F459169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 524 | 309 | 479 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0005137|Ga0466965_0005137_75_1001 |
| Length | 308 |
| Sequence | MRRDDIPPGQKVWARHIGRQPPREETLLQDDAAPRVATREREGKRMPLYDSLRPRPELRVLVTAGASGIGAAIARAFHEAGSRVHVCDIDRAGLDRLVADTPGITGSMADVSVAADVDQVFEDVRGCLGGLDVLINNAGIAGPTGPIESFDAGGWERTVSVNLNSQFYFARRAVPLLKQSSANPVLISMSSVAGRLGYAFRTPYASTKWAIVGLTKSLAIELGPQGIRVNAILPGVVEGERMDGVIASRAASLGIGVDEMRQEYLRKISLRRMVTASDVAAMALFLCSPAAHNLSGQAISVDGNLEYL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 2 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 3 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 4 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 5 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 6 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 7 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 8 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 9 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 10 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 11 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 12 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 13 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 14 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 15 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 16 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 17 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 18 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 19 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 20 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 21 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 22 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 23 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 24 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 25 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 26 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 27 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 28 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 29 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 30 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 31 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 32 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 33 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 34 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 35 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 36 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 37 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 38 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 39 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 40 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 41 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 42 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 43 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 44 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 47 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 48 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 49 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 50 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 52 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 167 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 182 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 183 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 184 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 301 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 302 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 303 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 304 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 305 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 306 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 307 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 308 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 309 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.41 |
| Metatranscriptomes | 0 |
| Isolates | 8.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.74 |
| Nodule | 1.15 |
| Rhizoplane | 8.02 |
| Rhizosphere | 62.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001143 | 3300001979 | Bacteria | 11990 |
| 2 | JGI24739J22299_10009570 | 3300001989 | Bacteria | 3607 |
| 3 | JGI24735J21928_10000373 | 3300002067 | Bacteria | 15664 |
| 4 | JGI24735J21928_10012354 | 3300002067 | Bacteria | 2700 |
| 5 | JGI24738J21930_10000443 | 3300002075 | Bacteria | 11696 |
| 6 | JGI25155J39150_1000366 | 3300002704 | Bacteria | 13753 |
| 7 | JGI25156J39149_1000649 | 3300002705 | Bacteria | 19021 |
| 8 | JGI25156J39149_1007814 | 3300002705 | Bacteria | 2764 |
| 9 | JGI25154J39366_1000534 | 3300002738 | Bacteria | 19006 |
| 10 | JGI25157J39369_1000665 | 3300002741 | Bacteria | 19017 |
| 11 | JGI25151J46595_10003224 | 3300003187 | Bacteria | 9120 |
| 12 | JGI25165J46597_1000809 | 3300003214 | Bacteria | 23655 |
| 13 | rootL2_10015957 | 3300003322 | Bacteria | 5335 |
| 14 | rootL2_10248635 | 3300003322 | Bacteria | 1922 |
| 15 | rootH1_10107075 | 3300003323 | Bacteria | 2190 |
| 16 | JGI25160J50197_1000099 | 3300003354 | Bacteria | 86777 |
| 17 | Ga0055533_1000085 | 3300003756 | Bacteria | 124875 |
| 18 | Ga0055533_1002390 | 3300003756 | Bacteria | 4283 |
| 19 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 20 | Ga0055532_1000453 | 3300003758 | Bacteria | 19021 |
| 21 | Ga0055525_1000084 | 3300003759 | Bacteria | 155319 |
| 22 | Ga0055527_1000002 | 3300003760 | Bacteria | 830488 |
| 23 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 24 | Ga0055535_1000267 | 3300003761 | Bacteria | 54799 |
| 25 | Ga0055535_1011018 | 3300003761 | Bacteria | 1453 |
| 26 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 27 | Ga0055542_1000175 | 3300003762 | Bacteria | 79760 |
| 28 | Ga0055529_1000026 | 3300003763 | Bacteria | 293254 |
| 29 | Ga0055529_1000131 | 3300003763 | Bacteria | 105530 |
| 30 | Ga0055526_1010741 | 3300003771 | Bacteria | 4221 |
| 31 | Ga0055537_1000315 | 3300003773 | Bacteria | 33077 |
| 32 | Ga0055524_1015969 | 3300003775 | Bacteria | 2716 |
| 33 | Ga0055534_1000100 | 3300003784 | Bacteria | 66813 |
| 34 | Ga0055534_1000538 | 3300003784 | Bacteria | 20301 |
| 35 | Ga0055528_1003161 | 3300003790 | Bacteria | 8429 |
| 36 | Ga0055543_1002594 | 3300004625 | Bacteria | 5848 |
| 37 | Ga0065165_1000119 | 3300005262 | Bacteria | 134464 |
| 38 | Ga0065165_1000246 | 3300005262 | Bacteria | 93310 |
| 39 | Ga0065165_1070105 | 3300005262 | Bacteria | 934 |
| 40 | Ga0065704_10275148 | 3300005289 | Bacteria | 934 |
| 41 | Ga0070670_100011963 | 3300005331 | Bacteria | 7422 |
| 42 | Ga0070666_10374608 | 3300005335 | Bacteria | 1021 |
| 43 | Ga0070689_100714280 | 3300005340 | Bacteria | 876 |
| 44 | Ga0070691_10145659 | 3300005341 | Bacteria | 1211 |
| 45 | Ga0070669_100034775 | 3300005353 | Bacteria | 3648 |
| 46 | Ga0070659_100097304 | 3300005366 | Bacteria | 2365 |
| 47 | Ga0070667_100019088 | 3300005367 | Bacteria | 5686 |
| 48 | Ga0070663_100019014 | 3300005455 | Bacteria | 4518 |
| 49 | Ga0070663_100113582 | 3300005455 | Bacteria | 2038 |
| 50 | Ga0070678_100048846 | 3300005456 | Bacteria | 3050 |
| 51 | Ga0070678_100059197 | 3300005456 | Bacteria | 2815 |
| 52 | Ga0068867_100003791 | 3300005459 | Bacteria | 10636 |
| 53 | Ga0070672_100029329 | 3300005543 | Bacteria | 4125 |
| 54 | Ga0070696_100023024 | 3300005546 | Bacteria | 4235 |
| 55 | Ga0070665_100140959 | 3300005548 | Bacteria | 2414 |
| 56 | Ga0070665_100445739 | 3300005548 | Bacteria | 1304 |
| 57 | Ga0070704_100509627 | 3300005549 | Bacteria | 1045 |
| 58 | Ga0068855_100291933 | 3300005563 | Bacteria | 1807 |
| 59 | Ga0068856_100528818 | 3300005614 | Bacteria | 1200 |
| 60 | Ga0068852_100129141 | 3300005616 | Bacteria | 2325 |
| 61 | Ga0068852_100604131 | 3300005616 | Bacteria | 1101 |
| 62 | Ga0068866_10004840 | 3300005718 | Bacteria | 5529 |
| 63 | Ga0068861_100001526 | 3300005719 | Bacteria | 14664 |
| 64 | Ga0068863_100326917 | 3300005841 | Bacteria | 1490 |
| 65 | Ga0068858_100128729 | 3300005842 | Bacteria | 2373 |
| 66 | Ga0068858_100310302 | 3300005842 | Bacteria | 1506 |
| 67 | Ga0068860_100001387 | 3300005843 | Bacteria | 26293 |
| 68 | Ga0068860_100056914 | 3300005843 | Bacteria | 3716 |
| 69 | Ga0068865_100000371 | 3300006881 | Bacteria | 24845 |
| 70 | Ga0097620_100053067 | 3300006931 | Bacteria | 4076 |
| 71 | Ga0105244_10132344 | 3300009036 | Bacteria | 1203 |
| 72 | Ga0105250_10115611 | 3300009092 | Bacteria | 1101 |
| 73 | Ga0105240_10013230 | 3300009093 | Bacteria | 11349 |
| 74 | Ga0105240_10087772 | 3300009093 | Bacteria | 3808 |
| 75 | Ga0105240_10415964 | 3300009093 | Bacteria | 1511 |
| 76 | Ga0105247_10359292 | 3300009101 | Bacteria | 1026 |
| 77 | Ga0105241_10439860 | 3300009174 | Bacteria | 1151 |
| 78 | Ga0105242_10408823 | 3300009176 | Bacteria | 1269 |
| 79 | Ga0105248_10018714 | 3300009177 | Bacteria | 7658 |
| 80 | Ga0105248_10073805 | 3300009177 | Bacteria | 3834 |
| 81 | Ga0105237_10014914 | 3300009545 | Bacteria | 8103 |
| 82 | Ga0105238_10018816 | 3300009551 | Bacteria | 7030 |
| 83 | Ga0105249_10083386 | 3300009553 | Bacteria | 2975 |
| 84 | Ga0105239_10009446 | 3300010375 | Bacteria | 10988 |
| 85 | Ga0105246_10064217 | 3300011119 | Bacteria | 2564 |
| 86 | Ga0105246_10090335 | 3300011119 | Bacteria | 2205 |
| 87 | Ga0157373_10007445 | 3300013100 | Bacteria | 8143 |
| 88 | Ga0157369_10000456 | 3300013105 | Bacteria | 54115 |
| 89 | Ga0157369_10082556 | 3300013105 | Bacteria | 3438 |
| 90 | Ga0157378_10038368 | 3300013297 | Bacteria | 4245 |
| 91 | Ga0163162_10000793 | 3300013306 | Bacteria | 29396 |
| 92 | Ga0163162_10000948 | 3300013306 | Bacteria | 26987 |
| 93 | Ga0163162_10045284 | 3300013306 | Bacteria | 4408 |
| 94 | Ga0157375_10217630 | 3300013308 | Bacteria | 2068 |
| 95 | Ga0157380_10220260 | 3300014326 | Bacteria | 1697 |
| 96 | Ga0182008_10000207 | 3300014497 | Bacteria | 46359 |
| 97 | Ga0157379_10075838 | 3300014968 | Bacteria | 3011 |
| 98 | Ga0157376_10320339 | 3300014969 | Bacteria | 1474 |
| 99 | Ga0182006_1024307 | 3300015261 | Bacteria | 2500 |
| 100 | Ga0182006_1035752 | 3300015261 | Bacteria | 1978 |
| 101 | Ga0182007_10000185 | 3300015262 | Bacteria | 42160 |
| 102 | Ga0163161_10003747 | 3300017792 | Bacteria | 10648 |
| 103 | Ga0163161_10109283 | 3300017792 | Bacteria | 2065 |
| 104 | Ga0209435_100080 | 3300025206 | Bacteria | 49104 |
| 105 | Ga0209566_100786 | 3300025225 | Bacteria | 16786 |
| 106 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 107 | Ga0209674_100078 | 3300025226 | Bacteria | 206136 |
| 108 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 109 | Ga0209672_100031 | 3300025228 | Bacteria | 332889 |
| 110 | Ga0209672_100158 | 3300025228 | Bacteria | 58904 |
| 111 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 112 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 113 | Ga0209147_100034 | 3300025229 | Bacteria | 346646 |
| 114 | Ga0209147_100040 | 3300025229 | Bacteria | 307612 |
| 115 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 116 | Ga0209563_103001 | 3300025230 | Bacteria | 3622 |
| 117 | Ga0209437_100117 | 3300025233 | Bacteria | 209271 |
| 118 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 119 | Ga0209258_100061 | 3300025242 | Bacteria | 313501 |
| 120 | Ga0209258_100788 | 3300025242 | Bacteria | 19070 |
| 121 | Ga0209646_1000481 | 3300025246 | Bacteria | 19783 |
| 122 | Ga0209026_1000729 | 3300025250 | Bacteria | 19150 |
| 123 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 124 | Ga0209148_1000070 | 3300025254 | Bacteria | 332889 |
| 125 | Ga0209759_1000029 | 3300025256 | Bacteria | 286968 |
| 126 | Ga0209759_1000087 | 3300025256 | Bacteria | 166470 |
| 127 | Ga0209759_1000440 | 3300025256 | Bacteria | 48778 |
| 128 | Ga0209759_1000815 | 3300025256 | Bacteria | 24792 |
| 129 | Ga0209759_1004244 | 3300025256 | Bacteria | 5411 |
| 130 | Ga0209233_1000043 | 3300025261 | Bacteria | 509723 |
| 131 | Ga0209565_1000076 | 3300025263 | Bacteria | 161760 |
| 132 | Ga0209565_1006273 | 3300025263 | Bacteria | 3358 |
| 133 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 134 | Ga0209455_1000069 | 3300025272 | Bacteria | 308247 |
| 135 | Ga0209673_1000026 | 3300025273 | Bacteria | 373739 |
| 136 | Ga0209673_1008488 | 3300025273 | Bacteria | 4566 |
| 137 | Ga0209130_1002434 | 3300025284 | Bacteria | 9333 |
| 138 | Ga0209130_1004456 | 3300025284 | Bacteria | 5301 |
| 139 | Ga0209675_1000047 | 3300025291 | Bacteria | 221683 |
| 140 | Ga0209675_1000859 | 3300025291 | Bacteria | 19681 |
| 141 | Ga0209676_1006609 | 3300025292 | Bacteria | 5671 |
| 142 | Ga0209025_1000133 | 3300025294 | Bacteria | 195885 |
| 143 | Ga0209025_1000342 | 3300025294 | Bacteria | 102758 |
| 144 | Ga0209025_1006938 | 3300025294 | Bacteria | 8619 |
| 145 | Ga0209025_1040896 | 3300025294 | Bacteria | 1996 |
| 146 | Ga0209564_1000553 | 3300025295 | Bacteria | 60114 |
| 147 | Ga0209564_1003544 | 3300025295 | Bacteria | 10502 |
| 148 | Ga0209758_1011181 | 3300025297 | Bacteria | 5238 |
| 149 | Ga0209050_1001725 | 3300025298 | Bacteria | 21758 |
| 150 | Ga0209256_1000544 | 3300025299 | Bacteria | 54207 |
| 151 | Ga0209256_1002942 | 3300025299 | Bacteria | 12780 |
| 152 | Ga0207426_1000215 | 3300025302 | Bacteria | 136757 |
| 153 | Ga0207426_1003763 | 3300025302 | Bacteria | 7907 |
| 154 | Ga0209051_1050524 | 3300025303 | Bacteria | 1392 |
| 155 | Ga0207713_1004266 | 3300025735 | Bacteria | 9329 |
| 156 | Ga0207642_10024742 | 3300025899 | Bacteria | 2418 |
| 157 | Ga0207680_10103786 | 3300025903 | Bacteria | 1831 |
| 158 | Ga0207680_10119693 | 3300025903 | Bacteria | 1720 |
| 159 | Ga0207647_10016751 | 3300025904 | Bacteria | 4994 |
| 160 | Ga0207647_10085536 | 3300025904 | Bacteria | 1886 |
| 161 | Ga0207695_10016943 | 3300025913 | Bacteria | 8502 |
| 162 | Ga0207695_10253648 | 3300025913 | Bacteria | 1658 |
| 163 | Ga0207695_10295599 | 3300025913 | Bacteria | 1511 |
| 164 | Ga0207671_10060153 | 3300025914 | Bacteria | 2818 |
| 165 | Ga0207681_10021881 | 3300025923 | Bacteria | 4071 |
| 166 | Ga0207694_10020992 | 3300025924 | Bacteria | 4944 |
| 167 | Ga0207694_10177367 | 3300025924 | Bacteria | 1727 |
| 168 | Ga0207650_10016686 | 3300025925 | Bacteria | 5135 |
| 169 | Ga0207644_10106844 | 3300025931 | Bacteria | 2111 |
| 170 | Ga0207704_10013981 | 3300025938 | Bacteria | 4039 |
| 171 | Ga0207691_10045164 | 3300025940 | Bacteria | 4051 |
| 172 | Ga0207711_10073342 | 3300025941 | Bacteria | 2975 |
| 173 | Ga0207667_10020362 | 3300025949 | Bacteria | 7382 |
| 174 | Ga0207667_10241642 | 3300025949 | Bacteria | 1848 |
| 175 | Ga0207712_10076205 | 3300025961 | Bacteria | 2427 |
| 176 | Ga0207658_10028141 | 3300025986 | Bacteria | 3956 |
| 177 | Ga0207703_10341341 | 3300026035 | Bacteria | 1377 |
| 178 | Ga0207678_10237222 | 3300026067 | Bacteria | 1562 |
| 179 | Ga0207648_10011597 | 3300026089 | Bacteria | 8298 |
| 180 | Ga0207674_10290127 | 3300026116 | Bacteria | 1585 |
| 181 | Ga0207675_100015873 | 3300026118 | Bacteria | 7024 |
| 182 | Ga0207683_10078207 | 3300026121 | Bacteria | 2931 |
| 183 | Ga0207683_10174164 | 3300026121 | Bacteria | 1949 |
| 184 | Ga0207698_10566753 | 3300026142 | Bacteria | 1115 |
| 185 | Ga0209371_1000971 | 3300027312 | Bacteria | 22220 |
| 186 | Ga0268266_10433660 | 3300028379 | Bacteria | 1247 |
| 187 | Ga0268266_10535846 | 3300028379 | Bacteria | 1120 |
| 188 | Ga0268264_10002698 | 3300028381 | Bacteria | 15494 |
| 189 | Ga0268256_1000821 | 3300030500 | Bacteria | 22220 |
| 190 | Ga0316181_1053488 | 3300030744 | Bacteria | 1490 |
| 191 | Ga0316182_1212983 | 3300030745 | Bacteria | 4164 |
| 192 | Ga0265330_10050874 | 3300031235 | Bacteria | 1817 |
| 193 | Ga0265325_10010668 | 3300031241 | Bacteria | 5307 |
| 194 | Ga0265325_10202811 | 3300031241 | Bacteria | 914 |
| 195 | Ga0265340_10006435 | 3300031247 | Bacteria | 6466 |
| 196 | Ga0265327_10006362 | 3300031251 | Bacteria | 9468 |
| 197 | Ga0265313_10012675 | 3300031595 | Bacteria | 5122 |
| 198 | Ga0265314_10110872 | 3300031711 | Bacteria | 1744 |
| 199 | Ga0265342_10064224 | 3300031712 | Bacteria | 2155 |
| 200 | Ga0307412_10000059 | 3300031911 | Bacteria | 138772 |
| 201 | Ga0395899_0012056 | 3300037312 | Bacteria | 6624 |
| 202 | Ga0395900_0001667 | 3300037418 | Bacteria | 25970 |
| 203 | Ga0395900_0041760 | 3300037418 | Bacteria | 4727 |
| 204 | Ga0395900_0116412 | 3300037418 | Bacteria | 2743 |
| 205 | Ga0395898_0004523 | 3300037466 | Bacteria | 15190 |
| 206 | Ga0395905_0000020 | 3300037471 | Bacteria | 337672 |
| 207 | Ga0395905_0020275 | 3300037471 | Bacteria | 6299 |
| 208 | Ga0395905_0139245 | 3300037471 | Bacteria | 2283 |
| 209 | Ga0395905_0372555 | 3300037471 | Bacteria | 1321 |
| 210 | Ga0395901_0000095 | 3300038443 | Bacteria | 119290 |
| 211 | Ga0395901_0081262 | 3300038443 | Bacteria | 3385 |
| 212 | Ga0400483_160367 | 3300039062 | Bacteria | 2022 |
| 213 | Ga0466969_0000534 | 3300044656 | Bacteria | 20884 |
| 214 | Ga0466972_0041504 | 3300044658 | Bacteria | 2240 |
| 215 | Ga0466982_0008424 | 3300044672 | Bacteria | 5185 |
| 216 | Ga0466965_0005137 | 3300044683 | Bacteria | 5874 |
| 217 | Ga0466965_0247169 | 3300044683 | Bacteria | 956 |
| 218 | Ga0466966_0001355 | 3300044684 | Bacteria | 15735 |
| 219 | Ga0466966_0168932 | 3300044684 | Bacteria | 1330 |
| 220 | Ga0466961_0001415 | 3300044693 | Bacteria | 14877 |
| 221 | Ga0466961_0003278 | 3300044693 | Bacteria | 10082 |
| 222 | Ga0466970_0032201 | 3300044765 | Bacteria | 2770 |
| 223 | Ga0466970_0131257 | 3300044765 | Bacteria | 1376 |
| 224 | Ga0466970_0219295 | 3300044765 | Bacteria | 1061 |
| 225 | Ga0466960_0054056 | 3300044901 | Bacteria | 1948 |
| 226 | Ga0466959_0021533 | 3300045049 | Bacteria | 4755 |
| 227 | Ga0466959_0139905 | 3300045049 | Bacteria | 1711 |
| 228 | Ga0466967_0708162 | 3300045976 | Bacteria | 997 |
| 229 | Ga0495592_0002222 | 3300046454 | Bacteria | 13694 |
| 230 | Ga0495592_0035395 | 3300046454 | Bacteria | 3762 |
| 231 | Ga0495592_0072482 | 3300046454 | Bacteria | 2506 |
| 232 | Ga0495603_0011710 | 3300046455 | Bacteria | 5308 |
| 233 | Ga0495590_0000092 | 3300046457 | Bacteria | 55212 |
| 234 | Ga0495590_0009089 | 3300046457 | Bacteria | 3774 |
| 235 | Ga0495590_0015933 | 3300046457 | Bacteria | 2718 |
| 236 | Ga0495590_0091739 | 3300046457 | Bacteria | 1075 |
| 237 | Ga0495591_001975 | 3300046458 | Bacteria | 11975 |
| 238 | Ga0495629_0000432 | 3300046459 | Bacteria | 34964 |
| 239 | Ga0495629_0010469 | 3300046459 | Bacteria | 6747 |
| 240 | Ga0495638_0059567 | 3300046460 | Bacteria | 2364 |
| 241 | Ga0495651_0037980 | 3300046462 | Bacteria | 3750 |
| 242 | Ga0495651_0150363 | 3300046462 | Bacteria | 1679 |
| 243 | Ga0495653_0008865 | 3300046463 | Bacteria | 8231 |
| 244 | Ga0495653_0018434 | 3300046463 | Bacteria | 5668 |
| 245 | Ga0495653_0038202 | 3300046463 | Bacteria | 3769 |
| 246 | Ga0495653_0057096 | 3300046463 | Bacteria | 2973 |
| 247 | Ga0495650_0003970 | 3300046471 | Bacteria | 10396 |
| 248 | Ga0495650_0077004 | 3300046471 | Bacteria | 1295 |
| 249 | Ga0495580_0098520 | 3300046472 | Bacteria | 2033 |
| 250 | Ga0495582_0007807 | 3300046473 | Bacteria | 5916 |
| 251 | Ga0495582_0059010 | 3300046473 | Bacteria | 2116 |
| 252 | Ga0495605_0003123 | 3300046474 | Bacteria | 9980 |
| 253 | Ga0495605_0086101 | 3300046474 | Bacteria | 1462 |
| 254 | Ga0495662_0003788 | 3300046476 | Bacteria | 7623 |
| 255 | Ga0495664_0000813 | 3300046477 | Bacteria | 15979 |
| 256 | Ga0495664_0014049 | 3300046477 | Bacteria | 4536 |
| 257 | Ga0495664_0114487 | 3300046477 | Bacteria | 1629 |
| 258 | Ga0495664_0200477 | 3300046477 | Bacteria | 1209 |
| 259 | Ga0495596_0005232 | 3300046500 | Bacteria | 6164 |
| 260 | Ga0495607_0110608 | 3300046501 | Bacteria | 1457 |
| 261 | Ga0495583_0003496 | 3300046506 | Bacteria | 11897 |
| 262 | Ga0495606_0003628 | 3300046507 | Bacteria | 16217 |
| 263 | Ga0495606_0020198 | 3300046507 | Bacteria | 4922 |
| 264 | Ga0495606_0029281 | 3300046507 | Bacteria | 3869 |
| 265 | Ga0495606_0031695 | 3300046507 | Bacteria | 3671 |
| 266 | Ga0495606_0133281 | 3300046507 | Bacteria | 1474 |
| 267 | Ga0495608_0000402 | 3300046511 | Bacteria | 30297 |
| 268 | Ga0495608_0001030 | 3300046511 | Bacteria | 19558 |
| 269 | Ga0495610_0000624 | 3300046512 | Bacteria | 35024 |
| 270 | Ga0495610_0152924 | 3300046512 | Bacteria | 982 |
| 271 | Ga0495616_0068026 | 3300046513 | Bacteria | 1730 |
| 272 | Ga0495616_0190379 | 3300046513 | Bacteria | 907 |
| 273 | Ga0495618_0005572 | 3300046514 | Bacteria | 7659 |
| 274 | Ga0495628_0021726 | 3300046516 | Bacteria | 5274 |
| 275 | Ga0495628_0037532 | 3300046516 | Bacteria | 3884 |
| 276 | Ga0495628_0178465 | 3300046516 | Bacteria | 1607 |
| 277 | Ga0495630_0003995 | 3300046517 | Bacteria | 10320 |
| 278 | Ga0495630_0160011 | 3300046517 | Bacteria | 1714 |
| 279 | Ga0495631_0100307 | 3300046518 | Bacteria | 1246 |
| 280 | Ga0495643_0155386 | 3300046522 | Bacteria | 1129 |
| 281 | Ga0495644_0106116 | 3300046523 | Bacteria | 1064 |
| 282 | Ga0495666_0000120 | 3300046526 | Bacteria | 32561 |
| 283 | Ga0495666_0000878 | 3300046526 | Bacteria | 14038 |
| 284 | Ga0495666_0202837 | 3300046526 | Bacteria | 911 |
| 285 | Ga0495642_0004439 | 3300046528 | Bacteria | 5444 |
| 286 | Ga0495642_0048064 | 3300046528 | Bacteria | 1749 |
| 287 | Ga0495652_0001389 | 3300046529 | Bacteria | 26896 |
| 288 | Ga0495652_0198458 | 3300046529 | Bacteria | 1525 |
| 289 | Ga0495652_0407105 | 3300046529 | Bacteria | 961 |
| 290 | Ga0495665_0000239 | 3300046531 | Bacteria | 27614 |
| 291 | Ga0495665_0000973 | 3300046531 | Bacteria | 15178 |
| 292 | Ga0495640_0001503 | 3300046533 | Bacteria | 18377 |
| 293 | Ga0495640_0002062 | 3300046533 | Bacteria | 16043 |
| 294 | Ga0495586_0079736 | 3300046535 | Bacteria | 1798 |
| 295 | Ga0495587_0019682 | 3300046536 | Bacteria | 4174 |
| 296 | Ga0495621_0040892 | 3300046539 | Bacteria | 1626 |
| 297 | Ga0495621_0075831 | 3300046539 | Bacteria | 1247 |
| 298 | Ga0495597_0001164 | 3300046542 | Bacteria | 19754 |
| 299 | Ga0495645_0021906 | 3300046543 | Bacteria | 4621 |
| 300 | Ga0495645_0110359 | 3300046543 | Bacteria | 1947 |
| 301 | Ga0495622_0000115 | 3300046557 | Bacteria | 69111 |
| 302 | Ga0495633_0177513 | 3300046558 | Bacteria | 981 |
| 303 | Ga0495656_0019443 | 3300046615 | Bacteria | 2622 |
| 304 | Ga0495634_0003103 | 3300046642 | Bacteria | 13505 |
| 305 | Ga0495611_0029670 | 3300046648 | Bacteria | 2399 |
| 306 | Ga0495611_0151985 | 3300046648 | Bacteria | 1081 |
| 307 | Ga0495625_0002351 | 3300046660 | Bacteria | 20624 |
| 308 | Ga0495635_0000831 | 3300046663 | Bacteria | 20224 |
| 309 | Ga0495635_0004416 | 3300046663 | Bacteria | 9739 |
| 310 | Ga0495661_0001916 | 3300046665 | Bacteria | 16560 |
| 311 | Ga0495588_0062706 | 3300046674 | Bacteria | 1927 |
| 312 | Ga0495657_0047863 | 3300046675 | Bacteria | 2888 |
| 313 | Ga0495599_0034104 | 3300046678 | Bacteria | 3198 |
| 314 | Ga0495599_0074568 | 3300046678 | Bacteria | 2118 |
| 315 | Ga0495599_0263396 | 3300046678 | Bacteria | 1047 |
| 316 | Ga0495623_0002004 | 3300046679 | Bacteria | 13669 |
| 317 | Ga0495646_0012933 | 3300046680 | Bacteria | 5305 |
| 318 | Ga0495646_0051695 | 3300046680 | Bacteria | 2485 |
| 319 | Ga0495646_0066205 | 3300046680 | Bacteria | 2137 |
| 320 | Ga0495669_0014543 | 3300046684 | Bacteria | 3363 |
| 321 | Ga0495669_0014864 | 3300046684 | Bacteria | 3330 |
| 322 | Ga0495613_0028567 | 3300046689 | Bacteria | 4148 |
| 323 | Ga0495624_0001875 | 3300046690 | Bacteria | 16011 |
| 324 | Ga0495624_0007388 | 3300046690 | Bacteria | 7715 |
| 325 | Ga0495624_0046645 | 3300046690 | Bacteria | 2755 |
| 326 | Ga0495670_0027512 | 3300046691 | Bacteria | 2817 |
| 327 | Ga0495671_0019792 | 3300046692 | Bacteria | 3554 |
| 328 | Ga0495671_0119186 | 3300046692 | Bacteria | 1288 |
| 329 | Ga0495671_0237397 | 3300046692 | Bacteria | 881 |
| 330 | Ga0495649_0000215 | 3300046694 | Bacteria | 50655 |
| 331 | Ga0495649_0012734 | 3300046694 | Bacteria | 4880 |
| 332 | Ga0495649_0026534 | 3300046694 | Bacteria | 3220 |
| 333 | Ga0495649_0096849 | 3300046694 | Bacteria | 1570 |
| 334 | Ga0495589_0012645 | 3300046794 | Bacteria | 4365 |
| 335 | Ga0495589_0026337 | 3300046794 | Bacteria | 2947 |
| 336 | Ga0495589_0046992 | 3300046794 | Bacteria | 2140 |
| 337 | Ga0495589_0073149 | 3300046794 | Bacteria | 1673 |
| 338 | Ga0495600_0000230 | 3300046809 | Bacteria | 30997 |
| 339 | Ga0495600_0004212 | 3300046809 | Bacteria | 8585 |
| 340 | Ga0495600_0131593 | 3300046809 | Bacteria | 1626 |
| 341 | Ga0495660_0043818 | 3300046810 | Bacteria | 2465 |
| 342 | Ga0495660_0087042 | 3300046810 | Bacteria | 1630 |
| 343 | Ga0495660_0155196 | 3300046810 | Bacteria | 1127 |
| 344 | Ga0495581_0000998 | 3300047315 | Bacteria | 15249 |
| 345 | Ga0495581_0003591 | 3300047315 | Bacteria | 8921 |
| 346 | Ga0495604_0101326 | 3300047317 | Bacteria | 2115 |
| 347 | Ga0495604_0109200 | 3300047317 | Bacteria | 2019 |
| 348 | Ga0495636_0135298 | 3300047318 | Bacteria | 1098 |
| 349 | Ga0495674_0050986 | 3300047319 | Bacteria | 3649 |
| 350 | Ga0495674_0189074 | 3300047319 | Bacteria | 1712 |
| 351 | Ga0495674_0291932 | 3300047319 | Bacteria | 1333 |
| 352 | Ga0495676_0015232 | 3300047321 | Bacteria | 6855 |
| 353 | Ga0495676_0201295 | 3300047321 | Bacteria | 1383 |
| 354 | Ga0495680_0005568 | 3300047322 | Bacteria | 11822 |
| 355 | Ga0495680_0055439 | 3300047322 | Bacteria | 3074 |
| 356 | Ga0495680_0285779 | 3300047322 | Bacteria | 1161 |
| 357 | Ga0495683_0001534 | 3300047323 | Bacteria | 14974 |
| 358 | Ga0495683_0010627 | 3300047323 | Bacteria | 4857 |
| 359 | Ga0495683_0010823 | 3300047323 | Bacteria | 4811 |
| 360 | Ga0495683_0050651 | 3300047323 | Bacteria | 2077 |
| 361 | Ga0495683_0170868 | 3300047323 | Bacteria | 999 |
| 362 | Ga0495687_016907 | 3300047443 | Bacteria | 3656 |
| 363 | Ga0495687_017543 | 3300047443 | Bacteria | 3566 |
| 364 | Ga0495675_0001188 | 3300047444 | Bacteria | 15769 |
| 365 | Ga0495675_0001459 | 3300047444 | Bacteria | 14311 |
| 366 | Ga0495675_0193411 | 3300047444 | Bacteria | 1241 |
| 367 | Ga0495677_0032430 | 3300047445 | Bacteria | 1903 |
| 368 | Ga0495679_000478 | 3300047446 | Bacteria | 28912 |
| 369 | Ga0495685_016099 | 3300047447 | Bacteria | 2555 |
| 370 | Ga0495673_0001172 | 3300047469 | Bacteria | 22155 |
| 371 | Ga0495673_0069619 | 3300047469 | Bacteria | 1483 |
| 372 | Ga0495673_0098510 | 3300047469 | Bacteria | 1185 |
| 373 | Ga0495681_0113434 | 3300047470 | Bacteria | 1171 |
| 374 | Ga0495686_0000181 | 3300047472 | Bacteria | 119765 |
| 375 | Ga0495686_0057601 | 3300047472 | Bacteria | 2425 |
| 376 | Ga0495593_0001222 | 3300047673 | Bacteria | 15022 |
| 377 | Ga0495593_0013364 | 3300047673 | Bacteria | 4684 |
| 378 | Ga0495593_0030535 | 3300047673 | Bacteria | 2949 |
| 379 | Ga0495593_0037705 | 3300047673 | Bacteria | 2612 |
| 380 | Ga0495593_0163896 | 3300047673 | Bacteria | 1122 |
| 381 | Ga0495602_0013684 | 3300048088 | Bacteria | 8277 |
| 382 | Ga0495602_0027695 | 3300048088 | Bacteria | 5441 |
| 383 | Ga0495602_0076896 | 3300048088 | Bacteria | 2826 |
| 384 | Ga0495602_0220202 | 3300048088 | Bacteria | 1433 |
| 385 | Ga0495602_0399010 | 3300048088 | Bacteria | 981 |
| 386 | Ga0495614_0000632 | 3300048089 | Bacteria | 14716 |
| 387 | Ga0495614_0001485 | 3300048089 | Bacteria | 10155 |
| 388 | Ga0495626_0025539 | 3300048091 | Bacteria | 2888 |
| 389 | Ga0495626_0034869 | 3300048091 | Bacteria | 2405 |
| 390 | Ga0495626_0063657 | 3300048091 | Bacteria | 1672 |
| 391 | Ga0495626_0071960 | 3300048091 | Bacteria | 1552 |
| 392 | Ga0496100_0000078 | 3300048903 | Bacteria | 54410 |
| 393 | Ga0496100_0000932 | 3300048903 | Bacteria | 13978 |
| 394 | Ga0496100_0002476 | 3300048903 | Bacteria | 9386 |
| 395 | Ga0496101_0000519 | 3300048904 | Bacteria | 24028 |
| 396 | Ga0496101_0000538 | 3300048904 | Bacteria | 23231 |
| 397 | Ga0496101_0043710 | 3300048904 | Bacteria | 3202 |
| 398 | Ga0496101_0196144 | 3300048904 | Bacteria | 1560 |
| 399 | Ga0496102_0000165 | 3300048905 | Bacteria | 89141 |
| 400 | Ga0496102_0003580 | 3300048905 | Bacteria | 13159 |
| 401 | Ga0496102_0013163 | 3300048905 | Bacteria | 7157 |
| 402 | Ga0496102_0039206 | 3300048905 | Bacteria | 4279 |
| 403 | Ga0496102_0081749 | 3300048905 | Bacteria | 2979 |
| 404 | Ga0496102_0106370 | 3300048905 | Bacteria | 2611 |
| 405 | Ga0496103_0000360 | 3300048906 | Bacteria | 41308 |
| 406 | Ga0496103_0000644 | 3300048906 | Bacteria | 26380 |
| 407 | Ga0496103_0014851 | 3300048906 | Bacteria | 4630 |
| 408 | Ga0496104_0002481 | 3300048907 | Bacteria | 15897 |
| 409 | Ga0496104_0008205 | 3300048907 | Bacteria | 9271 |
| 410 | Ga0496104_0149761 | 3300048907 | Bacteria | 2240 |
| 411 | Ga0496105_0000375 | 3300048908 | Bacteria | 29508 |
| 412 | Ga0496106_0000045 | 3300048909 | Bacteria | 103269 |
| 413 | Ga0496106_0005706 | 3300048909 | Bacteria | 9208 |
| 414 | Ga0496106_0013224 | 3300048909 | Bacteria | 6092 |
| 415 | Ga0496106_0022374 | 3300048909 | Bacteria | 4695 |
| 416 | Ga0496107_0005245 | 3300048910 | Bacteria | 8844 |
| 417 | Ga0496107_0061491 | 3300048910 | Bacteria | 2719 |
| 418 | Ga0496107_0484641 | 3300048910 | Bacteria | 918 |
| 419 | Ga0496109_0042598 | 3300048912 | Bacteria | 4113 |
| 420 | Ga0496109_0308223 | 3300048912 | Bacteria | 1493 |
| 421 | Ga0496110_0003384 | 3300048913 | Bacteria | 12181 |
| 422 | Ga0496110_0060777 | 3300048913 | Bacteria | 3333 |
| 423 | Ga0496110_0113947 | 3300048913 | Bacteria | 2432 |
| 424 | Ga0496110_0253973 | 3300048913 | Bacteria | 1600 |
| 425 | Ga0496111_0018131 | 3300048914 | Bacteria | 4873 |
| 426 | Ga0496111_0066681 | 3300048914 | Bacteria | 2614 |
| 427 | Ga0496112_0011630 | 3300048915 | Bacteria | 8049 |
| 428 | Ga0496112_0024005 | 3300048915 | Bacteria | 5834 |
| 429 | Ga0496113_0003212 | 3300048916 | Bacteria | 9742 |
| 430 | Ga0496113_0080747 | 3300048916 | Bacteria | 2491 |
| 431 | Ga0496114_0039656 | 3300048917 | Bacteria | 3897 |
| 432 | Ga0496116_0001434 | 3300048919 | Bacteria | 26780 |
| 433 | Ga0496116_0067321 | 3300048919 | Bacteria | 2288 |
| 434 | Ga0496117_0000707 | 3300048920 | Bacteria | 52889 |
| 435 | Ga0496117_0002321 | 3300048920 | Bacteria | 24382 |
| 436 | Ga0496117_0002393 | 3300048920 | Bacteria | 23847 |
| 437 | Ga0496117_0007204 | 3300048920 | Bacteria | 10965 |
| 438 | Ga0496117_0007634 | 3300048920 | Bacteria | 10492 |
| 439 | Ga0496117_0015333 | 3300048920 | Bacteria | 6540 |
| 440 | Ga0496117_0072054 | 3300048920 | Bacteria | 2312 |
| 441 | Ga0496118_0000283 | 3300048921 | Bacteria | 89206 |
| 442 | Ga0496118_0000647 | 3300048921 | Bacteria | 56808 |
| 443 | Ga0496118_0003472 | 3300048921 | Bacteria | 19786 |
| 444 | Ga0496118_0008341 | 3300048921 | Bacteria | 10727 |
| 445 | Ga0496118_0012458 | 3300048921 | Bacteria | 8162 |
| 446 | Ga0496118_0024001 | 3300048921 | Bacteria | 5278 |
| 447 | Ga0496118_0051414 | 3300048921 | Bacteria | 3152 |
| 448 | Ga0496119_0038458 | 3300048922 | Bacteria | 3091 |
| 449 | Ga0496120_0066373 | 3300048923 | Bacteria | 1996 |
| 450 | Ga0496121_0002547 | 3300048924 | Bacteria | 27634 |
| 451 | Ga0496121_0002717 | 3300048924 | Bacteria | 26409 |
| 452 | Ga0496121_0008605 | 3300048924 | Bacteria | 11948 |
| 453 | Ga0496121_0011190 | 3300048924 | Bacteria | 10001 |
| 454 | Ga0496121_0017457 | 3300048924 | Bacteria | 7332 |
| 455 | Ga0496121_0024609 | 3300048924 | Bacteria | 5749 |
| 456 | Ga0496122_0006237 | 3300048925 | Bacteria | 13796 |
| 457 | Ga0496122_0056368 | 3300048925 | Bacteria | 2930 |
| 458 | Ga0496122_0079799 | 3300048925 | Bacteria | 2285 |
| 459 | Ga0496123_0006105 | 3300048926 | Bacteria | 11810 |
| 460 | Ga0496123_0015633 | 3300048926 | Bacteria | 6210 |
| 461 | Ga0496123_0189826 | 3300048926 | Bacteria | 1064 |
| 462 | Ga0496124_0006512 | 3300048927 | Bacteria | 12709 |
| 463 | Ga0496124_0010208 | 3300048927 | Bacteria | 9542 |
| 464 | Ga0496124_0178290 | 3300048927 | Bacteria | 1638 |
| 465 | Ga0496124_0187702 | 3300048927 | Bacteria | 1585 |
| 466 | Ga0496125_0007063 | 3300048928 | Bacteria | 11996 |
| 467 | Ga0496125_0071998 | 3300048928 | Bacteria | 2697 |
| 468 | Ga0496126_0000031 | 3300048929 | Bacteria | 373371 |
| 469 | Ga0496126_0000105 | 3300048929 | Bacteria | 198893 |
| 470 | Ga0496126_0354917 | 3300048929 | Bacteria | 1198 |
| 471 | Ga0495682_0013848 | 3300049460 | Bacteria | 3063 |
| 472 | Ga0501032_0267834 | 3300049569 | Bacteria | 1107 |
| 473 | Ga0501070_0009081 | 3300049586 | Bacteria | 8409 |
| 474 | Ga0501080_0184125 | 3300049742 | Bacteria | 1921 |
| 475 | Ga0501035_0602374 | 3300049822 | Bacteria | 895 |
| 476 | Ga0500572_054582 | 3300053111 | Bacteria | 1199 |
| 477 | Ga0500607_007274 | 3300053121 | Bacteria | 6864 |
| 478 | Ga0500645_057158 | 3300053730 | Bacteria | 1131 |
| 479 | Ga0466962_0006725 | 3300061719 | Bacteria | 5511 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047318 | Ga0495636_0135298 | Ga0495636_0135298_433_1080 | 214 |
| 2 | 3300005549 | Ga0070704_100509627 | Ga0070704_1005096271 | 246 |
| 3 | 3300005340 | Ga0070689_100714280 | Ga0070689_1007142801 | 247 |
| 4 | 3300005341 | Ga0070691_10145659 | Ga0070691_101456592 | 247 |
| 5 | 3300005546 | Ga0070696_100023024 | Ga0070696_1000230242 | 247 |
| 6 | 3300046539 | Ga0495621_0075831 | Ga0495621_0075831_80_826 | 247 |
| 7 | 3300049822 | Ga0501035_0602374 | Ga0501035_0602374_10_759 | 249 |
| 8 | 3300047322 | Ga0495680_0005568 | Ga0495680_0005568_22_777 | 251 |
| 9 | 3300048904 | Ga0496101_0196144 | Ga0496101_0196144_11_766 | 251 |
| 10 | 3300031235 | Ga0265330_10050874 | Ga0265330_100508742 | 253 |
| 11 | 3300031241 | Ga0265325_10010668 | Ga0265325_100106683 | 253 |
| 12 | 3300031247 | Ga0265340_10006435 | Ga0265340_100064354 | 253 |
| 13 | 3300031595 | Ga0265313_10012675 | Ga0265313_100126752 | 253 |
| 14 | 3300031711 | Ga0265314_10110872 | Ga0265314_101108722 | 253 |
| 15 | 3300031712 | Ga0265342_10064224 | Ga0265342_100642242 | 253 |
| 16 | 3300046516 | Ga0495628_0021726 | Ga0495628_0021726_1911_2717 | 253 |
| 17 | 3300003771 | Ga0055526_1010741 | Ga0055526_10107412 | 255 |
| 18 | 3300003773 | Ga0055537_1000315 | Ga0055537_100031520 | 255 |
| 19 | 3300003775 | Ga0055524_1015969 | Ga0055524_10159693 | 255 |
| 20 | 3300003784 | Ga0055534_1000100 | Ga0055534_10001006 | 255 |
| 21 | 3300025263 | Ga0209565_1000076 | Ga0209565_100007635 | 255 |
| 22 | 3300025273 | Ga0209673_1008488 | Ga0209673_10084885 | 255 |
| 23 | 3300025291 | Ga0209675_1000047 | Ga0209675_100004735 | 255 |
| 24 | 3300025294 | Ga0209025_1006938 | Ga0209025_100693811 | 255 |
| 25 | 3300025295 | Ga0209564_1000553 | Ga0209564_100055329 | 255 |
| 26 | 3300025297 | Ga0209758_1011181 | Ga0209758_10111812 | 255 |
| 27 | 3300025299 | Ga0209256_1002942 | Ga0209256_10029428 | 255 |
| 28 | 3300046463 | Ga0495653_0008865 | Ga0495653_0008865_6614_7396 | 255 |
| 29 | iso_pu_bacteria | 2548876994 | 2550696606 | 255 |
| 30 | 3300039062 | Ga0400483_160367 | Ga0400483_160367_730_1503 | 256 |
| 31 | 3300025225 | Ga0209566_100786 | Ga0209566_10078612 | 257 |
| 32 | 3300025229 | Ga0209147_100034 | Ga0209147_10003486 | 257 |
| 33 | 3300046507 | Ga0495606_0003628 | Ga0495606_0003628_15161_15952 | 258 |
| 34 | 3300046528 | Ga0495642_0048064 | Ga0495642_0048064_893_1684 | 258 |
| 35 | 3300046543 | Ga0495645_0021906 | Ga0495645_0021906_368_1159 | 258 |
| 36 | 3300046678 | Ga0495599_0074568 | Ga0495599_0074568_65_856 | 258 |
| 37 | 3300046692 | Ga0495671_0237397 | Ga0495671_0237397_80_871 | 258 |
| 38 | 3300046694 | Ga0495649_0026534 | Ga0495649_0026534_2062_2853 | 258 |
| 39 | 3300046794 | Ga0495589_0046992 | Ga0495589_0046992_537_1328 | 258 |
| 40 | 3300046809 | Ga0495600_0131593 | Ga0495600_0131593_610_1401 | 258 |
| 41 | 3300047319 | Ga0495674_0189074 | Ga0495674_0189074_202_993 | 258 |
| 42 | 3300047444 | Ga0495675_0193411 | Ga0495675_0193411_319_1110 | 258 |
| 43 | iso_pu_bacteria | 2808606384 | 2808969506 | 258 |
| 44 | iso_pu_bacteria | 2808606390 | 2809004337 | 258 |
| 45 | iso_pu_bacteria | 2808606391 | 2809012915 | 258 |
| 46 | iso_pu_bacteria | 8039098773 | 8039101273 | 258 |
| 47 | iso_pu_bacteria | 2508501125 | 2509126549 | 259 |
| 48 | iso_pu_bacteria | 2513237166 | 2514053829 | 259 |
| 49 | iso_pu_bacteria | 2562617112 | 2563065097 | 259 |
| 50 | iso_pu_bacteria | 2599185239 | 2599735094 | 259 |
| 51 | iso_pu_bacteria | 2600255067 | 2600811491 | 259 |
| 52 | iso_pu_bacteria | 2711768613 | 2713481916 | 259 |
| 53 | iso_pu_bacteria | 2738541296 | 2738821072 | 259 |
| 54 | iso_pu_bacteria | 2738541298 | 2738833554 | 259 |
| 55 | iso_pu_bacteria | 2738541306 | 2738876961 | 259 |
| 56 | iso_pu_bacteria | 2738543002 | 2739186710 | 259 |
| 57 | iso_pu_bacteria | 2738543008 | 2739223554 | 259 |
| 58 | iso_pu_bacteria | 2738543013 | 2739250694 | 259 |
| 59 | iso_pu_bacteria | 2808606384 | 2808974207 | 259 |
| 60 | iso_pu_bacteria | 2808606390 | 2809008993 | 259 |
| 61 | iso_pu_bacteria | 2808606391 | 2809016144 | 259 |
| 62 | iso_pu_bacteria | 2818991445 | 2819595282 | 259 |
| 63 | iso_pu_bacteria | 2818991452 | 2819632002 | 259 |
| 64 | iso_pu_bacteria | 2857357740 | 2857366158 | 259 |
| 65 | iso_pu_bacteria | 2863421361 | 2863422401 | 259 |
| 66 | iso_pu_bacteria | 2884811622 | 2884812644 | 259 |
| 67 | iso_pu_bacteria | 2884836552 | 2884841124 | 259 |
| 68 | iso_pu_bacteria | 2884852848 | 2884855999 | 259 |
| 69 | iso_pu_bacteria | 2896154374 | 2896157076 | 259 |
| 70 | iso_pu_bacteria | 2904483920 | 2904484727 | 259 |
| 71 | iso_pu_bacteria | 2904541872 | 2904547002 | 259 |
| 72 | iso_pu_bacteria | 2904564687 | 2904564896 | 259 |
| 73 | iso_pu_bacteria | 2904571731 | 2904572408 | 259 |
| 74 | iso_pu_bacteria | 2919527303 | 2919530470 | 259 |
| 75 | iso_pu_bacteria | 2921643360 | 2921655268 | 259 |
| 76 | iso_pu_bacteria | 2928170801 | 2928172172 | 259 |
| 77 | iso_pu_bacteria | 2928536128 | 2928537734 | 259 |
| 78 | iso_pu_bacteria | 2929160207 | 2929164474 | 259 |
| 79 | iso_pu_bacteria | 2945934425 | 2945939367 | 259 |
| 80 | iso_pu_bacteria | 2954767861 | 2954768297 | 259 |
| 81 | iso_pu_bacteria | 2990703756 | 2990706710 | 259 |
| 82 | iso_pu_bacteria | 641736151 | 642424634 | 259 |
| 83 | iso_pu_bacteria | 8018845410 | 8018852039 | 259 |
| 84 | iso_pu_bacteria | 8021120328 | 8021120442 | 259 |
| 85 | iso_pu_bacteria | 8048746797 | 8048748775 | 259 |
| 86 | 3300046454 | Ga0495592_0035395 | Ga0495592_0035395_1150_1947 | 260 |
| 87 | 3300046454 | Ga0495592_0072482 | Ga0495592_0072482_190_987 | 260 |
| 88 | 3300046458 | Ga0495591_001975 | Ga0495591_001975_739_1536 | 260 |
| 89 | 3300046459 | Ga0495629_0000432 | Ga0495629_0000432_3012_3809 | 260 |
| 90 | 3300046462 | Ga0495651_0037980 | Ga0495651_0037980_2376_3173 | 260 |
| 91 | 3300046463 | Ga0495653_0018434 | Ga0495653_0018434_1222_2019 | 260 |
| 92 | 3300046473 | Ga0495582_0007807 | Ga0495582_0007807_254_1051 | 260 |
| 93 | 3300046476 | Ga0495662_0003788 | Ga0495662_0003788_6473_7270 | 260 |
| 94 | 3300046477 | Ga0495664_0000813 | Ga0495664_0000813_4837_5634 | 260 |
| 95 | 3300046500 | Ga0495596_0005232 | Ga0495596_0005232_2438_3235 | 260 |
| 96 | 3300046511 | Ga0495608_0001030 | Ga0495608_0001030_8676_9473 | 260 |
| 97 | 3300046517 | Ga0495630_0003995 | Ga0495630_0003995_7620_8417 | 260 |
| 98 | 3300046526 | Ga0495666_0000120 | Ga0495666_0000120_1593_2390 | 260 |
| 99 | 3300046529 | Ga0495652_0407105 | Ga0495652_0407105_57_854 | 260 |
| 100 | 3300046531 | Ga0495665_0000239 | Ga0495665_0000239_5105_5902 | 260 |
| 101 | 3300046533 | Ga0495640_0001503 | Ga0495640_0001503_10495_11292 | 260 |
| 102 | 3300046536 | Ga0495587_0019682 | Ga0495587_0019682_92_889 | 260 |
| 103 | 3300046543 | Ga0495645_0110359 | Ga0495645_0110359_166_963 | 260 |
| 104 | 3300046557 | Ga0495622_0000115 | Ga0495622_0000115_58562_59359 | 260 |
| 105 | 3300046648 | Ga0495611_0029670 | Ga0495611_0029670_731_1528 | 260 |
| 106 | 3300046663 | Ga0495635_0004416 | Ga0495635_0004416_1168_1965 | 260 |
| 107 | 3300046665 | Ga0495661_0001916 | Ga0495661_0001916_4422_5219 | 260 |
| 108 | 3300046675 | Ga0495657_0047863 | Ga0495657_0047863_1529_2326 | 260 |
| 109 | 3300046678 | Ga0495599_0034104 | Ga0495599_0034104_1824_2621 | 260 |
| 110 | 3300046679 | Ga0495623_0002004 | Ga0495623_0002004_5580_6377 | 260 |
| 111 | 3300046680 | Ga0495646_0012933 | Ga0495646_0012933_1661_2458 | 260 |
| 112 | 3300046689 | Ga0495613_0028567 | Ga0495613_0028567_65_862 | 260 |
| 113 | 3300046690 | Ga0495624_0007388 | Ga0495624_0007388_6733_7530 | 260 |
| 114 | 3300046690 | Ga0495624_0046645 | Ga0495624_0046645_1143_1940 | 260 |
| 115 | 3300046692 | Ga0495671_0019792 | Ga0495671_0019792_1132_1929 | 260 |
| 116 | 3300046794 | Ga0495589_0012645 | Ga0495589_0012645_2593_3390 | 260 |
| 117 | 3300046809 | Ga0495600_0004212 | Ga0495600_0004212_2109_2906 | 260 |
| 118 | 3300047315 | Ga0495581_0003591 | Ga0495581_0003591_4974_5771 | 260 |
| 119 | 3300047317 | Ga0495604_0101326 | Ga0495604_0101326_1133_1930 | 260 |
| 120 | 3300047321 | Ga0495676_0015232 | Ga0495676_0015232_5149_5946 | 260 |
| 121 | 3300047322 | Ga0495680_0055439 | Ga0495680_0055439_1138_1935 | 260 |
| 122 | 3300047322 | Ga0495680_0285779 | Ga0495680_0285779_64_861 | 260 |
| 123 | 3300047323 | Ga0495683_0010823 | Ga0495683_0010823_1906_2703 | 260 |
| 124 | 3300047444 | Ga0495675_0001188 | Ga0495675_0001188_13318_14115 | 260 |
| 125 | 3300047446 | Ga0495679_000478 | Ga0495679_000478_27861_28658 | 260 |
| 126 | 3300047469 | Ga0495673_0001172 | Ga0495673_0001172_20006_20803 | 260 |
| 127 | 3300047470 | Ga0495681_0113434 | Ga0495681_0113434_130_927 | 260 |
| 128 | 3300047673 | Ga0495593_0013364 | Ga0495593_0013364_1981_2778 | 260 |
| 129 | 3300048088 | Ga0495602_0013684 | Ga0495602_0013684_2438_3235 | 260 |
| 130 | 3300048089 | Ga0495614_0001485 | Ga0495614_0001485_9014_9811 | 260 |
| 131 | 3300048905 | Ga0496102_0039206 | Ga0496102_0039206_2728_3525 | 260 |
| 132 | 3300048905 | Ga0496102_0106370 | Ga0496102_0106370_622_1419 | 260 |
| 133 | 3300048920 | Ga0496117_0002393 | Ga0496117_0002393_13927_14724 | 260 |
| 134 | 3300048920 | Ga0496117_0007634 | Ga0496117_0007634_1478_2275 | 260 |
| 135 | 3300048921 | Ga0496118_0000647 | Ga0496118_0000647_619_1416 | 260 |
| 136 | 3300048921 | Ga0496118_0003472 | Ga0496118_0003472_13866_14663 | 260 |
| 137 | 3300048929 | Ga0496126_0000105 | Ga0496126_0000105_50347_51144 | 260 |
| 138 | 3300049460 | Ga0495682_0013848 | Ga0495682_0013848_612_1409 | 260 |
| 139 | 3300005842 | Ga0068858_100128729 | Ga0068858_1001287292 | 261 |
| 140 | 3300005843 | Ga0068860_100056914 | Ga0068860_1000569142 | 261 |
| 141 | 3300006931 | Ga0097620_100053067 | Ga0097620_1000530672 | 261 |
| 142 | 3300009101 | Ga0105247_10359292 | Ga0105247_103592921 | 261 |
| 143 | 3300011119 | Ga0105246_10090335 | Ga0105246_100903352 | 261 |
| 144 | 3300014968 | Ga0157379_10075838 | Ga0157379_100758382 | 261 |
| 145 | 3300005353 | Ga0070669_100034775 | Ga0070669_1000347753 | 262 |
| 146 | 3300005456 | Ga0070678_100048846 | Ga0070678_1000488462 | 262 |
| 147 | 3300005459 | Ga0068867_100003791 | Ga0068867_1000037917 | 262 |
| 148 | 3300005543 | Ga0070672_100029329 | Ga0070672_1000293295 | 262 |
| 149 | 3300005616 | Ga0068852_100604131 | Ga0068852_1006041311 | 262 |
| 150 | 3300005718 | Ga0068866_10004840 | Ga0068866_100048401 | 262 |
| 151 | 3300005719 | Ga0068861_100001526 | Ga0068861_1000015262 | 262 |
| 152 | 3300005842 | Ga0068858_100310302 | Ga0068858_1003103022 | 262 |
| 153 | 3300005843 | Ga0068860_100001387 | Ga0068860_10000138716 | 262 |
| 154 | 3300006881 | Ga0068865_100000371 | Ga0068865_10000037117 | 262 |
| 155 | 3300009553 | Ga0105249_10083386 | Ga0105249_100833862 | 262 |
| 156 | 3300013297 | Ga0157378_10038368 | Ga0157378_100383682 | 262 |
| 157 | 3300013306 | Ga0163162_10000948 | Ga0163162_1000094811 | 262 |
| 158 | 3300017792 | Ga0163161_10109283 | Ga0163161_101092832 | 262 |
| 159 | 3300025899 | Ga0207642_10024742 | Ga0207642_100247423 | 262 |
| 160 | 3300025923 | Ga0207681_10021881 | Ga0207681_100218813 | 262 |
| 161 | 3300025938 | Ga0207704_10013981 | Ga0207704_100139813 | 262 |
| 162 | 3300025940 | Ga0207691_10045164 | Ga0207691_100451645 | 262 |
| 163 | 3300025961 | Ga0207712_10076205 | Ga0207712_100762052 | 262 |
| 164 | 3300026035 | Ga0207703_10341341 | Ga0207703_103413412 | 262 |
| 165 | 3300026089 | Ga0207648_10011597 | Ga0207648_100115976 | 262 |
| 166 | 3300026118 | Ga0207675_100015873 | Ga0207675_1000158732 | 262 |
| 167 | 3300026121 | Ga0207683_10078207 | Ga0207683_100782074 | 262 |
| 168 | 3300026142 | Ga0207698_10566753 | Ga0207698_105667531 | 262 |
| 169 | 3300028381 | Ga0268264_10002698 | Ga0268264_1000269810 | 262 |
| 170 | 3300045976 | Ga0466967_0708162 | Ga0466967_0708162_17_814 | 262 |
| 171 | 3300001979 | JGI24740J21852_10001143 | JGI24740J21852_100011433 | 263 |
| 172 | 3300001989 | JGI24739J22299_10009570 | JGI24739J22299_100095703 | 263 |
| 173 | 3300002067 | JGI24735J21928_10000373 | JGI24735J21928_1000037313 | 263 |
| 174 | 3300002067 | JGI24735J21928_10012354 | JGI24735J21928_100123542 | 263 |
| 175 | 3300002075 | JGI24738J21930_10000443 | JGI24738J21930_1000044310 | 263 |
| 176 | 3300002704 | JGI25155J39150_1000366 | JGI25155J39150_10003667 | 263 |
| 177 | 3300002705 | JGI25156J39149_1000649 | JGI25156J39149_10006497 | 263 |
| 178 | 3300002705 | JGI25156J39149_1007814 | JGI25156J39149_10078141 | 263 |
| 179 | 3300002738 | JGI25154J39366_1000534 | JGI25154J39366_10005347 | 263 |
| 180 | 3300002741 | JGI25157J39369_1000665 | JGI25157J39369_10006657 | 263 |
| 181 | 3300003187 | JGI25151J46595_10003224 | JGI25151J46595_100032242 | 263 |
| 182 | 3300003214 | JGI25165J46597_1000809 | JGI25165J46597_100080920 | 263 |
| 183 | 3300003322 | rootL2_10015957 | rootL2_100159575 | 263 |
| 184 | 3300003322 | rootL2_10248635 | rootL2_102486352 | 263 |
| 185 | 3300003323 | rootH1_10107075 | rootH1_101070752 | 263 |
| 186 | 3300003354 | JGI25160J50197_1000099 | JGI25160J50197_10000994 | 263 |
| 187 | 3300003756 | Ga0055533_1000085 | Ga0055533_100008598 | 263 |
| 188 | 3300003756 | Ga0055533_1002390 | Ga0055533_10023905 | 263 |
| 189 | 3300003758 | Ga0055532_1000001 | Ga0055532_1000001188 | 263 |
| 190 | 3300003758 | Ga0055532_1000453 | Ga0055532_100045312 | 263 |
| 191 | 3300003759 | Ga0055525_1000084 | Ga0055525_1000084152 | 263 |
| 192 | 3300003760 | Ga0055527_1000002 | Ga0055527_1000002571 | 263 |
| 193 | 3300003761 | Ga0055535_1000001 | Ga0055535_1000001816 | 263 |
| 194 | 3300003761 | Ga0055535_1000267 | Ga0055535_100026716 | 263 |
| 195 | 3300003761 | Ga0055535_1011018 | Ga0055535_10110181 | 263 |
| 196 | 3300003762 | Ga0055542_1000001 | Ga0055542_1000001188 | 263 |
| 197 | 3300003762 | Ga0055542_1000175 | Ga0055542_100017543 | 263 |
| 198 | 3300003763 | Ga0055529_1000026 | Ga0055529_100002696 | 263 |
| 199 | 3300003763 | Ga0055529_1000131 | Ga0055529_100013116 | 263 |
| 200 | 3300003784 | Ga0055534_1000538 | Ga0055534_10005389 | 263 |
| 201 | 3300003790 | Ga0055528_1003161 | Ga0055528_10031613 | 263 |
| 202 | 3300004625 | Ga0055543_1002594 | Ga0055543_10025942 | 263 |
| 203 | 3300005262 | Ga0065165_1000119 | Ga0065165_100011950 | 263 |
| 204 | 3300005262 | Ga0065165_1000246 | Ga0065165_100024610 | 263 |
| 205 | 3300005262 | Ga0065165_1070105 | Ga0065165_10701051 | 263 |
| 206 | 3300005289 | Ga0065704_10275148 | Ga0065704_102751481 | 263 |
| 207 | 3300005331 | Ga0070670_100011963 | Ga0070670_1000119633 | 263 |
| 208 | 3300005335 | Ga0070666_10374608 | Ga0070666_103746081 | 263 |
| 209 | 3300005366 | Ga0070659_100097304 | Ga0070659_1000973042 | 263 |
| 210 | 3300005367 | Ga0070667_100019088 | Ga0070667_1000190882 | 263 |
| 211 | 3300005455 | Ga0070663_100019014 | Ga0070663_1000190144 | 263 |
| 212 | 3300005455 | Ga0070663_100113582 | Ga0070663_1001135821 | 263 |
| 213 | 3300005456 | Ga0070678_100059197 | Ga0070678_1000591972 | 263 |
| 214 | 3300005548 | Ga0070665_100140959 | Ga0070665_1001409592 | 263 |
| 215 | 3300005548 | Ga0070665_100445739 | Ga0070665_1004457391 | 263 |
| 216 | 3300005563 | Ga0068855_100291933 | Ga0068855_1002919332 | 263 |
| 217 | 3300005614 | Ga0068856_100528818 | Ga0068856_1005288182 | 263 |
| 218 | 3300005616 | Ga0068852_100129141 | Ga0068852_1001291412 | 263 |
| 219 | 3300005841 | Ga0068863_100326917 | Ga0068863_1003269172 | 263 |
| 220 | 3300009036 | Ga0105244_10132344 | Ga0105244_101323442 | 263 |
| 221 | 3300009092 | Ga0105250_10115611 | Ga0105250_101156111 | 263 |
| 222 | 3300009093 | Ga0105240_10013230 | Ga0105240_100132304 | 263 |
| 223 | 3300009093 | Ga0105240_10087772 | Ga0105240_100877724 | 263 |
| 224 | 3300009093 | Ga0105240_10415964 | Ga0105240_104159642 | 263 |
| 225 | 3300009174 | Ga0105241_10439860 | Ga0105241_104398602 | 263 |
| 226 | 3300009176 | Ga0105242_10408823 | Ga0105242_104088232 | 263 |
| 227 | 3300009177 | Ga0105248_10018714 | Ga0105248_100187149 | 263 |
| 228 | 3300009177 | Ga0105248_10073805 | Ga0105248_100738052 | 263 |
| 229 | 3300009545 | Ga0105237_10014914 | Ga0105237_100149147 | 263 |
| 230 | 3300009551 | Ga0105238_10018816 | Ga0105238_100188165 | 263 |
| 231 | 3300010375 | Ga0105239_10009446 | Ga0105239_100094463 | 263 |
| 232 | 3300011119 | Ga0105246_10064217 | Ga0105246_100642172 | 263 |
| 233 | 3300013100 | Ga0157373_10007445 | Ga0157373_100074452 | 263 |
| 234 | 3300013105 | Ga0157369_10000456 | Ga0157369_1000045643 | 263 |
| 235 | 3300013105 | Ga0157369_10082556 | Ga0157369_100825562 | 263 |
| 236 | 3300013306 | Ga0163162_10000793 | Ga0163162_100007932 | 263 |
| 237 | 3300013306 | Ga0163162_10045284 | Ga0163162_100452843 | 263 |
| 238 | 3300013308 | Ga0157375_10217630 | Ga0157375_102176302 | 263 |
| 239 | 3300014326 | Ga0157380_10220260 | Ga0157380_102202602 | 263 |
| 240 | 3300014497 | Ga0182008_10000207 | Ga0182008_1000020711 | 263 |
| 241 | 3300014969 | Ga0157376_10320339 | Ga0157376_103203391 | 263 |
| 242 | 3300015261 | Ga0182006_1024307 | Ga0182006_10243071 | 263 |
| 243 | 3300015261 | Ga0182006_1035752 | Ga0182006_10357522 | 263 |
| 244 | 3300015262 | Ga0182007_10000185 | Ga0182007_1000018525 | 263 |
| 245 | 3300017792 | Ga0163161_10003747 | Ga0163161_100037474 | 263 |
| 246 | 3300025206 | Ga0209435_100080 | Ga0209435_1000809 | 263 |
| 247 | 3300025226 | Ga0209674_100005 | Ga0209674_100005558 | 263 |
| 248 | 3300025226 | Ga0209674_100078 | Ga0209674_100078149 | 263 |
| 249 | 3300025228 | Ga0209672_100001 | Ga0209672_1000011019 | 263 |
| 250 | 3300025228 | Ga0209672_100031 | Ga0209672_10003180 | 263 |
| 251 | 3300025228 | Ga0209672_100158 | Ga0209672_10015822 | 263 |
| 252 | 3300025229 | Ga0209147_100001 | Ga0209147_1000011019 | 263 |
| 253 | 3300025229 | Ga0209147_100004 | Ga0209147_1000041267 | 263 |
| 254 | 3300025229 | Ga0209147_100040 | Ga0209147_100040198 | 263 |
| 255 | 3300025230 | Ga0209563_100025 | Ga0209563_100025153 | 263 |
| 256 | 3300025230 | Ga0209563_103001 | Ga0209563_1030012 | 263 |
| 257 | 3300025233 | Ga0209437_100117 | Ga0209437_10011795 | 263 |
| 258 | 3300025242 | Ga0209258_100001 | Ga0209258_1000011019 | 263 |
| 259 | 3300025242 | Ga0209258_100061 | Ga0209258_100061202 | 263 |
| 260 | 3300025242 | Ga0209258_100788 | Ga0209258_1007889 | 263 |
| 261 | 3300025246 | Ga0209646_1000481 | Ga0209646_100048112 | 263 |
| 262 | 3300025250 | Ga0209026_1000729 | Ga0209026_10007299 | 263 |
| 263 | 3300025254 | Ga0209148_1000003 | Ga0209148_10000031019 | 263 |
| 264 | 3300025254 | Ga0209148_1000070 | Ga0209148_1000070219 | 263 |
| 265 | 3300025256 | Ga0209759_1000029 | Ga0209759_1000029177 | 263 |
| 266 | 3300025256 | Ga0209759_1000087 | Ga0209759_1000087126 | 263 |
| 267 | 3300025256 | Ga0209759_1000440 | Ga0209759_10004409 | 263 |
| 268 | 3300025256 | Ga0209759_1000815 | Ga0209759_100081511 | 263 |
| 269 | 3300025256 | Ga0209759_1004244 | Ga0209759_10042442 | 263 |
| 270 | 3300025261 | Ga0209233_1000043 | Ga0209233_1000043445 | 263 |
| 271 | 3300025263 | Ga0209565_1006273 | Ga0209565_10062731 | 263 |
| 272 | 3300025272 | Ga0209455_1000001 | Ga0209455_10000011019 | 263 |
| 273 | 3300025272 | Ga0209455_1000069 | Ga0209455_100006960 | 263 |
| 274 | 3300025273 | Ga0209673_1000026 | Ga0209673_1000026199 | 263 |
| 275 | 3300025284 | Ga0209130_1002434 | Ga0209130_10024343 | 263 |
| 276 | 3300025284 | Ga0209130_1004456 | Ga0209130_10044563 | 263 |
| 277 | 3300025291 | Ga0209675_1000859 | Ga0209675_10008594 | 263 |
| 278 | 3300025292 | Ga0209676_1006609 | Ga0209676_10066093 | 263 |
| 279 | 3300025294 | Ga0209025_1000133 | Ga0209025_100013398 | 263 |
| 280 | 3300025294 | Ga0209025_1000342 | Ga0209025_100034287 | 263 |
| 281 | 3300025294 | Ga0209025_1040896 | Ga0209025_10408962 | 263 |
| 282 | 3300025295 | Ga0209564_1003544 | Ga0209564_10035446 | 263 |
| 283 | 3300025298 | Ga0209050_1001725 | Ga0209050_100172511 | 263 |
| 284 | 3300025299 | Ga0209256_1000544 | Ga0209256_100054425 | 263 |
| 285 | 3300025302 | Ga0207426_1000215 | Ga0207426_100021549 | 263 |
| 286 | 3300025302 | Ga0207426_1003763 | Ga0207426_10037634 | 263 |
| 287 | 3300025303 | Ga0209051_1050524 | Ga0209051_10505242 | 263 |
| 288 | 3300025735 | Ga0207713_1004266 | Ga0207713_10042663 | 263 |
| 289 | 3300025903 | Ga0207680_10103786 | Ga0207680_101037862 | 263 |
| 290 | 3300025903 | Ga0207680_10119693 | Ga0207680_101196931 | 263 |
| 291 | 3300025904 | Ga0207647_10016751 | Ga0207647_100167516 | 263 |
| 292 | 3300025904 | Ga0207647_10085536 | Ga0207647_100855361 | 263 |
| 293 | 3300025913 | Ga0207695_10016943 | Ga0207695_100169433 | 263 |
| 294 | 3300025913 | Ga0207695_10253648 | Ga0207695_102536482 | 263 |
| 295 | 3300025913 | Ga0207695_10295599 | Ga0207695_102955992 | 263 |
| 296 | 3300025914 | Ga0207671_10060153 | Ga0207671_100601532 | 263 |
| 297 | 3300025924 | Ga0207694_10020992 | Ga0207694_100209923 | 263 |
| 298 | 3300025924 | Ga0207694_10177367 | Ga0207694_101773672 | 263 |
| 299 | 3300025925 | Ga0207650_10016686 | Ga0207650_100166863 | 263 |
| 300 | 3300025931 | Ga0207644_10106844 | Ga0207644_101068442 | 263 |
| 301 | 3300025941 | Ga0207711_10073342 | Ga0207711_100733422 | 263 |
| 302 | 3300025949 | Ga0207667_10020362 | Ga0207667_100203622 | 263 |
| 303 | 3300025949 | Ga0207667_10241642 | Ga0207667_102416422 | 263 |
| 304 | 3300025986 | Ga0207658_10028141 | Ga0207658_100281414 | 263 |
| 305 | 3300026067 | Ga0207678_10237222 | Ga0207678_102372222 | 263 |
| 306 | 3300026116 | Ga0207674_10290127 | Ga0207674_102901272 | 263 |
| 307 | 3300026121 | Ga0207683_10174164 | Ga0207683_101741642 | 263 |
| 308 | 3300027312 | Ga0209371_1000971 | Ga0209371_100097111 | 263 |
| 309 | 3300028379 | Ga0268266_10433660 | Ga0268266_104336601 | 263 |
| 310 | 3300028379 | Ga0268266_10535846 | Ga0268266_105358462 | 263 |
| 311 | 3300030500 | Ga0268256_1000821 | Ga0268256_100082111 | 263 |
| 312 | 3300030744 | Ga0316181_1053488 | Ga0316181_10534882 | 263 |
| 313 | 3300030745 | Ga0316182_1212983 | Ga0316182_12129833 | 263 |
| 314 | 3300031241 | Ga0265325_10202811 | Ga0265325_102028111 | 263 |
| 315 | 3300031251 | Ga0265327_10006362 | Ga0265327_100063623 | 263 |
| 316 | 3300031911 | Ga0307412_10000059 | Ga0307412_1000005949 | 263 |
| 317 | 3300037312 | Ga0395899_0012056 | Ga0395899_0012056_3771_4562 | 263 |
| 318 | 3300037418 | Ga0395900_0001667 | Ga0395900_0001667_3389_4180 | 263 |
| 319 | 3300037418 | Ga0395900_0041760 | Ga0395900_0041760_1949_2740 | 263 |
| 320 | 3300037418 | Ga0395900_0116412 | Ga0395900_0116412_698_1489 | 263 |
| 321 | 3300037466 | Ga0395898_0004523 | Ga0395898_0004523_6154_6945 | 263 |
| 322 | 3300037471 | Ga0395905_0000020 | Ga0395905_0000020_296572_297363 | 263 |
| 323 | 3300037471 | Ga0395905_0020275 | Ga0395905_0020275_3643_4449 | 263 |
| 324 | 3300037471 | Ga0395905_0139245 | Ga0395905_0139245_857_1648 | 263 |
| 325 | 3300037471 | Ga0395905_0372555 | Ga0395905_0372555_354_1145 | 263 |
| 326 | 3300038443 | Ga0395901_0000095 | Ga0395901_0000095_69067_69858 | 263 |
| 327 | 3300038443 | Ga0395901_0081262 | Ga0395901_0081262_839_1630 | 263 |
| 328 | 3300044656 | Ga0466969_0000534 | Ga0466969_0000534_9017_9838 | 263 |
| 329 | 3300044658 | Ga0466972_0041504 | Ga0466972_0041504_24_815 | 263 |
| 330 | 3300044672 | Ga0466982_0008424 | Ga0466982_0008424_2849_3640 | 263 |
| 331 | 3300044683 | Ga0466965_0005137 | Ga0466965_0005137_75_1001 | 263 |
| 332 | 3300044683 | Ga0466965_0247169 | Ga0466965_0247169_82_873 | 263 |
| 333 | 3300044684 | Ga0466966_0001355 | Ga0466966_0001355_7186_8007 | 263 |
| 334 | 3300044684 | Ga0466966_0168932 | Ga0466966_0168932_392_1183 | 263 |
| 335 | 3300044693 | Ga0466961_0001415 | Ga0466961_0001415_4743_5534 | 263 |
| 336 | 3300044693 | Ga0466961_0003278 | Ga0466961_0003278_4271_5062 | 263 |
| 337 | 3300044765 | Ga0466970_0032201 | Ga0466970_0032201_1679_2500 | 263 |
| 338 | 3300044765 | Ga0466970_0131257 | Ga0466970_0131257_308_1099 | 263 |
| 339 | 3300044765 | Ga0466970_0219295 | Ga0466970_0219295_222_1013 | 263 |
| 340 | 3300044901 | Ga0466960_0054056 | Ga0466960_0054056_515_1306 | 263 |
| 341 | 3300045049 | Ga0466959_0021533 | Ga0466959_0021533_2687_3478 | 263 |
| 342 | 3300045049 | Ga0466959_0139905 | Ga0466959_0139905_612_1433 | 263 |
| 343 | 3300046454 | Ga0495592_0002222 | Ga0495592_0002222_10071_10862 | 263 |
| 344 | 3300046455 | Ga0495603_0011710 | Ga0495603_0011710_26_817 | 263 |
| 345 | 3300046457 | Ga0495590_0000092 | Ga0495590_0000092_25176_25967 | 263 |
| 346 | 3300046457 | Ga0495590_0009089 | Ga0495590_0009089_2427_3218 | 263 |
| 347 | 3300046457 | Ga0495590_0015933 | Ga0495590_0015933_848_1639 | 263 |
| 348 | 3300046457 | Ga0495590_0091739 | Ga0495590_0091739_31_822 | 263 |
| 349 | 3300046459 | Ga0495629_0010469 | Ga0495629_0010469_1172_1963 | 263 |
| 350 | 3300046460 | Ga0495638_0059567 | Ga0495638_0059567_94_885 | 263 |
| 351 | 3300046462 | Ga0495651_0150363 | Ga0495651_0150363_613_1404 | 263 |
| 352 | 3300046463 | Ga0495653_0038202 | Ga0495653_0038202_2364_3155 | 263 |
| 353 | 3300046463 | Ga0495653_0057096 | Ga0495653_0057096_1363_2154 | 263 |
| 354 | 3300046471 | Ga0495650_0003970 | Ga0495650_0003970_6476_7267 | 263 |
| 355 | 3300046471 | Ga0495650_0077004 | Ga0495650_0077004_339_1130 | 263 |
| 356 | 3300046472 | Ga0495580_0098520 | Ga0495580_0098520_250_1041 | 263 |
| 357 | 3300046473 | Ga0495582_0059010 | Ga0495582_0059010_990_1781 | 263 |
| 358 | 3300046474 | Ga0495605_0003123 | Ga0495605_0003123_1294_2085 | 263 |
| 359 | 3300046474 | Ga0495605_0086101 | Ga0495605_0086101_422_1213 | 263 |
| 360 | 3300046477 | Ga0495664_0014049 | Ga0495664_0014049_1178_1969 | 263 |
| 361 | 3300046477 | Ga0495664_0114487 | Ga0495664_0114487_649_1440 | 263 |
| 362 | 3300046477 | Ga0495664_0200477 | Ga0495664_0200477_14_805 | 263 |
| 363 | 3300046501 | Ga0495607_0110608 | Ga0495607_0110608_241_1032 | 263 |
| 364 | 3300046506 | Ga0495583_0003496 | Ga0495583_0003496_4538_5329 | 263 |
| 365 | 3300046507 | Ga0495606_0020198 | Ga0495606_0020198_323_1114 | 263 |
| 366 | 3300046507 | Ga0495606_0029281 | Ga0495606_0029281_716_1507 | 263 |
| 367 | 3300046507 | Ga0495606_0031695 | Ga0495606_0031695_1248_2039 | 263 |
| 368 | 3300046507 | Ga0495606_0133281 | Ga0495606_0133281_292_1083 | 263 |
| 369 | 3300046511 | Ga0495608_0000402 | Ga0495608_0000402_7653_8444 | 263 |
| 370 | 3300046512 | Ga0495610_0000624 | Ga0495610_0000624_31053_31844 | 263 |
| 371 | 3300046512 | Ga0495610_0152924 | Ga0495610_0152924_32_823 | 263 |
| 372 | 3300046513 | Ga0495616_0068026 | Ga0495616_0068026_813_1604 | 263 |
| 373 | 3300046513 | Ga0495616_0190379 | Ga0495616_0190379_93_884 | 263 |
| 374 | 3300046514 | Ga0495618_0005572 | Ga0495618_0005572_4203_4994 | 263 |
| 375 | 3300046516 | Ga0495628_0037532 | Ga0495628_0037532_555_1346 | 263 |
| 376 | 3300046516 | Ga0495628_0178465 | Ga0495628_0178465_545_1336 | 263 |
| 377 | 3300046517 | Ga0495630_0160011 | Ga0495630_0160011_338_1129 | 263 |
| 378 | 3300046518 | Ga0495631_0100307 | Ga0495631_0100307_259_1050 | 263 |
| 379 | 3300046522 | Ga0495643_0155386 | Ga0495643_0155386_112_903 | 263 |
| 380 | 3300046523 | Ga0495644_0106116 | Ga0495644_0106116_65_856 | 263 |
| 381 | 3300046526 | Ga0495666_0000878 | Ga0495666_0000878_12257_13048 | 263 |
| 382 | 3300046526 | Ga0495666_0202837 | Ga0495666_0202837_30_821 | 263 |
| 383 | 3300046528 | Ga0495642_0004439 | Ga0495642_0004439_1396_2187 | 263 |
| 384 | 3300046529 | Ga0495652_0001389 | Ga0495652_0001389_21085_21876 | 263 |
| 385 | 3300046529 | Ga0495652_0198458 | Ga0495652_0198458_322_1113 | 263 |
| 386 | 3300046531 | Ga0495665_0000973 | Ga0495665_0000973_12257_13048 | 263 |
| 387 | 3300046533 | Ga0495640_0002062 | Ga0495640_0002062_1024_1815 | 263 |
| 388 | 3300046535 | Ga0495586_0079736 | Ga0495586_0079736_473_1264 | 263 |
| 389 | 3300046539 | Ga0495621_0040892 | Ga0495621_0040892_457_1248 | 263 |
| 390 | 3300046542 | Ga0495597_0001164 | Ga0495597_0001164_13761_14552 | 263 |
| 391 | 3300046558 | Ga0495633_0177513 | Ga0495633_0177513_89_880 | 263 |
| 392 | 3300046615 | Ga0495656_0019443 | Ga0495656_0019443_1426_2217 | 263 |
| 393 | 3300046642 | Ga0495634_0003103 | Ga0495634_0003103_7630_8421 | 263 |
| 394 | 3300046648 | Ga0495611_0151985 | Ga0495611_0151985_112_903 | 263 |
| 395 | 3300046660 | Ga0495625_0002351 | Ga0495625_0002351_12172_12963 | 263 |
| 396 | 3300046663 | Ga0495635_0000831 | Ga0495635_0000831_13640_14431 | 263 |
| 397 | 3300046674 | Ga0495588_0062706 | Ga0495588_0062706_220_1011 | 263 |
| 398 | 3300046678 | Ga0495599_0263396 | Ga0495599_0263396_169_960 | 263 |
| 399 | 3300046680 | Ga0495646_0051695 | Ga0495646_0051695_408_1199 | 263 |
| 400 | 3300046680 | Ga0495646_0066205 | Ga0495646_0066205_606_1397 | 263 |
| 401 | 3300046684 | Ga0495669_0014543 | Ga0495669_0014543_345_1136 | 263 |
| 402 | 3300046684 | Ga0495669_0014864 | Ga0495669_0014864_215_1006 | 263 |
| 403 | 3300046690 | Ga0495624_0001875 | Ga0495624_0001875_10918_11709 | 263 |
| 404 | 3300046691 | Ga0495670_0027512 | Ga0495670_0027512_1565_2356 | 263 |
| 405 | 3300046692 | Ga0495671_0119186 | Ga0495671_0119186_444_1235 | 263 |
| 406 | 3300046694 | Ga0495649_0000215 | Ga0495649_0000215_10203_10994 | 263 |
| 407 | 3300046694 | Ga0495649_0012734 | Ga0495649_0012734_3340_4131 | 263 |
| 408 | 3300046694 | Ga0495649_0096849 | Ga0495649_0096849_526_1317 | 263 |
| 409 | 3300046794 | Ga0495589_0026337 | Ga0495589_0026337_481_1272 | 263 |
| 410 | 3300046794 | Ga0495589_0073149 | Ga0495589_0073149_224_1015 | 263 |
| 411 | 3300046809 | Ga0495600_0000230 | Ga0495600_0000230_16332_17123 | 263 |
| 412 | 3300046810 | Ga0495660_0043818 | Ga0495660_0043818_754_1545 | 263 |
| 413 | 3300046810 | Ga0495660_0087042 | Ga0495660_0087042_105_896 | 263 |
| 414 | 3300046810 | Ga0495660_0155196 | Ga0495660_0155196_238_1029 | 263 |
| 415 | 3300047315 | Ga0495581_0000998 | Ga0495581_0000998_2386_3177 | 263 |
| 416 | 3300047317 | Ga0495604_0109200 | Ga0495604_0109200_822_1613 | 263 |
| 417 | 3300047319 | Ga0495674_0050986 | Ga0495674_0050986_1368_2159 | 263 |
| 418 | 3300047319 | Ga0495674_0291932 | Ga0495674_0291932_355_1146 | 263 |
| 419 | 3300047321 | Ga0495676_0201295 | Ga0495676_0201295_338_1129 | 263 |
| 420 | 3300047323 | Ga0495683_0001534 | Ga0495683_0001534_11611_12402 | 263 |
| 421 | 3300047323 | Ga0495683_0010627 | Ga0495683_0010627_2188_2979 | 263 |
| 422 | 3300047323 | Ga0495683_0050651 | Ga0495683_0050651_23_814 | 263 |
| 423 | 3300047323 | Ga0495683_0170868 | Ga0495683_0170868_165_956 | 263 |
| 424 | 3300047443 | Ga0495687_016907 | Ga0495687_016907_2123_2914 | 263 |
| 425 | 3300047443 | Ga0495687_017543 | Ga0495687_017543_1189_1980 | 263 |
| 426 | 3300047444 | Ga0495675_0001459 | Ga0495675_0001459_1379_2170 | 263 |
| 427 | 3300047445 | Ga0495677_0032430 | Ga0495677_0032430_480_1271 | 263 |
| 428 | 3300047447 | Ga0495685_016099 | Ga0495685_016099_1608_2399 | 263 |
| 429 | 3300047469 | Ga0495673_0069619 | Ga0495673_0069619_584_1375 | 263 |
| 430 | 3300047469 | Ga0495673_0098510 | Ga0495673_0098510_91_882 | 263 |
| 431 | 3300047472 | Ga0495686_0000181 | Ga0495686_0000181_931_1722 | 263 |
| 432 | 3300047472 | Ga0495686_0057601 | Ga0495686_0057601_344_1135 | 263 |
| 433 | 3300047673 | Ga0495593_0001222 | Ga0495593_0001222_9011_9802 | 263 |
| 434 | 3300047673 | Ga0495593_0030535 | Ga0495593_0030535_2072_2863 | 263 |
| 435 | 3300047673 | Ga0495593_0037705 | Ga0495593_0037705_1287_2078 | 263 |
| 436 | 3300047673 | Ga0495593_0163896 | Ga0495593_0163896_292_1083 | 263 |
| 437 | 3300048088 | Ga0495602_0027695 | Ga0495602_0027695_535_1326 | 263 |
| 438 | 3300048088 | Ga0495602_0076896 | Ga0495602_0076896_860_1651 | 263 |
| 439 | 3300048088 | Ga0495602_0220202 | Ga0495602_0220202_87_878 | 263 |
| 440 | 3300048088 | Ga0495602_0399010 | Ga0495602_0399010_66_857 | 263 |
| 441 | 3300048089 | Ga0495614_0000632 | Ga0495614_0000632_10918_11709 | 263 |
| 442 | 3300048091 | Ga0495626_0025539 | Ga0495626_0025539_394_1185 | 263 |
| 443 | 3300048091 | Ga0495626_0034869 | Ga0495626_0034869_871_1662 | 263 |
| 444 | 3300048091 | Ga0495626_0063657 | Ga0495626_0063657_683_1474 | 263 |
| 445 | 3300048091 | Ga0495626_0071960 | Ga0495626_0071960_131_922 | 263 |
| 446 | 3300048903 | Ga0496100_0000078 | Ga0496100_0000078_2484_3275 | 263 |
| 447 | 3300048903 | Ga0496100_0000932 | Ga0496100_0000932_6255_7046 | 263 |
| 448 | 3300048903 | Ga0496100_0002476 | Ga0496100_0002476_745_1536 | 263 |
| 449 | 3300048904 | Ga0496101_0000519 | Ga0496101_0000519_16690_17481 | 263 |
| 450 | 3300048904 | Ga0496101_0000538 | Ga0496101_0000538_2550_3341 | 263 |
| 451 | 3300048904 | Ga0496101_0043710 | Ga0496101_0043710_1765_2556 | 263 |
| 452 | 3300048905 | Ga0496102_0000165 | Ga0496102_0000165_2402_3193 | 263 |
| 453 | 3300048905 | Ga0496102_0003580 | Ga0496102_0003580_7333_8124 | 263 |
| 454 | 3300048905 | Ga0496102_0013163 | Ga0496102_0013163_4395_5186 | 263 |
| 455 | 3300048905 | Ga0496102_0081749 | Ga0496102_0081749_287_1078 | 263 |
| 456 | 3300048906 | Ga0496103_0000360 | Ga0496103_0000360_33639_34430 | 263 |
| 457 | 3300048906 | Ga0496103_0000644 | Ga0496103_0000644_21912_22703 | 263 |
| 458 | 3300048906 | Ga0496103_0014851 | Ga0496103_0014851_1189_1980 | 263 |
| 459 | 3300048907 | Ga0496104_0002481 | Ga0496104_0002481_10063_10854 | 263 |
| 460 | 3300048907 | Ga0496104_0008205 | Ga0496104_0008205_754_1545 | 263 |
| 461 | 3300048907 | Ga0496104_0149761 | Ga0496104_0149761_925_1716 | 263 |
| 462 | 3300048908 | Ga0496105_0000375 | Ga0496105_0000375_7160_7951 | 263 |
| 463 | 3300048909 | Ga0496106_0000045 | Ga0496106_0000045_6602_7393 | 263 |
| 464 | 3300048909 | Ga0496106_0005706 | Ga0496106_0005706_1064_1891 | 263 |
| 465 | 3300048909 | Ga0496106_0013224 | Ga0496106_0013224_38_829 | 263 |
| 466 | 3300048909 | Ga0496106_0022374 | Ga0496106_0022374_2243_3034 | 263 |
| 467 | 3300048910 | Ga0496107_0005245 | Ga0496107_0005245_558_1349 | 263 |
| 468 | 3300048910 | Ga0496107_0061491 | Ga0496107_0061491_1862_2653 | 263 |
| 469 | 3300048910 | Ga0496107_0484641 | Ga0496107_0484641_48_839 | 263 |
| 470 | 3300048912 | Ga0496109_0042598 | Ga0496109_0042598_2553_3380 | 263 |
| 471 | 3300048912 | Ga0496109_0308223 | Ga0496109_0308223_633_1424 | 263 |
| 472 | 3300048913 | Ga0496110_0003384 | Ga0496110_0003384_10282_11073 | 263 |
| 473 | 3300048913 | Ga0496110_0060777 | Ga0496110_0060777_2290_3117 | 263 |
| 474 | 3300048913 | Ga0496110_0113947 | Ga0496110_0113947_369_1160 | 263 |
| 475 | 3300048913 | Ga0496110_0253973 | Ga0496110_0253973_190_981 | 263 |
| 476 | 3300048914 | Ga0496111_0018131 | Ga0496111_0018131_3280_4071 | 263 |
| 477 | 3300048914 | Ga0496111_0066681 | Ga0496111_0066681_1018_1809 | 263 |
| 478 | 3300048915 | Ga0496112_0011630 | Ga0496112_0011630_5161_5952 | 263 |
| 479 | 3300048915 | Ga0496112_0024005 | Ga0496112_0024005_500_1291 | 263 |
| 480 | 3300048916 | Ga0496113_0003212 | Ga0496113_0003212_5508_6299 | 263 |
| 481 | 3300048916 | Ga0496113_0080747 | Ga0496113_0080747_439_1230 | 263 |
| 482 | 3300048917 | Ga0496114_0039656 | Ga0496114_0039656_1747_2538 | 263 |
| 483 | 3300048919 | Ga0496116_0001434 | Ga0496116_0001434_5381_6172 | 263 |
| 484 | 3300048919 | Ga0496116_0067321 | Ga0496116_0067321_1029_1820 | 263 |
| 485 | 3300048920 | Ga0496117_0000707 | Ga0496117_0000707_2389_3180 | 263 |
| 486 | 3300048920 | Ga0496117_0002321 | Ga0496117_0002321_15395_16186 | 263 |
| 487 | 3300048920 | Ga0496117_0007204 | Ga0496117_0007204_4366_5157 | 263 |
| 488 | 3300048920 | Ga0496117_0015333 | Ga0496117_0015333_2061_2852 | 263 |
| 489 | 3300048920 | Ga0496117_0072054 | Ga0496117_0072054_461_1252 | 263 |
| 490 | 3300048921 | Ga0496118_0000283 | Ga0496118_0000283_86027_86818 | 263 |
| 491 | 3300048921 | Ga0496118_0008341 | Ga0496118_0008341_1825_2616 | 263 |
| 492 | 3300048921 | Ga0496118_0012458 | Ga0496118_0012458_521_1312 | 263 |
| 493 | 3300048921 | Ga0496118_0024001 | Ga0496118_0024001_1765_2556 | 263 |
| 494 | 3300048921 | Ga0496118_0051414 | Ga0496118_0051414_197_988 | 263 |
| 495 | 3300048922 | Ga0496119_0038458 | Ga0496119_0038458_2269_3060 | 263 |
| 496 | 3300048923 | Ga0496120_0066373 | Ga0496120_0066373_82_873 | 263 |
| 497 | 3300048924 | Ga0496121_0002547 | Ga0496121_0002547_6779_7570 | 263 |
| 498 | 3300048924 | Ga0496121_0002717 | Ga0496121_0002717_17338_18129 | 263 |
| 499 | 3300048924 | Ga0496121_0008605 | Ga0496121_0008605_4576_5367 | 263 |
| 500 | 3300048924 | Ga0496121_0011190 | Ga0496121_0011190_6097_6888 | 263 |
| 501 | 3300048924 | Ga0496121_0017457 | Ga0496121_0017457_6047_6838 | 263 |
| 502 | 3300048924 | Ga0496121_0024609 | Ga0496121_0024609_3028_3819 | 263 |
| 503 | 3300048925 | Ga0496122_0006237 | Ga0496122_0006237_7006_7797 | 263 |
| 504 | 3300048925 | Ga0496122_0056368 | Ga0496122_0056368_837_1628 | 263 |
| 505 | 3300048925 | Ga0496122_0079799 | Ga0496122_0079799_1207_1998 | 263 |
| 506 | 3300048926 | Ga0496123_0006105 | Ga0496123_0006105_7162_7953 | 263 |
| 507 | 3300048926 | Ga0496123_0015633 | Ga0496123_0015633_2797_3588 | 263 |
| 508 | 3300048926 | Ga0496123_0189826 | Ga0496123_0189826_45_836 | 263 |
| 509 | 3300048927 | Ga0496124_0006512 | Ga0496124_0006512_1711_2502 | 263 |
| 510 | 3300048927 | Ga0496124_0010208 | Ga0496124_0010208_8065_8856 | 263 |
| 511 | 3300048927 | Ga0496124_0178290 | Ga0496124_0178290_769_1560 | 263 |
| 512 | 3300048927 | Ga0496124_0187702 | Ga0496124_0187702_125_916 | 263 |
| 513 | 3300048928 | Ga0496125_0007063 | Ga0496125_0007063_1992_2783 | 263 |
| 514 | 3300048928 | Ga0496125_0071998 | Ga0496125_0071998_174_965 | 263 |
| 515 | 3300048929 | Ga0496126_0000031 | Ga0496126_0000031_263352_264143 | 263 |
| 516 | 3300048929 | Ga0496126_0354917 | Ga0496126_0354917_66_857 | 263 |
| 517 | 3300049569 | Ga0501032_0267834 | Ga0501032_0267834_178_975 | 263 |
| 518 | 3300049586 | Ga0501070_0009081 | Ga0501070_0009081_771_1568 | 263 |
| 519 | 3300049742 | Ga0501080_0184125 | Ga0501080_0184125_146_943 | 263 |
| 520 | 3300053111 | Ga0500572_054582 | Ga0500572_054582_213_1004 | 263 |
| 521 | 3300053121 | Ga0500607_007274 | Ga0500607_007274_1858_2649 | 263 |
| 522 | 3300053730 | Ga0500645_057158 | Ga0500645_057158_195_986 | 263 |
| 523 | 3300061719 | Ga0466962_0006725 | Ga0466962_0006725_2943_3734 | 263 |
| 524 | iso_pu_bacteria | 8055301274 | 8055302250 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i5d-assembly1.cif.gz_A | crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form | 0.9482 | 11 | 258 |
| 5itv-assembly3.cif.gz_D | crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh | 0.947 | 11 | 258 |
| 1uzl-assembly1.cif.gz_B-2 | maba from mycobacterium tuberculosis | 0.9452 | 12 | 261 |
| 4bmn-assembly1.cif.gz_D | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.945 | 11 | 258 |
| 1uls-assembly1.cif.gz_C | crystal structure of tt0140 from thermus thermophilus hb8 | 0.9448 | 11 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0ISZ5_12_118_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9559 | 11 | 91 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9546 | 7 | 190 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.947 | 11 | 258 | 3.40.50.720 |
| 2ntnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9464 | 12 | 259 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9419 | 99 | 194 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535TRS1-F1-model_v4 | SDR family oxidoreductase | 0.9652 | 11 | 128 |
|
| AF-U4KRH9-F1-model_v4 | Putative acetoin dehydrogenase BudC (EC 1.1.1.303) | 0.954 | 10 | 191 |
GO:0052587
|
| AF-A0A429CA30-F1-model_v4 | 3-hydroxybutyrate dehydrogenase | 0.9517 | 8 | 254 |
GO:0003858
|
| AF-A0A6I5VG95-F1-model_v4 | SDR family oxidoreductase | 0.951 | 7 | 260 |
GO:0016616
|
| AF-A0A384AZA9-F1-model_v4 | 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) | 0.9472 | 14 | 190 |
GO:0006633
GO:0016616 GO:0048038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar