 415
258 3300005548 Ga0070665_100009726 Ga0070665_1000097267 416
259 3300005616 Ga0068852_100154023 Ga0068852_1001540232 416
260 3300025904 Ga0207647_10000347 Ga0207647_1000034715 416
261 3300025914 Ga0207671_10162927 Ga0207671_101629272 416
262 3300025944 Ga0207661_10279866 Ga0207661_102798661 416
263 3300028379 Ga0268266_10001424 Ga0268266_1000142426 416
264 3300042876 Ga0451577_0000034 Ga0451577_0000034_206036_207292 416
265 3300044673 Ga0453683_0000057 Ga0453683_0000057_179297_180553 416
266 3300044712 Ga0453684_0000098 Ga0453684_0000098_206036_207292 416
267 3300045051 Ga0451576_0000036 Ga0451576_0000036_168892_170148 416
268 iso_pu_bacteria 2519899754 2520879243 416
269 iso_pu_bacteria 2929921140 2929926284 416
270 3300003316 rootH1_10052212 rootH1_100522124 417
271 3300003316 rootH1_10160141 rootH1_101601412 417
272 3300003322 rootL2_10024198 rootL2_100241984 417
273 3300003323 rootH1_10011789 rootH1_1001178941 417
274 3300005614 Ga0068856_100007044 Ga0068856_10000704410 417
275 3300006844 Ga0075428_100129367 Ga0075428_1001293672 417
276 3300009093 Ga0105240_10007530 Ga0105240_100075303 417
277 3300009174 Ga0105241_10002514 Ga0105241_100025142 417
278 3300013104 Ga0157370_10012521 Ga0157370_100125217 417
279 3300013105 Ga0157369_10107283 Ga0157369_101072833 417
280 3300026078 Ga0207702_10050474 Ga0207702_100504742 417
281 3300046691 Ga0495670_0015714 Ga0495670_0015714_1549_2802 417
282 iso_pu_bacteria 2884933994 2884937100 417
283 iso_pu_bacteria 2902048731 2902052750 417
284 3300003323 rootH1_10289623 rootH1_102896232 418
285 3300005353 Ga0070669_100234259 Ga0070669_1002342591 418
286 3300006237 Ga0097621_100006903 Ga0097621_1000069034 418
287 3300010375 Ga0105239_10101177 Ga0105239_101011772 418
288 3300013297 Ga0157378_10136684 Ga0157378_101366842 418
289 3300013306 Ga0163162_10004336 Ga0163162_100043364 418
290 3300013306 Ga0163162_10134747 Ga0163162_101347472 418
291 3300014968 Ga0157379_10162617 Ga0157379_101626172 418
292 3300005327 Ga0070658_10124481 Ga0070658_101244811 419
293 3300005329 Ga0070683_100085077 Ga0070683_1000850774 419
294 3300005337 Ga0070682_100000044 Ga0070682_10000004499 419
295 3300005455 Ga0070663_100004297 Ga0070663_1000042977 419
296 3300005530 Ga0070679_100113333 Ga0070679_1001133332 419
297 3300005544 Ga0070686_100041578 Ga0070686_1000415781 419
298 3300009176 Ga0105242_10079329 Ga0105242_100793292 419
299 3300010375 Ga0105239_10071322 Ga0105239_100713224 419
300 3300013102 Ga0157371_10003427 Ga0157371_100034273 419
301 3300013105 Ga0157369_10000742 Ga0157369_1000074247 419
302 3300013307 Ga0157372_10000048 Ga0157372_10000048114 419
303 3300015684 Ga0183365_10004 Ga0183365_10004211 419
304 3300025909 Ga0207705_10255641 Ga0207705_102556411 419
305 3300025981 Ga0207640_10139635 Ga0207640_101396351 419
306 3300026067 Ga0207678_10027997 Ga0207678_100279975 419
307 3300026089 Ga0207648_10065383 Ga0207648_100653832 419
308 3300028800 Ga0265338_10042158 Ga0265338_100421582 419
309 3300029957 Ga0265324_10020522 Ga0265324_100205222 419
310 3300031344 Ga0265316_10021419 Ga0265316_100214193 419
311 3300037312 Ga0395899_0000522 Ga0395899_0000522_27649_28908 419
312 3300044658 Ga0466972_0000120 Ga0466972_0000120_17300_18568 419
313 3300049571 Ga0501034_0327558 Ga0501034_0327558_82_1353 419
314 3300049822 Ga0501035_0042329 Ga0501035_0042329_140_1414 419
315 3300002737 JGI25162J39368_1000046 JGI25162J39368_1000046118 420
316 3300002738 JGI25154J39366_1000016 JGI25154J39366_100001687 420
317 3300003320 rootH2_10005192 rootH2_100051924 420
318 3300003323 rootH1_10025617 rootH1_100256174 420
319 3300003323 rootH1_10071014 rootH1_100710146 420
320 3300003354 JGI25160J50197_1004864 JGI25160J50197_10048645 420
321 3300005331 Ga0070670_100081108 Ga0070670_1000811083 420
322 3300005331 Ga0070670_100230979 Ga0070670_1002309791 420
323 3300005334 Ga0068869_100040291 Ga0068869_1000402914 420
324 3300005367 Ga0070667_100016560 Ga0070667_1000165604 420
325 3300005471 Ga0070698_100000965 Ga0070698_1000009652 420
326 3300005844 Ga0068862_100006143 Ga0068862_1000061434 420
327 3300009093 Ga0105240_10315718 Ga0105240_103157182 420
328 3300009176 Ga0105242_10058834 Ga0105242_100588342 420
329 3300010375 Ga0105239_10000176 Ga0105239_1000017625 420
330 3300025233 Ga0209437_100070 Ga0209437_100070193 420
331 3300025245 Ga0207425_1017189 Ga0207425_10171891 420
332 3300025246 Ga0209646_1000003 Ga0209646_100000387 420
333 3300025250 Ga0209026_1000202 Ga0209026_100020210 420
334 3300025250 Ga0209026_1003860 Ga0209026_10038607 420
335 3300025297 Ga0209758_1013892 Ga0209758_10138922 420
336 3300025302 Ga0207426_1001047 Ga0207426_100104716 420
337 3300025925 Ga0207650_10111263 Ga0207650_101112632 420
338 3300025942 Ga0207689_10063393 Ga0207689_100633934 420
339 3300025942 Ga0207689_10175789 Ga0207689_101757891 420
340 3300025986 Ga0207658_10020810 Ga0207658_100208104 420
341 3300026089 Ga0207648_10078126 Ga0207648_100781263 420
342 3300028380 Ga0268265_10012870 Ga0268265_100128705 420
343 3300031251 Ga0265327_10000055 Ga0265327_1000005562 420
344 3300031616 Ga0307508_10003562 Ga0307508_1000356210 420
345 3300031616 Ga0307508_10030681 Ga0307508_100306813 420
346 3300049686 Ga0501257_005232 Ga0501257_005232_890_2215 420
347 3300053122 Ga0500608_000835 Ga0500608_000835_4867_6141 420
348 iso_pu_bacteria 2818991460 2819681215 420
349 iso_pu_bacteria 8003151029 8003156576 420
350 3300001979 JGI24740J21852_10005045 JGI24740J21852_100050453 421
351 3300003316 rootH1_10036836 rootH1_100368362 421
352 3300003320 rootH2_10133397 rootH2_101333972 421
353 3300003322 rootL2_10124837 rootL2_101248372 421
354 3300003323 rootH1_10122889 rootH1_101228893 421
355 3300005290 Ga0065712_10000853 Ga0065712_100008535 421
356 3300005334 Ga0068869_100004103 Ga0068869_1000041037 421
357 3300005336 Ga0070680_100005777 Ga0070680_1000057773 421
358 3300005337 Ga0070682_100055890 Ga0070682_1000558902 421
359 3300005340 Ga0070689_100024974 Ga0070689_1000249744 421
360 3300005344 Ga0070661_100069081 Ga0070661_1000690811 421
361 3300005355 Ga0070671_100067357 Ga0070671_1000673573 421
362 3300005366 Ga0070659_100138129 Ga0070659_1001381292 421
363 3300005438 Ga0070701_10060408 Ga0070701_100604082 421
364 3300005441 Ga0070700_100095390 Ga0070700_1000953901 421
365 3300005458 Ga0070681_10127478 Ga0070681_101274782 421
366 3300005466 Ga0070685_10036922 Ga0070685_100369222 421
367 3300005467 Ga0070706_100291078 Ga0070706_1002910781 421
368 3300005471 Ga0070698_100010578 Ga0070698_1000105784 421
369 3300005471 Ga0070698_100018700 Ga0070698_1000187006 421
370 3300005539 Ga0068853_100089691 Ga0068853_1000896913 421
371 3300005539 Ga0068853_100108201 Ga0068853_1001082012 421
372 3300005539 Ga0068853_100145150 Ga0068853_1001451502 421
373 3300005543 Ga0070672_100246699 Ga0070672_1002466991 421
374 3300005548 Ga0070665_100000031 Ga0070665_100000031221 421
375 3300005563 Ga0068855_100006093 Ga0068855_1000060931 421
376 3300005563 Ga0068855_100034944 Ga0068855_1000349443 421
377 3300005563 Ga0068855_100049935 Ga0068855_1000499352 421
378 3300005563 Ga0068855_100142712 Ga0068855_1001427122 421
379 3300005564 Ga0070664_100077781 Ga0070664_1000777813 421
380 3300005577 Ga0068857_100013784 Ga0068857_1000137846 421
381 3300005578 Ga0068854_100014269 Ga0068854_1000142693 421
382 3300005614 Ga0068856_100044869 Ga0068856_1000448692 421
383 3300005616 Ga0068852_100002245 Ga0068852_1000022453 421
384 3300005617 Ga0068859_100000012 Ga0068859_10000001237 421
385 3300005617 Ga0068859_100055472 Ga0068859_1000554722 421
386 3300005618 Ga0068864_100002123 Ga0068864_1000021237 421
387 3300005840 Ga0068870_10095406 Ga0068870_100954062 421
388 3300005841 Ga0068863_100004636 Ga0068863_1000046367 421
389 3300005842 Ga0068858_100012915 Ga0068858_1000129154 421
390 3300005843 Ga0068860_100000072 Ga0068860_10000007263 421
391 3300005843 Ga0068860_100002371 Ga0068860_10000237112 421
392 3300005844 Ga0068862_100179091 Ga0068862_1001790912 421
393 3300006358 Ga0068871_100032988 Ga0068871_1000329884 421
394 3300006358 Ga0068871_100269906 Ga0068871_1002699061 421
395 3300006844 Ga0075428_100007967 Ga0075428_1000079676 421
396 3300006846 Ga0075430_100155797 Ga0075430_1001557972 421
397 3300006847 Ga0075431_100269718 Ga0075431_1002697182 421
398 3300006880 Ga0075429_100006484 Ga0075429_1000064846 421
399 3300006931 Ga0097620_100000012 Ga0097620_10000001237 421
400 3300006931 Ga0097620_100055467 Ga0097620_1000554672 421
401 3300009093 Ga0105240_10000319 Ga0105240_1000031936 421
402 3300009094 Ga0111539_10065798 Ga0111539_100657982 421
403 3300009094 Ga0111539_10120492 Ga0111539_101204922 421
404 3300009094 Ga0111539_10172101 Ga0111539_101721012 421
405 3300009098 Ga0105245_10096582 Ga0105245_100965822 421
406 3300009101 Ga0105247_10035764 Ga0105247_100357642 421
407 3300009147 Ga0114129_10110056 Ga0114129_101100562 421
408 3300009174 Ga0105241_10004826 Ga0105241_100048268 421
409 3300009174 Ga0105241_10009603 Ga0105241_100096033 421
410 3300009174 Ga0105241_10121574 Ga0105241_101215741 421
411 3300009176 Ga0105242_10044006 Ga0105242_100440062 421
412 3300009176 Ga0105242_10124436 Ga0105242_101244362 421
413 3300009545 Ga0105237_10001705 Ga0105237_100017058 421
414 3300009545 Ga0105237_10006687 Ga0105237_100066878 421
415 3300009545 Ga0105237_10046780 Ga0105237_100467803 421
416 3300009545 Ga0105237_10206312 Ga0105237_102063122 421
417 3300009545 Ga0105237_10206410 Ga0105237_102064102 421
418 3300009551 Ga0105238_10084732 Ga0105238_100847321 421
419 3300009553 Ga0105249_10003245 Ga0105249_100032452 421
420 3300009553 Ga0105249_10006757 Ga0105249_100067574 421
421 3300009553 Ga0105249_10047239 Ga0105249_100472393 421
422 3300009553 Ga0105249_10139141 Ga0105249_101391412 421
423 3300010375 Ga0105239_10147418 Ga0105239_101474182 421
424 3300013296 Ga0157374_10048822 Ga0157374_100488223 421
425 3300013296 Ga0157374_10060745 Ga0157374_100607452 421
426 3300013297 Ga0157378_10102262 Ga0157378_101022623 421
427 3300013297 Ga0157378_10205006 Ga0157378_102050061 421
428 3300013297 Ga0157378_10267236 Ga0157378_102672361 421
429 3300013306 Ga0163162_10000140 Ga0163162_1000014027 421
430 3300013306 Ga0163162_10009385 Ga0163162_100093859 421
431 3300013306 Ga0163162_10112283 Ga0163162_101122832 421
432 3300013306 Ga0163162_10117717 Ga0163162_101177172 421
433 3300013307 Ga0157372_10018325 Ga0157372_100183252 421
434 3300013308 Ga0157375_10154262 Ga0157375_101542622 421
435 3300013308 Ga0157375_10161077 Ga0157375_101610772 421
436 3300014326 Ga0157380_10013195 Ga0157380_100131953 421
437 3300014326 Ga0157380_10081207 Ga0157380_100812073 421
438 3300014968 Ga0157379_10121216 Ga0157379_101212162 421
439 3300017792 Ga0163161_10033293 Ga0163161_100332933 421
440 3300025321 Ga0207656_10003051 Ga0207656_100030515 421
441 3300025893 Ga0207682_10019689 Ga0207682_100196892 421
442 3300025903 Ga0207680_10000031 Ga0207680_1000003118 421
443 3300025908 Ga0207643_10011962 Ga0207643_100119624 421
444 3300025911 Ga0207654_10002706 Ga0207654_100027067 421
445 3300025911 Ga0207654_10007850 Ga0207654_100078502 421
446 3300025911 Ga0207654_10023653 Ga0207654_100236532 421
447 3300025911 Ga0207654_10123716 Ga0207654_101237162 421
448 3300025912 Ga0207707_10002565 Ga0207707_1000256510 421
449 3300025913 Ga0207695_10011387 Ga0207695_100113879 421
450 3300025913 Ga0207695_10090010 Ga0207695_100900101 421
451 3300025914 Ga0207671_10001908 Ga0207671_1000190816 421
452 3300025914 Ga0207671_10002014 Ga0207671_1000201415 421
453 3300025914 Ga0207671_10007673 Ga0207671_100076739 421
454 3300025914 Ga0207671_10150228 Ga0207671_101502282 421
455 3300025917 Ga0207660_10008582 Ga0207660_100085822 421
456 3300025918 Ga0207662_10043611 Ga0207662_100436112 421
457 3300025921 Ga0207652_10014719 Ga0207652_100147195 421
458 3300025923 Ga0207681_10024417 Ga0207681_100244172 421
459 3300025924 Ga0207694_10031636 Ga0207694_100316364 421
460 3300025924 Ga0207694_10112734 Ga0207694_101127342 421
461 3300025926 Ga0207659_10016338 Ga0207659_100163382 421
462 3300025926 Ga0207659_10249120 Ga0207659_102491201 421
463 3300025934 Ga0207686_10014112 Ga0207686_100141122 421
464 3300025936 Ga0207670_10005273 Ga0207670_100052733 421
465 3300025936 Ga0207670_10023522 Ga0207670_100235223 421
466 3300025940 Ga0207691_10101662 Ga0207691_101016622 421
467 3300025942 Ga0207689_10003365 Ga0207689_100033658 421
468 3300025949 Ga0207667_10005062 Ga0207667_100050627 421
469 3300025949 Ga0207667_10010151 Ga0207667_100101513 421
470 3300025949 Ga0207667_10023006 Ga0207667_100230062 421
471 3300025961 Ga0207712_10003064 Ga0207712_100030648 421
472 3300025961 Ga0207712_10003234 Ga0207712_100032346 421
473 3300025981 Ga0207640_10108851 Ga0207640_101088512 421
474 3300025981 Ga0207640_10166797 Ga0207640_101667972 421
475 3300026035 Ga0207703_10009965 Ga0207703_100099655 421
476 3300026075 Ga0207708_10094803 Ga0207708_100948032 421
477 3300026078 Ga0207702_10031068 Ga0207702_100310682 421
478 3300026088 Ga0207641_10000048 Ga0207641_10000048112 421
479 3300026088 Ga0207641_10027604 Ga0207641_100276042 421
480 3300026089 Ga0207648_10046869 Ga0207648_100468693 421
481 3300026095 Ga0207676_10013618 Ga0207676_100136183 421
482 3300026116 Ga0207674_10000487 Ga0207674_1000048747 421
483 3300026118 Ga0207675_100018877 Ga0207675_1000188776 421
484 3300026118 Ga0207675_100045784 Ga0207675_1000457842 421
485 3300026142 Ga0207698_10007703 Ga0207698_100077037 421
486 3300028379 Ga0268266_10000088 Ga0268266_10000088114 421
487 3300028381 Ga0268264_10000201 Ga0268264_1000020163 421
488 3300028381 Ga0268264_10006728 Ga0268264_100067285 421
489 3300028563 Ga0265319_1003241 Ga0265319_10032414 421
490 3300028573 Ga0265334_10000602 Ga0265334_1000060213 421
491 3300028577 Ga0265318_10002173 Ga0265318_100021738 421
492 3300028666 Ga0265336_10000991 Ga0265336_100009917 421
493 3300028666 Ga0265336_10012918 Ga0265336_100129181 421
494 3300028800 Ga0265338_10003310 Ga0265338_100033104 421
495 3300031240 Ga0265320_10007117 Ga0265320_100071176 421
496 3300031247 Ga0265340_10014462 Ga0265340_100144623 421
497 3300031251 Ga0265327_10003723 Ga0265327_100037232 421
498 3300031251 Ga0265327_10014414 Ga0265327_100144143 421
499 3300031344 Ga0265316_10037463 Ga0265316_100374633 421
500 3300031344 Ga0265316_10149644 Ga0265316_101496441 421
501 3300031595 Ga0265313_10054808 Ga0265313_100548081 421
502 3300031730 Ga0307516_10003131 Ga0307516_1000313113 421
503 3300031730 Ga0307516_10021590 Ga0307516_100215904 421
504 3300037471 Ga0395905_0054490 Ga0395905_0054490_1111_2397 421
505 3300039437 Ga0436365_1837098 Ga0436365_1837098_14654_15952 421
506 3300044656 Ga0466969_0000556 Ga0466969_0000556_18235_19563 421
507 3300044658 Ga0466972_0013257 Ga0466972_0013257_1643_2914 421
508 3300044684 Ga0466966_0000393 Ga0466966_0000393_2189_3517 421
509 3300044712 Ga0453684_0051097 Ga0453684_0051097_1175_2467 421
510 3300044842 Ga0466957_0029344 Ga0466957_0029344_1490_2818 421
511 3300045049 Ga0466959_0000083 Ga0466959_0000083_2186_3514 421
512 3300045051 Ga0451576_0000739 Ga0451576_0000739_32562_33860 421
513 3300046524 Ga0495648_0015330 Ga0495648_0015330_1404_2675 421
514 3300046539 Ga0495621_0032213 Ga0495621_0032213_34_1311 421
515 3300046648 Ga0495611_0018429 Ga0495611_0018429_1201_2472 421
516 3300047443 Ga0495687_000010 Ga0495687_000010_382248_383519 421
517 3300049579 Ga0501043_0110255 Ga0501043_0110255_546_1874 421
518 3300049581 Ga0501047_0021592 Ga0501047_0021592_146_1474 421
519 3300050507 nmdc:mga05p37_89356_c1 nmdc:mga05p37_89356_c1_1137_2411 421
520 3300050508 nmdc:mga09592_17647_c1 nmdc:mga09592_17647_c1_365_1639 421
521 3300050510 nmdc:mga06r32_268875_c1 nmdc:mga06r32_268875_c1_267_1541 421
522 3300050511 nmdc:mga08y16_154716_c1 nmdc:mga08y16_154716_c1_346_1614 421
523 3300053092 Ga0500583_0029101 Ga0500583_0029101_543_1814 421
524 3300053156 Ga0500622_0002993 Ga0500622_0002993_3790_5061 421
525 3300053177 Ga0500636_0085756 Ga0500636_0085756_172_1497 421

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

65

426

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c3i-assembly1.cif.gz_A crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.8854 20 419
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.8846 15 419
6c3i-assembly1.cif.gz_A crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.8747 20 419
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.8703 15 419
8e6n-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state 0.8668 14 417
ID Description Score Start End Superfamily
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8932 35 394 1.20.1740.10
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.886 35 394 1.20.1740.10
af_Q2QN30_93_531_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8811 21 420 1.20.1740.10
af_Q553K4_170_526_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8699 35 394 1.20.1740.10
af_Q8I3M7_238_670_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8696 21 420 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2R7JY88-F1-model_v4 Iron transporter 0.9875 9 389 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A536EP44-F1-model_v4 Divalent metal cation transporter 0.9832 9 420 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A521AXZ4-F1-model_v4 NRAMP (Natural resistance-associated macrophage protein) metal ion transporters 0.9794 11 417 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A7V5G9S2-F1-model_v4 Divalent metal cation transporter 0.9771 11 419 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A1G1WXR2-F1-model_v4 Iron transporter 0.9743 18 421 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755

Feature Viewer

pLDDT pTM Quality
90.76 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map