F459198

General Info

Members Datasets Scaffolds Average Seq Length
524 276 1048 267

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0055642|Ga0501039_0055642_1031_1804
Length 257
Sequence MEDFFELAGRRYRSRLIVGTGKYKDFDETKRAIEISGAEIVTVAVRRVNITDPQKENLLDYLDPKKYTILPNTAGCYNAEDAVRTCRLAREAGVGKLVKLEVIGDDRTLFPDLPATLEAAKTLVKEGFVVLPYITDDPITAKKLEEIGCAAVMPLAAPIGSGLGIRNPYNIRIILEQAKVPVIVDAGVGTASDAAVAMELGCAGVLMNTAIASAKNPILMAEAMRQAVEAGRKAYLAGRIPRKLYATASSPLDGLVG

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
269 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
270 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
271 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
272 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
273 2952252522 Salinicola sp. DM10 Isolate Unclassified
274 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
275 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
276 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0.38
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 1.34
Rhizosphere 95.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0055642 3300049575 Bacteria 3065
2 Ga0070658_10007380 3300005327 Bacteria 8883
3 Ga0070658_10009438 3300005327 Bacteria 7841
4 Ga0070658_10607772 3300005327 Bacteria 948
5 Ga0070683_100019937 3300005329 Bacteria 5961
6 Ga0070683_100184434 3300005329 Bacteria 1981
7 Ga0070683_100189819 3300005329 Bacteria 1951
8 Ga0070690_100081875 3300005330 Bacteria 2113
9 Ga0070690_100405668 3300005330 Bacteria 1002
10 Ga0070670_100012490 3300005331 Bacteria 7270
11 Ga0070670_100016776 3300005331 Bacteria 6284
12 Ga0070677_10012255 3300005333 Bacteria 2975
13 Ga0070680_100283272 3300005336 Bacteria 1404
14 Ga0070682_100069629 3300005337 Bacteria 2247
15 Ga0068868_100119472 3300005338 Bacteria 2149
16 Ga0068868_100613866 3300005338 Bacteria 965
17 Ga0070660_100068133 3300005339 Bacteria 2773
18 Ga0070660_100077800 3300005339 Bacteria 2600
19 Ga0070660_100087144 3300005339 Bacteria 2457
20 Ga0070660_100179698 3300005339 Bacteria 1712
21 Ga0070660_100200862 3300005339 Bacteria 1617
22 Ga0070660_100557137 3300005339 Bacteria 956
23 Ga0070689_100001950 3300005340 Bacteria 13372
24 Ga0070689_100005705 3300005340 Bacteria 8531
25 Ga0070689_100054879 3300005340 Bacteria 3085
26 Ga0070661_100112782 3300005344 Bacteria 2031
27 Ga0070661_100130602 3300005344 Bacteria 1886
28 Ga0070692_10075772 3300005345 Bacteria 1802
29 Ga0070668_100004001 3300005347 Bacteria 10908
30 Ga0070669_100010145 3300005353 Bacteria 6697
31 Ga0070669_100049033 3300005353 Bacteria 3083
32 Ga0070669_100069919 3300005353 Bacteria 2594
33 Ga0070675_100010664 3300005354 Bacteria 7184
34 Ga0070675_100106210 3300005354 Bacteria 2370
35 Ga0070675_100161627 3300005354 Bacteria 1926
36 Ga0070675_100178699 3300005354 Bacteria 1834
37 Ga0070675_100269635 3300005354 Bacteria 1493
38 Ga0070671_100010540 3300005355 Bacteria 7421
39 Ga0070674_100012633 3300005356 Bacteria 5190
40 Ga0070674_100366670 3300005356 Bacteria 1168
41 Ga0070673_100096884 3300005364 Bacteria 2421
42 Ga0070673_100100933 3300005364 Bacteria 2377
43 Ga0070673_100111690 3300005364 Bacteria 2268
44 Ga0070688_100005713 3300005365 Bacteria 6576
45 Ga0070688_100118064 3300005365 Bacteria 1773
46 Ga0070688_100456304 3300005365 Bacteria 956
47 Ga0070659_100004323 3300005366 Bacteria 10143
48 Ga0070659_100004965 3300005366 Bacteria 9518
49 Ga0070667_100035968 3300005367 Bacteria 4150
50 Ga0070709_10004582 3300005434 Bacteria 7463
51 Ga0070709_10013676 3300005434 Bacteria 4569
52 Ga0070714_100040090 3300005435 Bacteria 3947
53 Ga0070714_100137807 3300005435 Bacteria 2187
54 Ga0070713_100011202 3300005436 Bacteria 6521
55 Ga0070713_100031238 3300005436 Bacteria 4240
56 Ga0070710_10008882 3300005437 Bacteria 4904
57 Ga0070701_10036528 3300005438 Bacteria 2476
58 Ga0070711_100034028 3300005439 Bacteria 3397
59 Ga0070705_100041816 3300005440 Bacteria 2616
60 Ga0070700_100023821 3300005441 Bacteria 3586
61 Ga0070694_100306460 3300005444 Bacteria 1218
62 Ga0070663_100104967 3300005455 Bacteria 2114
63 Ga0070678_100016710 3300005456 Bacteria 4702
64 Ga0070678_100378788 3300005456 Bacteria 1224
65 Ga0070662_100001880 3300005457 Bacteria 12868
66 Ga0070662_100085316 3300005457 Bacteria 2360
67 Ga0070681_10037220 3300005458 Bacteria 4884
68 Ga0070681_10308165 3300005458 Bacteria 1493
69 Ga0068867_100007361 3300005459 Bacteria 7788
70 Ga0068867_100056886 3300005459 Bacteria 2895
71 Ga0068867_100058740 3300005459 Bacteria 2850
72 Ga0068867_100242395 3300005459 Bacteria 1462
73 Ga0070685_10167872 3300005466 Bacteria 1404
74 Ga0070699_100034854 3300005518 Bacteria 4349
75 Ga0070679_100020518 3300005530 Bacteria 6444
76 Ga0070679_100041050 3300005530 Bacteria 4606
77 Ga0070679_100185052 3300005530 Bacteria 2054
78 Ga0070684_100026837 3300005535 Bacteria 4855
79 Ga0068853_100014932 3300005539 Bacteria 6379
80 Ga0068853_100049157 3300005539 Bacteria 3623
81 Ga0070672_100000860 3300005543 Bacteria 18160
82 Ga0070672_100005701 3300005543 Bacteria 8295
83 Ga0070672_100086597 3300005543 Bacteria 2519
84 Ga0070672_100187895 3300005543 Bacteria 1724
85 Ga0070696_100002856 3300005546 Bacteria 11493
86 Ga0070696_100115395 3300005546 Bacteria 1938
87 Ga0070693_100000747 3300005547 Bacteria 14361
88 Ga0070693_100083401 3300005547 Bacteria 1910
89 Ga0070665_100053355 3300005548 Bacteria 4054
90 Ga0070665_100707908 3300005548 Bacteria 1020
91 Ga0070704_100114412 3300005549 Bacteria 2059
92 Ga0068855_100000418 3300005563 Bacteria 52788
93 Ga0068855_100016121 3300005563 Bacteria 8985
94 Ga0068855_100159760 3300005563 Bacteria 2559
95 Ga0068855_100177856 3300005563 Bacteria 2406
96 Ga0070664_100028480 3300005564 Bacteria 4647
97 Ga0070664_100087103 3300005564 Bacteria 2699
98 Ga0068857_100071884 3300005577 Bacteria 3083
99 Ga0068857_100197243 3300005577 Bacteria 1834
100 Ga0068854_100043773 3300005578 Bacteria 3175
101 Ga0068854_100332628 3300005578 Bacteria 1238
102 Ga0068856_100004275 3300005614 Bacteria 14256
103 Ga0068856_100047581 3300005614 Bacteria 4225
104 Ga0068856_100057190 3300005614 Bacteria 3850
105 Ga0068856_100085308 3300005614 Bacteria 3137
106 Ga0068856_100140272 3300005614 Bacteria 2424
107 Ga0070702_100088210 3300005615 Bacteria 1875
108 Ga0068852_100000254 3300005616 Bacteria 36057
109 Ga0068852_100013979 3300005616 Bacteria 6158
110 Ga0068852_100032942 3300005616 Bacteria 4297
111 Ga0068852_100066170 3300005616 Bacteria 3155
112 Ga0068859_100061781 3300005617 Bacteria 3775
113 Ga0068859_100119831 3300005617 Bacteria 2698
114 Ga0068859_100328794 3300005617 Bacteria 1623
115 Ga0068864_100025255 3300005618 Bacteria 5002
116 Ga0068864_100032108 3300005618 Bacteria 4459
117 Ga0068864_100626521 3300005618 Bacteria 1046
118 Ga0068861_100252827 3300005719 Bacteria 1505
119 Ga0068861_100447743 3300005719 Bacteria 1156
120 Ga0068851_10000830 3300005834 Bacteria 13340
121 Ga0068851_10004492 3300005834 Bacteria 6294
122 Ga0068870_10253881 3300005840 Bacteria 1091
123 Ga0068863_100059510 3300005841 Bacteria 3613
124 Ga0068858_100007962 3300005842 Bacteria 10212
125 Ga0068858_100009008 3300005842 Bacteria 9548
126 Ga0068858_100017308 3300005842 Bacteria 6761
127 Ga0068858_100120771 3300005842 Bacteria 2450
128 Ga0068860_100013958 3300005843 Bacteria 7875
129 Ga0068860_100148684 3300005843 Bacteria 2255
130 Ga0068860_100229020 3300005843 Bacteria 1806
131 Ga0068860_100440102 3300005843 Bacteria 1295
132 Ga0068862_100134585 3300005844 Bacteria 2189
133 Ga0068862_100162184 3300005844 Bacteria 1996
134 Ga0075364_10031006 3300006051 Bacteria 3434
135 Ga0075364_10114788 3300006051 Bacteria 1800
136 Ga0070716_100030298 3300006173 Bacteria 2934
137 Ga0075366_10000934 3300006195 Bacteria 14194
138 Ga0075366_10183937 3300006195 Bacteria 1269
139 Ga0097621_100003672 3300006237 Bacteria 10610
140 Ga0097621_100018014 3300006237 Bacteria 5382
141 Ga0097621_100054399 3300006237 Bacteria 3264
142 Ga0068871_100011321 3300006358 Bacteria 6539
143 Ga0068871_100019012 3300006358 Bacteria 5237
144 Ga0068871_100081674 3300006358 Bacteria 2678
145 Ga0068871_100176034 3300006358 Bacteria 1837
146 Ga0075428_100022378 3300006844 Bacteria 6998
147 Ga0075434_100167549 3300006871 Bacteria 2217
148 Ga0075434_100211639 3300006871 Bacteria 1959
149 Ga0075436_100029890 3300006914 Bacteria 3748
150 Ga0075436_100037993 3300006914 Bacteria 3324
151 Ga0075436_100052951 3300006914 Bacteria 2802
152 Ga0075436_100218511 3300006914 Bacteria 1352
153 Ga0097620_100061784 3300006931 Bacteria 3775
154 Ga0097620_100119830 3300006931 Bacteria 2698
155 Ga0097620_100328773 3300006931 Bacteria 1623
156 Ga0105240_10002504 3300009093 Bacteria 29518
157 Ga0105240_10036399 3300009093 Bacteria 6332
158 Ga0105240_10048096 3300009093 Bacteria 5393
159 Ga0105240_10052746 3300009093 Bacteria 5110
160 Ga0105240_10282265 3300009093 Bacteria 1907
161 Ga0105240_10356250 3300009093 Bacteria 1659
162 Ga0105240_10596017 3300009093 Bacteria 1217
163 Ga0111539_10001826 3300009094 Bacteria 28335
164 Ga0111539_10200376 3300009094 Bacteria 2328
165 Ga0105245_10039399 3300009098 Bacteria 4206
166 Ga0105245_10103350 3300009098 Bacteria 2640
167 Ga0105245_10155306 3300009098 Bacteria 2167
168 Ga0105243_10038106 3300009148 Bacteria 3742
169 Ga0105243_10159554 3300009148 Bacteria 1943
170 Ga0105243_10174696 3300009148 Bacteria 1863
171 Ga0105241_10001727 3300009174 Bacteria 16585
172 Ga0105242_10002431 3300009176 Bacteria 14628
173 Ga0105242_10036975 3300009176 Bacteria 3920
174 Ga0105242_10089890 3300009176 Bacteria 2582
175 Ga0105242_10129661 3300009176 Bacteria 2175
176 Ga0105242_10193679 3300009176 Bacteria 1801
177 Ga0105242_10236699 3300009176 Bacteria 1639
178 Ga0105248_10005709 3300009177 Bacteria 13664
179 Ga0105248_10017520 3300009177 Bacteria 7899
180 Ga0105248_10019911 3300009177 Bacteria 7428
181 Ga0105248_10101699 3300009177 Bacteria 3239
182 Ga0105248_10165486 3300009177 Bacteria 2493
183 Ga0105237_10004560 3300009545 Bacteria 15996
184 Ga0105249_10071194 3300009553 Bacteria 3212
185 Ga0157373_10013145 3300013100 Bacteria 6078
186 Ga0157373_10049269 3300013100 Bacteria 3002
187 Ga0157373_10212207 3300013100 Bacteria 1365
188 Ga0157371_10000354 3300013102 Bacteria 58515
189 Ga0157371_10148332 3300013102 Bacteria 1672
190 Ga0157370_10024332 3300013104 Bacteria 5996
191 Ga0157370_10027571 3300013104 Bacteria 5600
192 Ga0157370_10034802 3300013104 Bacteria 4901
193 Ga0157370_10115545 3300013104 Bacteria 2507
194 Ga0157370_10179267 3300013104 Bacteria 1969
195 Ga0157370_10673779 3300013104 Bacteria 945
196 Ga0157369_10036870 3300013105 Bacteria 5355
197 Ga0157369_10061430 3300013105 Bacteria 4051
198 Ga0157369_10087528 3300013105 Bacteria 3326
199 Ga0157374_10094314 3300013296 Bacteria 2860
200 Ga0157378_10005184 3300013297 Bacteria 11446
201 Ga0157378_10112242 3300013297 Bacteria 2500
202 Ga0157378_10224209 3300013297 Bacteria 1788
203 Ga0163162_10111136 3300013306 Bacteria 2838
204 Ga0157372_10002030 3300013307 Bacteria 22017
205 Ga0157372_10053683 3300013307 Bacteria 4493
206 Ga0157372_10118651 3300013307 Bacteria 3036
207 Ga0157372_10128366 3300013307 Bacteria 2916
208 Ga0157372_10199414 3300013307 Bacteria 2318
209 Ga0157372_11135612 3300013307 Bacteria 904
210 Ga0157375_10007571 3300013308 Bacteria 9495
211 Ga0157375_10060080 3300013308 Bacteria 3768
212 Ga0157375_10237056 3300013308 Bacteria 1984
213 Ga0163163_10023637 3300014325 Bacteria 5835
214 Ga0157380_10028816 3300014326 Bacteria 4238
215 Ga0157380_10051914 3300014326 Bacteria 3245
216 Ga0157380_10158383 3300014326 Bacteria 1965
217 Ga0157379_10023156 3300014968 Bacteria 5508
218 Ga0157379_10097787 3300014968 Bacteria 2635
219 Ga0157379_10113954 3300014968 Bacteria 2430
220 Ga0157376_10072644 3300014969 Bacteria 2927
221 Ga0157376_10205996 3300014969 Bacteria 1813
222 Ga0163161_10108004 3300017792 Bacteria 2077
223 Ga0163161_10144618 3300017792 Bacteria 1803
224 Ga0206356_11402804 3300020070 Bacteria 2770
225 Ga0206353_11565639 3300020082 Bacteria 2159
226 Ga0213872_10003475 3300021361 Bacteria 8735
227 Ga0213876_10024046 3300021384 Bacteria 3218
228 Ga0207656_10006761 3300025321 Bacteria 4144
229 Ga0207688_10045194 3300025901 Bacteria 2456
230 Ga0207680_10034341 3300025903 Bacteria 2901
231 Ga0207699_10037753 3300025906 Bacteria 2763
232 Ga0207699_10177003 3300025906 Bacteria 1431
233 Ga0207643_10007379 3300025908 Bacteria 5898
234 Ga0207643_10062838 3300025908 Bacteria 2122
235 Ga0207705_10001459 3300025909 Bacteria 18852
236 Ga0207705_10229024 3300025909 Bacteria 1413
237 Ga0207705_10414328 3300025909 Bacteria 1043
238 Ga0207705_10448771 3300025909 Bacteria 1000
239 Ga0207654_10015074 3300025911 Bacteria 4003
240 Ga0207654_10116486 3300025911 Bacteria 1671
241 Ga0207707_10012839 3300025912 Bacteria 7287
242 Ga0207695_10001050 3300025913 Bacteria 48496
243 Ga0207695_10033280 3300025913 Bacteria 5625
244 Ga0207695_10196254 3300025913 Bacteria 1934
245 Ga0207695_10306100 3300025913 Bacteria 1480
246 Ga0207695_10428114 3300025913 Bacteria 1207
247 Ga0207671_10084701 3300025914 Bacteria 2381
248 Ga0207693_10335753 3300025915 Bacteria 1183
249 Ga0207693_10506789 3300025915 Bacteria 942
250 Ga0207663_10027865 3300025916 Bacteria 3299
251 Ga0207663_10048040 3300025916 Bacteria 2639
252 Ga0207663_10146787 3300025916 Bacteria 1650
253 Ga0207660_10015328 3300025917 Bacteria 5057
254 Ga0207657_10000428 3300025919 Bacteria 44668
255 Ga0207657_10019239 3300025919 Bacteria 6489
256 Ga0207657_10035439 3300025919 Bacteria 4475
257 Ga0207649_10007354 3300025920 Bacteria 5992
258 Ga0207649_10048826 3300025920 Bacteria 2611
259 Ga0207652_10007031 3300025921 Bacteria 9069
260 Ga0207652_10026070 3300025921 Bacteria 4865
261 Ga0207652_10190048 3300025921 Bacteria 1847
262 Ga0207681_10053249 3300025923 Bacteria 2747
263 Ga0207681_10272679 3300025923 Bacteria 1329
264 Ga0207694_10005761 3300025924 Bacteria 9493
265 Ga0207694_10191840 3300025924 Bacteria 1660
266 Ga0207650_10009894 3300025925 Bacteria 6524
267 Ga0207650_10089035 3300025925 Bacteria 2355
268 Ga0207659_10016137 3300025926 Bacteria 4855
269 Ga0207659_10053235 3300025926 Bacteria 2886
270 Ga0207659_10065806 3300025926 Bacteria 2628
271 Ga0207687_10032368 3300025927 Bacteria 3541
272 Ga0207687_10272155 3300025927 Bacteria 1354
273 Ga0207700_10171468 3300025928 Bacteria 1810
274 Ga0207700_10172686 3300025928 Bacteria 1804
275 Ga0207700_10260672 3300025928 Bacteria 1484
276 Ga0207664_10032642 3300025929 Bacteria 3993
277 Ga0207664_10222271 3300025929 Bacteria 1638
278 Ga0207644_10014186 3300025931 Bacteria 5330
279 Ga0207644_10016074 3300025931 Bacteria 5032
280 Ga0207690_10001844 3300025932 Bacteria 13018
281 Ga0207706_10000024 3300025933 Bacteria 151942
282 Ga0207706_10109453 3300025933 Bacteria 2431
283 Ga0207686_10019749 3300025934 Bacteria 3839
284 Ga0207686_10089869 3300025934 Bacteria 2025
285 Ga0207686_10312991 3300025934 Bacteria 1170
286 Ga0207686_10329350 3300025934 Bacteria 1144
287 Ga0207709_10079405 3300025935 Bacteria 2110
288 Ga0207669_10370008 3300025937 Bacteria 1113
289 Ga0207665_10005306 3300025939 Bacteria 8614
290 Ga0207691_10000876 3300025940 Bacteria 29932
291 Ga0207691_10004670 3300025940 Bacteria 13260
292 Ga0207691_10031605 3300025940 Bacteria 4939
293 Ga0207691_10084863 3300025940 Bacteria 2842
294 Ga0207711_10019200 3300025941 Bacteria 5691
295 Ga0207711_10099362 3300025941 Bacteria 2572
296 Ga0207711_10102759 3300025941 Bacteria 2530
297 Ga0207711_10447229 3300025941 Bacteria 1203
298 Ga0207689_10033743 3300025942 Bacteria 4252
299 Ga0207689_10077288 3300025942 Bacteria 2736
300 Ga0207689_10504736 3300025942 Bacteria 1013
301 Ga0207661_10057074 3300025944 Bacteria 3138
302 Ga0207679_10003137 3300025945 Bacteria 10209
303 Ga0207679_10136141 3300025945 Bacteria 1978
304 Ga0207667_10001359 3300025949 Bacteria 30727
305 Ga0207667_10001633 3300025949 Bacteria 28242
306 Ga0207667_10004089 3300025949 Bacteria 17920
307 Ga0207667_10018131 3300025949 Bacteria 7902
308 Ga0207667_10080511 3300025949 Bacteria 3375
309 Ga0207667_10096004 3300025949 Bacteria 3059
310 Ga0207651_10001706 3300025960 Bacteria 10141
311 Ga0207651_10101911 3300025960 Bacteria 2132
312 Ga0207651_10118347 3300025960 Bacteria 2004
313 Ga0207651_10423437 3300025960 Bacteria 1137
314 Ga0207712_10436059 3300025961 Bacteria 1108
315 Ga0207668_10015145 3300025972 Bacteria 4787
316 Ga0207640_10073606 3300025981 Bacteria 2309
317 Ga0207640_10263449 3300025981 Bacteria 1344
318 Ga0207658_10026937 3300025986 Bacteria 4035
319 Ga0207658_10066826 3300025986 Bacteria 2706
320 Ga0207677_10571995 3300026023 Bacteria 988
321 Ga0207703_10006202 3300026035 Bacteria 9565
322 Ga0207703_10152070 3300026035 Bacteria 2019
323 Ga0207639_10004954 3300026041 Bacteria 8969
324 Ga0207639_10011402 3300026041 Bacteria 6174
325 Ga0207678_10003094 3300026067 Bacteria 15059
326 Ga0207678_10014760 3300026067 Bacteria 6875
327 Ga0207708_10041652 3300026075 Bacteria 3501
328 Ga0207702_10003126 3300026078 Bacteria 15354
329 Ga0207702_10207133 3300026078 Bacteria 1821
330 Ga0207702_10427967 3300026078 Bacteria 1281
331 Ga0207641_10204629 3300026088 Bacteria 1822
332 Ga0207641_10207478 3300026088 Bacteria 1810
333 Ga0207648_10031300 3300026089 Bacteria 4704
334 Ga0207648_10069918 3300026089 Bacteria 3060
335 Ga0207648_10150472 3300026089 Bacteria 2054
336 Ga0207676_10412065 3300026095 Bacteria 1265
337 Ga0207674_10001026 3300026116 Bacteria 36426
338 Ga0207674_10005717 3300026116 Bacteria 14740
339 Ga0207674_10206112 3300026116 Bacteria 1915
340 Ga0207674_10444416 3300026116 Bacteria 1253
341 Ga0207675_100073638 3300026118 Bacteria 3196
342 Ga0207675_100086847 3300026118 Bacteria 2937
343 Ga0207675_100104959 3300026118 Bacteria 2663
344 Ga0207675_100167714 3300026118 Bacteria 2097
345 Ga0207683_10003736 3300026121 Bacteria 13208
346 Ga0207683_10297947 3300026121 Bacteria 1475
347 Ga0207683_10535934 3300026121 Bacteria 1082
348 Ga0207683_10594213 3300026121 Bacteria 1024
349 Ga0207698_10008769 3300026142 Bacteria 6414
350 Ga0207698_10012510 3300026142 Bacteria 5557
351 Ga0207698_10029084 3300026142 Bacteria 3952
352 Ga0207698_10059441 3300026142 Bacteria 2968
353 Ga0207698_10078433 3300026142 Bacteria 2652
354 Ga0207698_10647205 3300026142 Bacteria 1047
355 Ga0268266_10051474 3300028379 Bacteria 3535
356 Ga0268266_10719172 3300028379 Bacteria 963
357 Ga0268265_10108471 3300028380 Bacteria 2260
358 Ga0268264_10032152 3300028381 Bacteria 4305
359 Ga0268264_10275745 3300028381 Bacteria 1573
360 Ga0307509_10000138 3300031507 Bacteria 108694
361 Ga0307408_100087478 3300031548 Bacteria 2345
362 Ga0307405_10002652 3300031731 Bacteria 7960
363 Ga0307413_10007026 3300031824 Bacteria 5190
364 Ga0307413_10280184 3300031824 Bacteria 1254
365 Ga0307410_10002378 3300031852 Bacteria 9069
366 Ga0307406_10066577 3300031901 Bacteria 2345
367 Ga0307406_10474448 3300031901 Bacteria 1009
368 Ga0307407_10019183 3300031903 Bacteria 3477
369 Ga0307412_10141973 3300031911 Bacteria 1760
370 Ga0307409_100005180 3300031995 Bacteria 7454
371 Ga0307416_100001305 3300032002 Bacteria 13447
372 Ga0307416_100170125 3300032002 Bacteria 2027
373 Ga0307416_100232068 3300032002 Bacteria 1780
374 Ga0307416_100278564 3300032002 Bacteria 1647
375 Ga0307416_100284343 3300032002 Bacteria 1633
376 Ga0307411_10000855 3300032005 Bacteria 11440
377 Ga0307415_100228610 3300032126 Bacteria 1496
378 Ga0373934_0001824 3300035086 Bacteria 7831
379 Ga0373923_0014494 3300035111 Bacteria 2962
380 Ga0373954_0066521 3300035118 Bacteria 1706
381 Ga0373954_0067668 3300035118 Bacteria 1693
382 Ga0373956_0005355 3300035119 Bacteria 5134
383 Ga0373957_0054846 3300035120 Bacteria 1531
384 Ga0373955_0333415 3300035172 Bacteria 917
385 Ga0373961_0056127 3300035241 Bacteria 1182
386 Ga0373924_0009169 3300035410 Bacteria 3620
387 Ga0373927_0141465 3300035695 Bacteria 1574
388 Ga0373933_0019139 3300035724 Bacteria 3862
389 Ga0373933_0019580 3300035724 Bacteria 3824
390 Ga0373933_0293188 3300035724 Bacteria 1052
391 Ga0373933_0429787 3300035724 Bacteria 863
392 Ga0373937_0010448 3300036401 Bacteria 8105
393 Ga0373937_0243104 3300036401 Bacteria 1696
394 Ga0373925_0028637 3300037068 Bacteria 4081
395 Ga0395900_0033287 3300037418 Bacteria 5306
396 Ga0395900_0196368 3300037418 Bacteria 2044
397 Ga0395898_0079328 3300037466 Bacteria 3167
398 Ga0395898_0251025 3300037466 Bacteria 1687
399 Ga0395905_0041864 3300037471 Bacteria 4299
400 Ga0395901_0008138 3300038443 Bacteria 10591
401 Ga0395901_0673350 3300038443 Bacteria 1035
402 Ga0436365_0533020 3300039437 Bacteria 1216
403 Ga0436365_0632282 3300039437 Bacteria 3440
404 Ga0436361_0763525 3300039447 Bacteria 48860
405 Ga0451577_0469349 3300042876 Bacteria 1143
406 Ga0451577_0686218 3300042876 Bacteria 928
407 Ga0466969_0008765 3300044656 Bacteria 5361
408 Ga0466966_0096738 3300044684 Bacteria 1828
409 Ga0466961_0000358 3300044693 Bacteria 29816
410 Ga0453684_0001904 3300044712 Bacteria 54155
411 Ga0466959_0030735 3300045049 Bacteria 3976
412 Ga0495629_0356237 3300046459 Bacteria 998
413 Ga0495651_0017271 3300046462 Bacteria 5589
414 Ga0495653_0023970 3300046463 Bacteria 4923
415 Ga0495650_0000133 3300046471 Bacteria 173878
416 Ga0495662_0015763 3300046476 Bacteria 3668
417 Ga0495664_0063287 3300046477 Bacteria 2204
418 Ga0495584_0021171 3300046491 Bacteria 3302
419 Ga0495585_0026788 3300046492 Bacteria 3291
420 Ga0495616_0087047 3300046513 Bacteria 1485
421 Ga0495620_0020695 3300046515 Bacteria 3209
422 Ga0495628_0142284 3300046516 Bacteria 1830
423 Ga0495630_0056541 3300046517 Bacteria 2939
424 Ga0495631_0017610 3300046518 Bacteria 3376
425 Ga0495666_0108140 3300046526 Bacteria 1307
426 Ga0495652_0132284 3300046529 Bacteria 1973
427 Ga0495640_0094045 3300046533 Bacteria 1974
428 Ga0495621_0005816 3300046539 Bacteria 3566
429 Ga0495621_0093462 3300046539 Bacteria 1136
430 Ga0495597_0001089 3300046542 Bacteria 20605
431 Ga0495645_0028054 3300046543 Bacteria 4090
432 Ga0495633_0004979 3300046558 Bacteria 8288
433 Ga0495634_0180745 3300046642 Bacteria 1320
434 Ga0495661_0000549 3300046665 Bacteria 38859
435 Ga0495657_0046559 3300046675 Bacteria 2935
436 Ga0495657_0199187 3300046675 Bacteria 1221
437 Ga0495624_0108340 3300046690 Bacteria 1709
438 Ga0495670_0074459 3300046691 Bacteria 1722
439 Ga0495589_0000310 3300046794 Bacteria 38833
440 Ga0495600_0066385 3300046809 Bacteria 2358
441 Ga0495604_0251676 3300047317 Bacteria 1204
442 Ga0495636_0030387 3300047318 Bacteria 2209
443 Ga0495674_0009158 3300047319 Bacteria 9409
444 Ga0495680_0175018 3300047322 Bacteria 1552
445 Ga0495681_0026059 3300047470 Bacteria 3053
446 Ga0496101_0037284 3300048904 Bacteria 3448
447 Ga0496102_0004418 3300048905 Bacteria 11875
448 Ga0496103_0229730 3300048906 Bacteria 1193
449 Ga0496104_0013030 3300048907 Bacteria 7488
450 Ga0496106_0000802 3300048909 Bacteria 22754
451 Ga0496109_0089946 3300048912 Bacteria 2839
452 Ga0496110_0039597 3300048913 Bacteria 4105
453 Ga0495678_038682 3300049459 Bacteria 1928
454 Ga0501031_0009359 3300049568 Bacteria 6367
455 Ga0501031_0230040 3300049568 Bacteria 1206
456 Ga0501032_0005180 3300049569 Bacteria 9715
457 Ga0501033_0011376 3300049570 Bacteria 6809
458 Ga0501034_0034384 3300049571 Bacteria 5137
459 Ga0501034_0479307 3300049571 Bacteria 1159
460 Ga0501036_0000051 3300049572 Bacteria 75057
461 Ga0501036_0036217 3300049572 Bacteria 4175
462 Ga0501037_0001916 3300049573 Bacteria 15094
463 Ga0501038_0001036 3300049574 Bacteria 25087
464 Ga0501038_0022187 3300049574 Bacteria 5689
465 Ga0501039_0004806 3300049575 Bacteria 10229
466 Ga0501039_0005801 3300049575 Bacteria 9348
467 Ga0501039_0039547 3300049575 Bacteria 3642
468 Ga0501040_0107326 3300049576 Bacteria 1951
469 Ga0501041_0001413 3300049577 Bacteria 13244
470 Ga0501041_0192574 3300049577 Bacteria 1277
471 Ga0501043_0008396 3300049579 Bacteria 8133
472 Ga0501046_0000415 3300049580 Bacteria 42538
473 Ga0501046_0031922 3300049580 Bacteria 4267
474 Ga0501047_0004291 3300049581 Bacteria 13417
475 Ga0501047_0470957 3300049581 Bacteria 1084
476 Ga0501068_0045446 3300049584 Bacteria 2646
477 Ga0501069_0006817 3300049585 Bacteria 5974
478 Ga0501070_0035078 3300049586 Bacteria 4192
479 Ga0501072_0019057 3300049588 Bacteria 5299
480 Ga0501072_0050074 3300049588 Bacteria 3289
481 Ga0501073_0054596 3300049589 Bacteria 2796
482 Ga0501074_0002417 3300049590 Bacteria 13010
483 Ga0501075_0015197 3300049591 Bacteria 5521
484 Ga0501075_0025463 3300049591 Bacteria 4346
485 Ga0501076_0030814 3300049592 Bacteria 4179
486 Ga0501077_0041465 3300049593 Bacteria 2930
487 Ga0501077_0111844 3300049593 Bacteria 1731
488 Ga0501079_0006616 3300049741 Bacteria 8721
489 Ga0501079_0006681 3300049741 Bacteria 8677
490 Ga0501080_0029059 3300049742 Bacteria 5146
491 Ga0501080_0061064 3300049742 Bacteria 3509
492 Ga0501080_0133633 3300049742 Bacteria 2296
493 Ga0501081_0000156 3300049743 Bacteria 31286
494 Ga0501081_0001665 3300049743 Bacteria 13744
495 Ga0501083_0025829 3300049744 Bacteria 4065
496 Ga0501083_0095667 3300049744 Bacteria 1960
497 Ga0501035_0001342 3300049822 Bacteria 25362
498 Ga0501035_0024648 3300049822 Bacteria 5516
499 Ga0501044_0002429 3300049823 Bacteria 21255
500 Ga0501045_0040341 3300049824 Bacteria 3398
501 Ga0501045_0311199 3300049824 Bacteria 1172
502 nmdc:mga0k408_19490_c1 3300050493 Bacteria 3792
503 nmdc:mga08y16_5125_c1 3300050511 Bacteria 13695
504 nmdc:mga0n895_139115_c1 3300050512 Bacteria 2455
505 nmdc:mga0n895_342920_c1 3300050512 Bacteria 1513
506 nmdc:mga0n895_690812_c1 3300050512 Bacteria 1017
507 nmdc:mga08x19_27909_c2 3300050514 Bacteria 2789
508 nmdc:mga08x19_71440_c1 3300050514 Bacteria 2263
509 nmdc:mga0sz30_52729_c1 3300050516 Bacteria 1727
510 Ga0495601_0015246 3300053077 Bacteria 4643
511 Ga0501084_0100727 3300054114 Bacteria 2425
512 Ga0501082_0000766 3300060353 Bacteria 28130
513 Ga0501082_0035203 3300060353 Bacteria 4316
514 Ga0501082_0169499 3300060353 Bacteria 1898
515 Ga0501082_0219194 3300060353 Bacteria 1655
516 Ga0530510_0156361 3300061734 Bacteria 1685
517 2526211978 2526164512 Bacteria 4025691
518 2739611483 2739367655 Bacteria 4051151
519 2881931389 2881927736 Bacteria 3993927
520 2887376858 2887375801 Bacteria 5334027
521 2952255004 2952252522 Bacteria 4171745
522 8002395660 8002392321 Bacteria 4159911
523 8048747265 8048746797 Bacteria 3557226
524 8057162686 8057160832 Bacteria 3268302
525 Ga0501039_0055642
526 Ga0070658_10007380
527 Ga0070658_10009438
528 Ga0070658_10607772
529 Ga0070683_100019937
530 Ga0070683_100184434
531 Ga0070683_100189819
532 Ga0070690_100081875
533 Ga0070690_100405668
534 Ga0070670_100012490
535 Ga0070670_100016776
536 Ga0070677_10012255
537 Ga0070680_100283272
538 Ga0070682_100069629
539 Ga0068868_100119472
540 Ga0068868_100613866
541 Ga0070660_100068133
542 Ga0070660_100077800
543 Ga0070660_100087144
544 Ga0070660_100179698
545 Ga0070660_100200862
546 Ga0070660_100557137
547 Ga0070689_100001950
548 Ga0070689_100005705
549 Ga0070689_100054879
550 Ga0070661_100112782
551 Ga0070661_100130602
552 Ga0070692_10075772
553 Ga0070668_100004001
554 Ga0070669_100010145
555 Ga0070669_100049033
556 Ga0070669_100069919
557 Ga0070675_100010664
558 Ga0070675_100106210
559 Ga0070675_100161627
560 Ga0070675_100178699
561 Ga0070675_100269635
562 Ga0070671_100010540
563 Ga0070674_100012633
564 Ga0070674_100366670
565 Ga0070673_100096884
566 Ga0070673_100100933
567 Ga0070673_100111690
568 Ga0070688_100005713
569 Ga0070688_100118064
570 Ga0070688_100456304
571 Ga0070659_100004323
572 Ga0070659_100004965
573 Ga0070667_100035968
574 Ga0070709_10004582
575 Ga0070709_10013676
576 Ga0070714_100040090
577 Ga0070714_100137807
578 Ga0070713_100011202
579 Ga0070713_100031238
580 Ga0070710_10008882
581 Ga0070701_10036528
582 Ga0070711_100034028
583 Ga0070705_100041816
584 Ga0070700_100023821
585 Ga0070694_100306460
586 Ga0070663_100104967
587 Ga0070678_100016710
588 Ga0070678_100378788
589 Ga0070662_100001880
590 Ga0070662_100085316
591 Ga0070681_10037220
592 Ga0070681_10308165
593 Ga0068867_100007361
594 Ga0068867_100056886
595 Ga0068867_100058740
596 Ga0068867_100242395
597 Ga0070685_10167872
598 Ga0070699_100034854
599 Ga0070679_100020518
600 Ga0070679_100041050
601 Ga0070679_100185052
602 Ga0070684_100026837
603 Ga0068853_100014932
604 Ga0068853_100049157
605 Ga0070672_100000860
606 Ga0070672_100005701
607 Ga0070672_100086597
608 Ga0070672_100187895
609 Ga0070696_100002856
610 Ga0070696_100115395
611 Ga0070693_100000747
612 Ga0070693_100083401
613 Ga0070665_100053355
614 Ga0070665_100707908
615 Ga0070704_100114412
616 Ga0068855_100000418
617 Ga0068855_100016121
618 Ga0068855_100159760
619 Ga0068855_100177856
620 Ga0070664_100028480
621 Ga0070664_100087103
622 Ga0068857_100071884
623 Ga0068857_100197243
624 Ga0068854_100043773
625 Ga0068854_100332628
626 Ga0068856_100004275
627 Ga0068856_100047581
628 Ga0068856_100057190
629 Ga0068856_100085308
630 Ga0068856_100140272
631 Ga0070702_100088210
632 Ga0068852_100000254
633 Ga0068852_100013979
634 Ga0068852_100032942
635 Ga0068852_100066170
636 Ga0068859_100061781
637 Ga0068859_100119831
638 Ga0068859_100328794
639 Ga0068864_100025255
640 Ga0068864_100032108
641 Ga0068864_100626521
642 Ga0068861_100252827
643 Ga0068861_100447743
644 Ga0068851_10000830
645 Ga0068851_10004492
646 Ga0068870_10253881
647 Ga0068863_100059510
648 Ga0068858_100007962
649 Ga0068858_100009008
650 Ga0068858_100017308
651 Ga0068858_100120771
652 Ga0068860_100013958
653 Ga0068860_100148684
654 Ga0068860_100229020
655 Ga0068860_100440102
656 Ga0068862_100134585
657 Ga0068862_100162184
658 Ga0075364_10031006
659 Ga0075364_10114788
660 Ga0070716_100030298
661 Ga0075366_10000934
662 Ga0075366_10183937
663 Ga0097621_100003672
664 Ga0097621_100018014
665 Ga0097621_100054399
666 Ga0068871_100011321
667 Ga0068871_100019012
668 Ga0068871_100081674
669 Ga0068871_100176034
670 Ga0075428_100022378
671 Ga0075434_100167549
672 Ga0075434_100211639
673 Ga0075436_100029890
674 Ga0075436_100037993
675 Ga0075436_100052951
676 Ga0075436_100218511
677 Ga0097620_100061784
678 Ga0097620_100119830
679 Ga0097620_100328773
680 Ga0105240_10002504
681 Ga0105240_10036399
682 Ga0105240_10048096
683 Ga0105240_10052746
684 Ga0105240_10282265
685 Ga0105240_10356250
686 Ga0105240_10596017
687 Ga0111539_10001826
688 Ga0111539_10200376
689 Ga0105245_10039399
690 Ga0105245_10103350
691 Ga0105245_10155306
692 Ga0105243_10038106
693 Ga0105243_10159554
694 Ga0105243_10174696
695 Ga0105241_10001727
696 Ga0105242_10002431
697 Ga0105242_10036975
698 Ga0105242_10089890
699 Ga0105242_10129661
700 Ga0105242_10193679
701 Ga0105242_10236699
702 Ga0105248_10005709
703 Ga0105248_10017520
704 Ga0105248_10019911
705 Ga0105248_10101699
706 Ga0105248_10165486
707 Ga0105237_10004560
708 Ga0105249_10071194
709 Ga0157373_10013145
710 Ga0157373_10049269
711 Ga0157373_10212207
712 Ga0157371_10000354
713 Ga0157371_10148332
714 Ga0157370_10024332
715 Ga0157370_10027571
716 Ga0157370_10034802
717 Ga0157370_10115545
718 Ga0157370_10179267
719 Ga0157370_10673779
720 Ga0157369_10036870
721 Ga0157369_10061430
722 Ga0157369_10087528
723 Ga0157374_10094314
724 Ga0157378_10005184
725 Ga0157378_10112242
726 Ga0157378_10224209
727 Ga0163162_10111136
728 Ga0157372_10002030
729 Ga0157372_10053683
730 Ga0157372_10118651
731 Ga0157372_10128366
732 Ga0157372_10199414
733 Ga0157372_11135612
734 Ga0157375_10007571
735 Ga0157375_10060080
736 Ga0157375_10237056
737 Ga0163163_10023637
738 Ga0157380_10028816
739 Ga0157380_10051914
740 Ga0157380_10158383
741 Ga0157379_10023156
742 Ga0157379_10097787
743 Ga0157379_10113954
744 Ga0157376_10072644
745 Ga0157376_10205996
746 Ga0163161_10108004
747 Ga0163161_10144618
748 Ga0206356_11402804
749 Ga0206353_11565639
750 Ga0213872_10003475
751 Ga0213876_10024046
752 Ga0207656_10006761
753 Ga0207688_10045194
754 Ga0207680_10034341
755 Ga0207699_10037753
756 Ga0207699_10177003
757 Ga0207643_10007379
758 Ga0207643_10062838
759 Ga0207705_10001459
760 Ga0207705_10229024
761 Ga0207705_10414328
762 Ga0207705_10448771
763 Ga0207654_10015074
764 Ga0207654_10116486
765 Ga0207707_10012839
766 Ga0207695_10001050
767 Ga0207695_10033280
768 Ga0207695_10196254
769 Ga0207695_10306100
770 Ga0207695_10428114
771 Ga0207671_10084701
772 Ga0207693_10335753
773 Ga0207693_10506789
774 Ga0207663_10027865
775 Ga0207663_10048040
776 Ga0207663_10146787
777 Ga0207660_10015328
778 Ga0207657_10000428
779 Ga0207657_10019239
780 Ga0207657_10035439
781 Ga0207649_10007354
782 Ga0207649_10048826
783 Ga0207652_10007031
784 Ga0207652_10026070
785 Ga0207652_10190048
786 Ga0207681_10053249
787 Ga0207681_10272679
788 Ga0207694_10005761
789 Ga0207694_10191840
790 Ga0207650_10009894
791 Ga0207650_10089035
792 Ga0207659_10016137
793 Ga0207659_10053235
794 Ga0207659_10065806
795 Ga0207687_10032368
796 Ga0207687_10272155
797 Ga0207700_10171468
798 Ga0207700_10172686
799 Ga0207700_10260672
800 Ga0207664_10032642
801 Ga0207664_10222271
802 Ga0207644_10014186
803 Ga0207644_10016074
804 Ga0207690_10001844
805 Ga0207706_10000024
806 Ga0207706_10109453
807 Ga0207686_10019749
808 Ga0207686_10089869
809 Ga0207686_10312991
810 Ga0207686_10329350
811 Ga0207709_10079405
812 Ga0207669_10370008
813 Ga0207665_10005306
814 Ga0207691_10000876
815 Ga0207691_10004670
816 Ga0207691_10031605
817 Ga0207691_10084863
818 Ga0207711_10019200
819 Ga0207711_10099362
820 Ga0207711_10102759
821 Ga0207711_10447229
822 Ga0207689_10033743
823 Ga0207689_10077288
824 Ga0207689_10504736
825 Ga0207661_10057074
826 Ga0207679_10003137
827 Ga0207679_10136141
828 Ga0207667_10001359
829 Ga0207667_10001633
830 Ga0207667_10004089
831 Ga0207667_10018131
832 Ga0207667_10080511
833 Ga0207667_10096004
834 Ga0207651_10001706
835 Ga0207651_10101911
836 Ga0207651_10118347
837 Ga0207651_10423437
838 Ga0207712_10436059
839 Ga0207668_10015145
840 Ga0207640_10073606
841 Ga0207640_10263449
842 Ga0207658_10026937
843 Ga0207658_10066826
844 Ga0207677_10571995
845 Ga0207703_10006202
846 Ga0207703_10152070
847 Ga0207639_10004954
848 Ga0207639_10011402
849 Ga0207678_10003094
850 Ga0207678_10014760
851 Ga0207708_10041652
852 Ga0207702_10003126
853 Ga0207702_10207133
854 Ga0207702_10427967
855 Ga0207641_10204629
856 Ga0207641_10207478
857 Ga0207648_10031300
858 Ga0207648_10069918
859 Ga0207648_10150472
860 Ga0207676_10412065
861 Ga0207674_10001026
862 Ga0207674_10005717
863 Ga0207674_10206112
864 Ga0207674_10444416
865 Ga0207675_100073638
866 Ga0207675_100086847
867 Ga0207675_100104959
868 Ga0207675_100167714
869 Ga0207683_10003736
870 Ga0207683_10297947
871 Ga0207683_10535934
872 Ga0207683_10594213
873 Ga0207698_10008769
874 Ga0207698_10012510
875 Ga0207698_10029084
876 Ga0207698_10059441
877 Ga0207698_10078433
878 Ga0207698_10647205
879 Ga0268266_10051474
880 Ga0268266_10719172
881 Ga0268265_10108471
882 Ga0268264_10032152
883 Ga0268264_10275745
884 Ga0307509_10000138
885 Ga0307408_100087478
886 Ga0307405_10002652
887 Ga0307413_10007026
888 Ga0307413_10280184
889 Ga0307410_10002378
890 Ga0307406_10066577
891 Ga0307406_10474448
892 Ga0307407_10019183
893 Ga0307412_10141973
894 Ga0307409_100005180
895 Ga0307416_100001305
896 Ga0307416_100170125
897 Ga0307416_100232068
898 Ga0307416_100278564
899 Ga0307416_100284343
900 Ga0307411_10000855
901 Ga0307415_100228610
902 Ga0373934_0001824
903 Ga0373923_0014494
904 Ga0373954_0066521
905 Ga0373954_0067668
906 Ga0373956_0005355
907 Ga0373957_0054846
908 Ga0373955_0333415
909 Ga0373961_0056127
910 Ga0373924_0009169
911 Ga0373927_0141465
912 Ga0373933_0019139
913 Ga0373933_0019580
914 Ga0373933_0293188
915 Ga0373933_0429787
916 Ga0373937_0010448
917 Ga0373937_0243104
918 Ga0373925_0028637
919 Ga0395900_0033287
920 Ga0395900_0196368
921 Ga0395898_0079328
922 Ga0395898_0251025
923 Ga0395905_0041864
924 Ga0395901_0008138
925 Ga0395901_0673350
926 Ga0436365_0533020
927 Ga0436365_0632282
928 Ga0436361_0763525
929 Ga0451577_0469349
930 Ga0451577_0686218
931 Ga0466969_0008765
932 Ga0466966_0096738
933 Ga0466961_0000358
934 Ga0453684_0001904
935 Ga0466959_0030735
936 Ga0495629_0356237
937 Ga0495651_0017271
938 Ga0495653_0023970
939 Ga0495650_0000133
940 Ga0495662_0015763
941 Ga0495664_0063287
942 Ga0495584_0021171
943 Ga0495585_0026788
944 Ga0495616_0087047
945 Ga0495620_0020695
946 Ga0495628_0142284
947 Ga0495630_0056541
948 Ga0495631_0017610
949 Ga0495666_0108140
950 Ga0495652_0132284
951 Ga0495640_0094045
952 Ga0495621_0005816
953 Ga0495621_0093462
954 Ga0495597_0001089
955 Ga0495645_0028054
956 Ga0495633_0004979
957 Ga0495634_0180745
958 Ga0495661_0000549
959 Ga0495657_0046559
960 Ga0495657_0199187
961 Ga0495624_0108340
962 Ga0495670_0074459
963 Ga0495589_0000310
964 Ga0495600_0066385
965 Ga0495604_0251676
966 Ga0495636_0030387
967 Ga0495674_0009158
968 Ga0495680_0175018
969 Ga0495681_0026059
970 Ga0496101_0037284
971 Ga0496102_0004418
972 Ga0496103_0229730
973 Ga0496104_0013030
974 Ga0496106_0000802
975 Ga0496109_0089946
976 Ga0496110_0039597
977 Ga0495678_038682
978 Ga0501031_0009359
979 Ga0501031_0230040
980 Ga0501032_0005180
981 Ga0501033_0011376
982 Ga0501034_0034384
983 Ga0501034_0479307
984 Ga0501036_0000051
985 Ga0501036_0036217
986 Ga0501037_0001916
987 Ga0501038_0001036
988 Ga0501038_0022187
989 Ga0501039_0004806
990 Ga0501039_0005801
991 Ga0501039_0039547
992 Ga0501040_0107326
993 Ga0501041_0001413
994 Ga0501041_0192574
995 Ga0501043_0008396
996 Ga0501046_0000415
997 Ga0501046_0031922
998 Ga0501047_0004291
999 Ga0501047_0470957
1000 Ga0501068_0045446
1001 Ga0501069_0006817
1002 Ga0501070_0035078
1003 Ga0501072_0019057
1004 Ga0501072_0050074
1005 Ga0501073_0054596
1006 Ga0501074_0002417
1007 Ga0501075_0015197
1008 Ga0501075_0025463
1009 Ga0501076_0030814
1010 Ga0501077_0041465
1011 Ga0501077_0111844
1012 Ga0501079_0006616
1013 Ga0501079_0006681
1014 Ga0501080_0029059
1015 Ga0501080_0061064
1016 Ga0501080_0133633
1017 Ga0501081_0000156
1018 Ga0501081_0001665
1019 Ga0501083_0025829
1020 Ga0501083_0095667
1021 Ga0501035_0001342
1022 Ga0501035_0024648
1023 Ga0501044_0002429
1024 Ga0501045_0040341
1025 Ga0501045_0311199
1026 nmdc:mga0k408_19490_c1
1027 nmdc:mga08y16_5125_c1
1028 nmdc:mga0n895_139115_c1
1029 nmdc:mga0n895_342920_c1
1030 nmdc:mga0n895_690812_c1
1031 nmdc:mga08x19_27909_c2
1032 nmdc:mga08x19_71440_c1
1033 nmdc:mga0sz30_52729_c1
1034 Ga0495601_0015246
1035 Ga0501084_0100727
1036 Ga0501082_0000766
1037 Ga0501082_0035203
1038 Ga0501082_0169499
1039 Ga0501082_0219194
1040 Ga0530510_0156361
1041 2526211978
1042 2739611483
1043 2881931389
1044 2887376858
1045 2952255004
1046 8002395660
1047 8048747265
1048 8057162686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05690

ThiG

Thiazole biosynthesis protein ThiG

6

251

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wv2-assembly1.cif.gz_B crystal structure of thiamine biosynthesis protein from pseudomonas aeruginosa 0.9857 3 244
1wv2-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein from pseudomonas aeruginosa 0.9837 3 244
1wv2-assembly1.cif.gz_B crystal structure of thiamine biosynthesis protein from pseudomonas aeruginosa 0.9769 3 244
1wv2-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein from pseudomonas aeruginosa 0.9752 3 244
5z9y-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis thiazole synthase (thig) complexed with dxp 0.9631 4 249
ID Description Score Start End Superfamily
1wv2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9837 3 244 3.20.20.70
1wv2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9752 3 244 3.20.20.70
af_P30139_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9371 4 261 3.20.20.70
af_P30139_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.93 4 261 3.20.20.70
1xm3C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9227 4 252 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2N2SGF1-F1-model_v4 thiazole synthase (EC 2.8.1.10) 0.9985 2 233 GO:0009229
GO:1990107
AF-A0A1X0HS91-F1-model_v4 thiazole synthase (EC 2.8.1.10) 0.9976 70 151 GO:0009229
GO:1990107
AF-A0A2S8NCG6-F1-model_v4 deleted 0.9976 128 211
AF-A0A350CLX7-F1-model_v4 thiazole synthase (EC 2.8.1.10) 0.9971 2 223 GO:0009229
GO:1990107
AF-A0A1W9W6G9-F1-model_v4 thiazole synthase (EC 2.8.1.10) 0.9966 3 235 GO:0009229
GO:1990107

Map