F459169

General Info

Members Datasets Scaffolds Average Seq Length
524 309 479 263

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0005137|Ga0466965_0005137_75_1001
Length 308
Sequence MRRDDIPPGQKVWARHIGRQPPREETLLQDDAAPRVATREREGKRMPLYDSLRPRPELRVLVTAGASGIGAAIARAFHEAGSRVHVCDIDRAGLDRLVADTPGITGSMADVSVAADVDQVFEDVRGCLGGLDVLINNAGIAGPTGPIESFDAGGWERTVSVNLNSQFYFARRAVPLLKQSSANPVLISMSSVAGRLGYAFRTPYASTKWAIVGLTKSLAIELGPQGIRVNAILPGVVEGERMDGVIASRAASLGIGVDEMRQEYLRKISLRRMVTASDVAAMALFLCSPAAHNLSGQAISVDGNLEYL

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
4 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
5 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
6 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
7 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
8 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
9 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
10 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
11 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
12 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
13 2738543013 Variovorax sp. BT01 Isolate Unclassified
14 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
15 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
16 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
17 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
18 2818991452 Burkholderia cepacia 561 Isolate Unclassified
19 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
20 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
21 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
22 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
23 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
24 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
25 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
26 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
27 2904564687 Burkholderia sp. 571 Isolate Unclassified
28 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
29 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
30 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
31 2928170801 Burkholderia sp. 572 Isolate Unclassified
32 2928536128 Burkholderia sola 565 Isolate Unclassified
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
35 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
36 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
37 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
41 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
42 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
43 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
51 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
52 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
53 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
54 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
55 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
56 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
57 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
114 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
166 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
167 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
301 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
305 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
306 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
307 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
308 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
309 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.41
Metatranscriptomes 0
Isolates 8.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.74
Nodule 1.15
Rhizoplane 8.02
Rhizosphere 62.21
Stem 0
Stem Tuber 0
Unclassified 14.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001143 3300001979 Bacteria 11990
2 JGI24739J22299_10009570 3300001989 Bacteria 3607
3 JGI24735J21928_10000373 3300002067 Bacteria 15664
4 JGI24735J21928_10012354 3300002067 Bacteria 2700
5 JGI24738J21930_10000443 3300002075 Bacteria 11696
6 JGI25155J39150_1000366 3300002704 Bacteria 13753
7 JGI25156J39149_1000649 3300002705 Bacteria 19021
8 JGI25156J39149_1007814 3300002705 Bacteria 2764
9 JGI25154J39366_1000534 3300002738 Bacteria 19006
10 JGI25157J39369_1000665 3300002741 Bacteria 19017
11 JGI25151J46595_10003224 3300003187 Bacteria 9120
12 JGI25165J46597_1000809 3300003214 Bacteria 23655
13 rootL2_10015957 3300003322 Bacteria 5335
14 rootL2_10248635 3300003322 Bacteria 1922
15 rootH1_10107075 3300003323 Bacteria 2190
16 JGI25160J50197_1000099 3300003354 Bacteria 86777
17 Ga0055533_1000085 3300003756 Bacteria 124875
18 Ga0055533_1002390 3300003756 Bacteria 4283
19 Ga0055532_1000001 3300003758 Bacteria 1119836
20 Ga0055532_1000453 3300003758 Bacteria 19021
21 Ga0055525_1000084 3300003759 Bacteria 155319
22 Ga0055527_1000002 3300003760 Bacteria 830488
23 Ga0055535_1000001 3300003761 Bacteria 1119836
24 Ga0055535_1000267 3300003761 Bacteria 54799
25 Ga0055535_1011018 3300003761 Bacteria 1453
26 Ga0055542_1000001 3300003762 Bacteria 1119836
27 Ga0055542_1000175 3300003762 Bacteria 79760
28 Ga0055529_1000026 3300003763 Bacteria 293254
29 Ga0055529_1000131 3300003763 Bacteria 105530
30 Ga0055526_1010741 3300003771 Bacteria 4221
31 Ga0055537_1000315 3300003773 Bacteria 33077
32 Ga0055524_1015969 3300003775 Bacteria 2716
33 Ga0055534_1000100 3300003784 Bacteria 66813
34 Ga0055534_1000538 3300003784 Bacteria 20301
35 Ga0055528_1003161 3300003790 Bacteria 8429
36 Ga0055543_1002594 3300004625 Bacteria 5848
37 Ga0065165_1000119 3300005262 Bacteria 134464
38 Ga0065165_1000246 3300005262 Bacteria 93310
39 Ga0065165_1070105 3300005262 Bacteria 934
40 Ga0065704_10275148 3300005289 Bacteria 934
41 Ga0070670_100011963 3300005331 Bacteria 7422
42 Ga0070666_10374608 3300005335 Bacteria 1021
43 Ga0070689_100714280 3300005340 Bacteria 876
44 Ga0070691_10145659 3300005341 Bacteria 1211
45 Ga0070669_100034775 3300005353 Bacteria 3648
46 Ga0070659_100097304 3300005366 Bacteria 2365
47 Ga0070667_100019088 3300005367 Bacteria 5686
48 Ga0070663_100019014 3300005455 Bacteria 4518
49 Ga0070663_100113582 3300005455 Bacteria 2038
50 Ga0070678_100048846 3300005456 Bacteria 3050
51 Ga0070678_100059197 3300005456 Bacteria 2815
52 Ga0068867_100003791 3300005459 Bacteria 10636
53 Ga0070672_100029329 3300005543 Bacteria 4125
54 Ga0070696_100023024 3300005546 Bacteria 4235
55 Ga0070665_100140959 3300005548 Bacteria 2414
56 Ga0070665_100445739 3300005548 Bacteria 1304
57 Ga0070704_100509627 3300005549 Bacteria 1045
58 Ga0068855_100291933 3300005563 Bacteria 1807
59 Ga0068856_100528818 3300005614 Bacteria 1200
60 Ga0068852_100129141 3300005616 Bacteria 2325
61 Ga0068852_100604131 3300005616 Bacteria 1101
62 Ga0068866_10004840 3300005718 Bacteria 5529
63 Ga0068861_100001526 3300005719 Bacteria 14664
64 Ga0068863_100326917 3300005841 Bacteria 1490
65 Ga0068858_100128729 3300005842 Bacteria 2373
66 Ga0068858_100310302 3300005842 Bacteria 1506
67 Ga0068860_100001387 3300005843 Bacteria 26293
68 Ga0068860_100056914 3300005843 Bacteria 3716
69 Ga0068865_100000371 3300006881 Bacteria 24845
70 Ga0097620_100053067 3300006931 Bacteria 4076
71 Ga0105244_10132344 3300009036 Bacteria 1203
72 Ga0105250_10115611 3300009092 Bacteria 1101
73 Ga0105240_10013230 3300009093 Bacteria 11349
74 Ga0105240_10087772 3300009093 Bacteria 3808
75 Ga0105240_10415964 3300009093 Bacteria 1511
76 Ga0105247_10359292 3300009101 Bacteria 1026
77 Ga0105241_10439860 3300009174 Bacteria 1151
78 Ga0105242_10408823 3300009176 Bacteria 1269
79 Ga0105248_10018714 3300009177 Bacteria 7658
80 Ga0105248_10073805 3300009177 Bacteria 3834
81 Ga0105237_10014914 3300009545 Bacteria 8103
82 Ga0105238_10018816 3300009551 Bacteria 7030
83 Ga0105249_10083386 3300009553 Bacteria 2975
84 Ga0105239_10009446 3300010375 Bacteria 10988
85 Ga0105246_10064217 3300011119 Bacteria 2564
86 Ga0105246_10090335 3300011119 Bacteria 2205
87 Ga0157373_10007445 3300013100 Bacteria 8143
88 Ga0157369_10000456 3300013105 Bacteria 54115
89 Ga0157369_10082556 3300013105 Bacteria 3438
90 Ga0157378_10038368 3300013297 Bacteria 4245
91 Ga0163162_10000793 3300013306 Bacteria 29396
92 Ga0163162_10000948 3300013306 Bacteria 26987
93 Ga0163162_10045284 3300013306 Bacteria 4408
94 Ga0157375_10217630 3300013308 Bacteria 2068
95 Ga0157380_10220260 3300014326 Bacteria 1697
96 Ga0182008_10000207 3300014497 Bacteria 46359
97 Ga0157379_10075838 3300014968 Bacteria 3011
98 Ga0157376_10320339 3300014969 Bacteria 1474
99 Ga0182006_1024307 3300015261 Bacteria 2500
100 Ga0182006_1035752 3300015261 Bacteria 1978
101 Ga0182007_10000185 3300015262 Bacteria 42160
102 Ga0163161_10003747 3300017792 Bacteria 10648
103 Ga0163161_10109283 3300017792 Bacteria 2065
104 Ga0209435_100080 3300025206 Bacteria 49104
105 Ga0209566_100786 3300025225 Bacteria 16786
106 Ga0209674_100005 3300025226 Bacteria 1708125
107 Ga0209674_100078 3300025226 Bacteria 206136
108 Ga0209672_100001 3300025228 Bacteria 2828210
109 Ga0209672_100031 3300025228 Bacteria 332889
110 Ga0209672_100158 3300025228 Bacteria 58904
111 Ga0209147_100001 3300025229 Bacteria 2384371
112 Ga0209147_100004 3300025229 Bacteria 1371850
113 Ga0209147_100034 3300025229 Bacteria 346646
114 Ga0209147_100040 3300025229 Bacteria 307612
115 Ga0209563_100025 3300025230 Bacteria 596456
116 Ga0209563_103001 3300025230 Bacteria 3622
117 Ga0209437_100117 3300025233 Bacteria 209271
118 Ga0209258_100001 3300025242 Bacteria 2384269
119 Ga0209258_100061 3300025242 Bacteria 313501
120 Ga0209258_100788 3300025242 Bacteria 19070
121 Ga0209646_1000481 3300025246 Bacteria 19783
122 Ga0209026_1000729 3300025250 Bacteria 19150
123 Ga0209148_1000003 3300025254 Bacteria 2384288
124 Ga0209148_1000070 3300025254 Bacteria 332889
125 Ga0209759_1000029 3300025256 Bacteria 286968
126 Ga0209759_1000087 3300025256 Bacteria 166470
127 Ga0209759_1000440 3300025256 Bacteria 48778
128 Ga0209759_1000815 3300025256 Bacteria 24792
129 Ga0209759_1004244 3300025256 Bacteria 5411
130 Ga0209233_1000043 3300025261 Bacteria 509723
131 Ga0209565_1000076 3300025263 Bacteria 161760
132 Ga0209565_1006273 3300025263 Bacteria 3358
133 Ga0209455_1000001 3300025272 Bacteria 2384278
134 Ga0209455_1000069 3300025272 Bacteria 308247
135 Ga0209673_1000026 3300025273 Bacteria 373739
136 Ga0209673_1008488 3300025273 Bacteria 4566
137 Ga0209130_1002434 3300025284 Bacteria 9333
138 Ga0209130_1004456 3300025284 Bacteria 5301
139 Ga0209675_1000047 3300025291 Bacteria 221683
140 Ga0209675_1000859 3300025291 Bacteria 19681
141 Ga0209676_1006609 3300025292 Bacteria 5671
142 Ga0209025_1000133 3300025294 Bacteria 195885
143 Ga0209025_1000342 3300025294 Bacteria 102758
144 Ga0209025_1006938 3300025294 Bacteria 8619
145 Ga0209025_1040896 3300025294 Bacteria 1996
146 Ga0209564_1000553 3300025295 Bacteria 60114
147 Ga0209564_1003544 3300025295 Bacteria 10502
148 Ga0209758_1011181 3300025297 Bacteria 5238
149 Ga0209050_1001725 3300025298 Bacteria 21758
150 Ga0209256_1000544 3300025299 Bacteria 54207
151 Ga0209256_1002942 3300025299 Bacteria 12780
152 Ga0207426_1000215 3300025302 Bacteria 136757
153 Ga0207426_1003763 3300025302 Bacteria 7907
154 Ga0209051_1050524 3300025303 Bacteria 1392
155 Ga0207713_1004266 3300025735 Bacteria 9329
156 Ga0207642_10024742 3300025899 Bacteria 2418
157 Ga0207680_10103786 3300025903 Bacteria 1831
158 Ga0207680_10119693 3300025903 Bacteria 1720
159 Ga0207647_10016751 3300025904 Bacteria 4994
160 Ga0207647_10085536 3300025904 Bacteria 1886
161 Ga0207695_10016943 3300025913 Bacteria 8502
162 Ga0207695_10253648 3300025913 Bacteria 1658
163 Ga0207695_10295599 3300025913 Bacteria 1511
164 Ga0207671_10060153 3300025914 Bacteria 2818
165 Ga0207681_10021881 3300025923 Bacteria 4071
166 Ga0207694_10020992 3300025924 Bacteria 4944
167 Ga0207694_10177367 3300025924 Bacteria 1727
168 Ga0207650_10016686 3300025925 Bacteria 5135
169 Ga0207644_10106844 3300025931 Bacteria 2111
170 Ga0207704_10013981 3300025938 Bacteria 4039
171 Ga0207691_10045164 3300025940 Bacteria 4051
172 Ga0207711_10073342 3300025941 Bacteria 2975
173 Ga0207667_10020362 3300025949 Bacteria 7382
174 Ga0207667_10241642 3300025949 Bacteria 1848
175 Ga0207712_10076205 3300025961 Bacteria 2427
176 Ga0207658_10028141 3300025986 Bacteria 3956
177 Ga0207703_10341341 3300026035 Bacteria 1377
178 Ga0207678_10237222 3300026067 Bacteria 1562
179 Ga0207648_10011597 3300026089 Bacteria 8298
180 Ga0207674_10290127 3300026116 Bacteria 1585
181 Ga0207675_100015873 3300026118 Bacteria 7024
182 Ga0207683_10078207 3300026121 Bacteria 2931
183 Ga0207683_10174164 3300026121 Bacteria 1949
184 Ga0207698_10566753 3300026142 Bacteria 1115
185 Ga0209371_1000971 3300027312 Bacteria 22220
186 Ga0268266_10433660 3300028379 Bacteria 1247
187 Ga0268266_10535846 3300028379 Bacteria 1120
188 Ga0268264_10002698 3300028381 Bacteria 15494
189 Ga0268256_1000821 3300030500 Bacteria 22220
190 Ga0316181_1053488 3300030744 Bacteria 1490
191 Ga0316182_1212983 3300030745 Bacteria 4164
192 Ga0265330_10050874 3300031235 Bacteria 1817
193 Ga0265325_10010668 3300031241 Bacteria 5307
194 Ga0265325_10202811 3300031241 Bacteria 914
195 Ga0265340_10006435 3300031247 Bacteria 6466
196 Ga0265327_10006362 3300031251 Bacteria 9468
197 Ga0265313_10012675 3300031595 Bacteria 5122
198 Ga0265314_10110872 3300031711 Bacteria 1744
199 Ga0265342_10064224 3300031712 Bacteria 2155
200 Ga0307412_10000059 3300031911 Bacteria 138772
201 Ga0395899_0012056 3300037312 Bacteria 6624
202 Ga0395900_0001667 3300037418 Bacteria 25970
203 Ga0395900_0041760 3300037418 Bacteria 4727
204 Ga0395900_0116412 3300037418 Bacteria 2743
205 Ga0395898_0004523 3300037466 Bacteria 15190
206 Ga0395905_0000020 3300037471 Bacteria 337672
207 Ga0395905_0020275 3300037471 Bacteria 6299
208 Ga0395905_0139245 3300037471 Bacteria 2283
209 Ga0395905_0372555 3300037471 Bacteria 1321
210 Ga0395901_0000095 3300038443 Bacteria 119290
211 Ga0395901_0081262 3300038443 Bacteria 3385
212 Ga0400483_160367 3300039062 Bacteria 2022
213 Ga0466969_0000534 3300044656 Bacteria 20884
214 Ga0466972_0041504 3300044658 Bacteria 2240
215 Ga0466982_0008424 3300044672 Bacteria 5185
216 Ga0466965_0005137 3300044683 Bacteria 5874
217 Ga0466965_0247169 3300044683 Bacteria 956
218 Ga0466966_0001355 3300044684 Bacteria 15735
219 Ga0466966_0168932 3300044684 Bacteria 1330
220 Ga0466961_0001415 3300044693 Bacteria 14877
221 Ga0466961_0003278 3300044693 Bacteria 10082
222 Ga0466970_0032201 3300044765 Bacteria 2770
223 Ga0466970_0131257 3300044765 Bacteria 1376
224 Ga0466970_0219295 3300044765 Bacteria 1061
225 Ga0466960_0054056 3300044901 Bacteria 1948
226 Ga0466959_0021533 3300045049 Bacteria 4755
227 Ga0466959_0139905 3300045049 Bacteria 1711
228 Ga0466967_0708162 3300045976 Bacteria 997
229 Ga0495592_0002222 3300046454 Bacteria 13694
230 Ga0495592_0035395 3300046454 Bacteria 3762
231 Ga0495592_0072482 3300046454 Bacteria 2506
232 Ga0495603_0011710 3300046455 Bacteria 5308
233 Ga0495590_0000092 3300046457 Bacteria 55212
234 Ga0495590_0009089 3300046457 Bacteria 3774
235 Ga0495590_0015933 3300046457 Bacteria 2718
236 Ga0495590_0091739 3300046457 Bacteria 1075
237 Ga0495591_001975 3300046458 Bacteria 11975
238 Ga0495629_0000432 3300046459 Bacteria 34964
239 Ga0495629_0010469 3300046459 Bacteria 6747
240 Ga0495638_0059567 3300046460 Bacteria 2364
241 Ga0495651_0037980 3300046462 Bacteria 3750
242 Ga0495651_0150363 3300046462 Bacteria 1679
243 Ga0495653_0008865 3300046463 Bacteria 8231
244 Ga0495653_0018434 3300046463 Bacteria 5668
245 Ga0495653_0038202 3300046463 Bacteria 3769
246 Ga0495653_0057096 3300046463 Bacteria 2973
247 Ga0495650_0003970 3300046471 Bacteria 10396
248 Ga0495650_0077004 3300046471 Bacteria 1295
249 Ga0495580_0098520 3300046472 Bacteria 2033
250 Ga0495582_0007807 3300046473 Bacteria 5916
251 Ga0495582_0059010 3300046473 Bacteria 2116
252 Ga0495605_0003123 3300046474 Bacteria 9980
253 Ga0495605_0086101 3300046474 Bacteria 1462
254 Ga0495662_0003788 3300046476 Bacteria 7623
255 Ga0495664_0000813 3300046477 Bacteria 15979
256 Ga0495664_0014049 3300046477 Bacteria 4536
257 Ga0495664_0114487 3300046477 Bacteria 1629
258 Ga0495664_0200477 3300046477 Bacteria 1209
259 Ga0495596_0005232 3300046500 Bacteria 6164
260 Ga0495607_0110608 3300046501 Bacteria 1457
261 Ga0495583_0003496 3300046506 Bacteria 11897
262 Ga0495606_0003628 3300046507 Bacteria 16217
263 Ga0495606_0020198 3300046507 Bacteria 4922
264 Ga0495606_0029281 3300046507 Bacteria 3869
265 Ga0495606_0031695 3300046507 Bacteria 3671
266 Ga0495606_0133281 3300046507 Bacteria 1474
267 Ga0495608_0000402 3300046511 Bacteria 30297
268 Ga0495608_0001030 3300046511 Bacteria 19558
269 Ga0495610_0000624 3300046512 Bacteria 35024
270 Ga0495610_0152924 3300046512 Bacteria 982
271 Ga0495616_0068026 3300046513 Bacteria 1730
272 Ga0495616_0190379 3300046513 Bacteria 907
273 Ga0495618_0005572 3300046514 Bacteria 7659
274 Ga0495628_0021726 3300046516 Bacteria 5274
275 Ga0495628_0037532 3300046516 Bacteria 3884
276 Ga0495628_0178465 3300046516 Bacteria 1607
277 Ga0495630_0003995 3300046517 Bacteria 10320
278 Ga0495630_0160011 3300046517 Bacteria 1714
279 Ga0495631_0100307 3300046518 Bacteria 1246
280 Ga0495643_0155386 3300046522 Bacteria 1129
281 Ga0495644_0106116 3300046523 Bacteria 1064
282 Ga0495666_0000120 3300046526 Bacteria 32561
283 Ga0495666_0000878 3300046526 Bacteria 14038
284 Ga0495666_0202837 3300046526 Bacteria 911
285 Ga0495642_0004439 3300046528 Bacteria 5444
286 Ga0495642_0048064 3300046528 Bacteria 1749
287 Ga0495652_0001389 3300046529 Bacteria 26896
288 Ga0495652_0198458 3300046529 Bacteria 1525
289 Ga0495652_0407105 3300046529 Bacteria 961
290 Ga0495665_0000239 3300046531 Bacteria 27614
291 Ga0495665_0000973 3300046531 Bacteria 15178
292 Ga0495640_0001503 3300046533 Bacteria 18377
293 Ga0495640_0002062 3300046533 Bacteria 16043
294 Ga0495586_0079736 3300046535 Bacteria 1798
295 Ga0495587_0019682 3300046536 Bacteria 4174
296 Ga0495621_0040892 3300046539 Bacteria 1626
297 Ga0495621_0075831 3300046539 Bacteria 1247
298 Ga0495597_0001164 3300046542 Bacteria 19754
299 Ga0495645_0021906 3300046543 Bacteria 4621
300 Ga0495645_0110359 3300046543 Bacteria 1947
301 Ga0495622_0000115 3300046557 Bacteria 69111
302 Ga0495633_0177513 3300046558 Bacteria 981
303 Ga0495656_0019443 3300046615 Bacteria 2622
304 Ga0495634_0003103 3300046642 Bacteria 13505
305 Ga0495611_0029670 3300046648 Bacteria 2399
306 Ga0495611_0151985 3300046648 Bacteria 1081
307 Ga0495625_0002351 3300046660 Bacteria 20624
308 Ga0495635_0000831 3300046663 Bacteria 20224
309 Ga0495635_0004416 3300046663 Bacteria 9739
310 Ga0495661_0001916 3300046665 Bacteria 16560
311 Ga0495588_0062706 3300046674 Bacteria 1927
312 Ga0495657_0047863 3300046675 Bacteria 2888
313 Ga0495599_0034104 3300046678 Bacteria 3198
314 Ga0495599_0074568 3300046678 Bacteria 2118
315 Ga0495599_0263396 3300046678 Bacteria 1047
316 Ga0495623_0002004 3300046679 Bacteria 13669
317 Ga0495646_0012933 3300046680 Bacteria 5305
318 Ga0495646_0051695 3300046680 Bacteria 2485
319 Ga0495646_0066205 3300046680 Bacteria 2137
320 Ga0495669_0014543 3300046684 Bacteria 3363
321 Ga0495669_0014864 3300046684 Bacteria 3330
322 Ga0495613_0028567 3300046689 Bacteria 4148
323 Ga0495624_0001875 3300046690 Bacteria 16011
324 Ga0495624_0007388 3300046690 Bacteria 7715
325 Ga0495624_0046645 3300046690 Bacteria 2755
326 Ga0495670_0027512 3300046691 Bacteria 2817
327 Ga0495671_0019792 3300046692 Bacteria 3554
328 Ga0495671_0119186 3300046692 Bacteria 1288
329 Ga0495671_0237397 3300046692 Bacteria 881
330 Ga0495649_0000215 3300046694 Bacteria 50655
331 Ga0495649_0012734 3300046694 Bacteria 4880
332 Ga0495649_0026534 3300046694 Bacteria 3220
333 Ga0495649_0096849 3300046694 Bacteria 1570
334 Ga0495589_0012645 3300046794 Bacteria 4365
335 Ga0495589_0026337 3300046794 Bacteria 2947
336 Ga0495589_0046992 3300046794 Bacteria 2140
337 Ga0495589_0073149 3300046794 Bacteria 1673
338 Ga0495600_0000230 3300046809 Bacteria 30997
339 Ga0495600_0004212 3300046809 Bacteria 8585
340 Ga0495600_0131593 3300046809 Bacteria 1626
341 Ga0495660_0043818 3300046810 Bacteria 2465
342 Ga0495660_0087042 3300046810 Bacteria 1630
343 Ga0495660_0155196 3300046810 Bacteria 1127
344 Ga0495581_0000998 3300047315 Bacteria 15249
345 Ga0495581_0003591 3300047315 Bacteria 8921
346 Ga0495604_0101326 3300047317 Bacteria 2115
347 Ga0495604_0109200 3300047317 Bacteria 2019
348 Ga0495636_0135298 3300047318 Bacteria 1098
349 Ga0495674_0050986 3300047319 Bacteria 3649
350 Ga0495674_0189074 3300047319 Bacteria 1712
351 Ga0495674_0291932 3300047319 Bacteria 1333
352 Ga0495676_0015232 3300047321 Bacteria 6855
353 Ga0495676_0201295 3300047321 Bacteria 1383
354 Ga0495680_0005568 3300047322 Bacteria 11822
355 Ga0495680_0055439 3300047322 Bacteria 3074
356 Ga0495680_0285779 3300047322 Bacteria 1161
357 Ga0495683_0001534 3300047323 Bacteria 14974
358 Ga0495683_0010627 3300047323 Bacteria 4857
359 Ga0495683_0010823 3300047323 Bacteria 4811
360 Ga0495683_0050651 3300047323 Bacteria 2077
361 Ga0495683_0170868 3300047323 Bacteria 999
362 Ga0495687_016907 3300047443 Bacteria 3656
363 Ga0495687_017543 3300047443 Bacteria 3566
364 Ga0495675_0001188 3300047444 Bacteria 15769
365 Ga0495675_0001459 3300047444 Bacteria 14311
366 Ga0495675_0193411 3300047444 Bacteria 1241
367 Ga0495677_0032430 3300047445 Bacteria 1903
368 Ga0495679_000478 3300047446 Bacteria 28912
369 Ga0495685_016099 3300047447 Bacteria 2555
370 Ga0495673_0001172 3300047469 Bacteria 22155
371 Ga0495673_0069619 3300047469 Bacteria 1483
372 Ga0495673_0098510 3300047469 Bacteria 1185
373 Ga0495681_0113434 3300047470 Bacteria 1171
374 Ga0495686_0000181 3300047472 Bacteria 119765
375 Ga0495686_0057601 3300047472 Bacteria 2425
376 Ga0495593_0001222 3300047673 Bacteria 15022
377 Ga0495593_0013364 3300047673 Bacteria 4684
378 Ga0495593_0030535 3300047673 Bacteria 2949
379 Ga0495593_0037705 3300047673 Bacteria 2612
380 Ga0495593_0163896 3300047673 Bacteria 1122
381 Ga0495602_0013684 3300048088 Bacteria 8277
382 Ga0495602_0027695 3300048088 Bacteria 5441
383 Ga0495602_0076896 3300048088 Bacteria 2826
384 Ga0495602_0220202 3300048088 Bacteria 1433
385 Ga0495602_0399010 3300048088 Bacteria 981
386 Ga0495614_0000632 3300048089 Bacteria 14716
387 Ga0495614_0001485 3300048089 Bacteria 10155
388 Ga0495626_0025539 3300048091 Bacteria 2888
389 Ga0495626_0034869 3300048091 Bacteria 2405
390 Ga0495626_0063657 3300048091 Bacteria 1672
391 Ga0495626_0071960 3300048091 Bacteria 1552
392 Ga0496100_0000078 3300048903 Bacteria 54410
393 Ga0496100_0000932 3300048903 Bacteria 13978
394 Ga0496100_0002476 3300048903 Bacteria 9386
395 Ga0496101_0000519 3300048904 Bacteria 24028
396 Ga0496101_0000538 3300048904 Bacteria 23231
397 Ga0496101_0043710 3300048904 Bacteria 3202
398 Ga0496101_0196144 3300048904 Bacteria 1560
399 Ga0496102_0000165 3300048905 Bacteria 89141
400 Ga0496102_0003580 3300048905 Bacteria 13159
401 Ga0496102_0013163 3300048905 Bacteria 7157
402 Ga0496102_0039206 3300048905 Bacteria 4279
403 Ga0496102_0081749 3300048905 Bacteria 2979
404 Ga0496102_0106370 3300048905 Bacteria 2611
405 Ga0496103_0000360 3300048906 Bacteria 41308
406 Ga0496103_0000644 3300048906 Bacteria 26380
407 Ga0496103_0014851 3300048906 Bacteria 4630
408 Ga0496104_0002481 3300048907 Bacteria 15897
409 Ga0496104_0008205 3300048907 Bacteria 9271
410 Ga0496104_0149761 3300048907 Bacteria 2240
411 Ga0496105_0000375 3300048908 Bacteria 29508
412 Ga0496106_0000045 3300048909 Bacteria 103269
413 Ga0496106_0005706 3300048909 Bacteria 9208
414 Ga0496106_0013224 3300048909 Bacteria 6092
415 Ga0496106_0022374 3300048909 Bacteria 4695
416 Ga0496107_0005245 3300048910 Bacteria 8844
417 Ga0496107_0061491 3300048910 Bacteria 2719
418 Ga0496107_0484641 3300048910 Bacteria 918
419 Ga0496109_0042598 3300048912 Bacteria 4113
420 Ga0496109_0308223 3300048912 Bacteria 1493
421 Ga0496110_0003384 3300048913 Bacteria 12181
422 Ga0496110_0060777 3300048913 Bacteria 3333
423 Ga0496110_0113947 3300048913 Bacteria 2432
424 Ga0496110_0253973 3300048913 Bacteria 1600
425 Ga0496111_0018131 3300048914 Bacteria 4873
426 Ga0496111_0066681 3300048914 Bacteria 2614
427 Ga0496112_0011630 3300048915 Bacteria 8049
428 Ga0496112_0024005 3300048915 Bacteria 5834
429 Ga0496113_0003212 3300048916 Bacteria 9742
430 Ga0496113_0080747 3300048916 Bacteria 2491
431 Ga0496114_0039656 3300048917 Bacteria 3897
432 Ga0496116_0001434 3300048919 Bacteria 26780
433 Ga0496116_0067321 3300048919 Bacteria 2288
434 Ga0496117_0000707 3300048920 Bacteria 52889
435 Ga0496117_0002321 3300048920 Bacteria 24382
436 Ga0496117_0002393 3300048920 Bacteria 23847
437 Ga0496117_0007204 3300048920 Bacteria 10965
438 Ga0496117_0007634 3300048920 Bacteria 10492
439 Ga0496117_0015333 3300048920 Bacteria 6540
440 Ga0496117_0072054 3300048920 Bacteria 2312
441 Ga0496118_0000283 3300048921 Bacteria 89206
442 Ga0496118_0000647 3300048921 Bacteria 56808
443 Ga0496118_0003472 3300048921 Bacteria 19786
444 Ga0496118_0008341 3300048921 Bacteria 10727
445 Ga0496118_0012458 3300048921 Bacteria 8162
446 Ga0496118_0024001 3300048921 Bacteria 5278
447 Ga0496118_0051414 3300048921 Bacteria 3152
448 Ga0496119_0038458 3300048922 Bacteria 3091
449 Ga0496120_0066373 3300048923 Bacteria 1996
450 Ga0496121_0002547 3300048924 Bacteria 27634
451 Ga0496121_0002717 3300048924 Bacteria 26409
452 Ga0496121_0008605 3300048924 Bacteria 11948
453 Ga0496121_0011190 3300048924 Bacteria 10001
454 Ga0496121_0017457 3300048924 Bacteria 7332
455 Ga0496121_0024609 3300048924 Bacteria 5749
456 Ga0496122_0006237 3300048925 Bacteria 13796
457 Ga0496122_0056368 3300048925 Bacteria 2930
458 Ga0496122_0079799 3300048925 Bacteria 2285
459 Ga0496123_0006105 3300048926 Bacteria 11810
460 Ga0496123_0015633 3300048926 Bacteria 6210
461 Ga0496123_0189826 3300048926 Bacteria 1064
462 Ga0496124_0006512 3300048927 Bacteria 12709
463 Ga0496124_0010208 3300048927 Bacteria 9542
464 Ga0496124_0178290 3300048927 Bacteria 1638
465 Ga0496124_0187702 3300048927 Bacteria 1585
466 Ga0496125_0007063 3300048928 Bacteria 11996
467 Ga0496125_0071998 3300048928 Bacteria 2697
468 Ga0496126_0000031 3300048929 Bacteria 373371
469 Ga0496126_0000105 3300048929 Bacteria 198893
470 Ga0496126_0354917 3300048929 Bacteria 1198
471 Ga0495682_0013848 3300049460 Bacteria 3063
472 Ga0501032_0267834 3300049569 Bacteria 1107
473 Ga0501070_0009081 3300049586 Bacteria 8409
474 Ga0501080_0184125 3300049742 Bacteria 1921
475 Ga0501035_0602374 3300049822 Bacteria 895
476 Ga0500572_054582 3300053111 Bacteria 1199
477 Ga0500607_007274 3300053121 Bacteria 6864
478 Ga0500645_057158 3300053730 Bacteria 1131
479 Ga0466962_0006725 3300061719 Bacteria 5511

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0135298 Ga0495636_0135298_433_1080 214
2 3300005549 Ga0070704_100509627 Ga0070704_1005096271 246
3 3300005340 Ga0070689_100714280 Ga0070689_1007142801 247
4 3300005341 Ga0070691_10145659 Ga0070691_101456592 247
5 3300005546 Ga0070696_100023024 Ga0070696_1000230242 247
6 3300046539 Ga0495621_0075831 Ga0495621_0075831_80_826 247
7 3300049822 Ga0501035_0602374 Ga0501035_0602374_10_759 249
8 3300047322 Ga0495680_0005568 Ga0495680_0005568_22_777 251
9 3300048904 Ga0496101_0196144 Ga0496101_0196144_11_766 251
10 3300031235 Ga0265330_10050874 Ga0265330_100508742 253
11 3300031241 Ga0265325_10010668 Ga0265325_100106683 253
12 3300031247 Ga0265340_10006435 Ga0265340_100064354 253
13 3300031595 Ga0265313_10012675 Ga0265313_100126752 253
14 3300031711 Ga0265314_10110872 Ga0265314_101108722 253
15 3300031712 Ga0265342_10064224 Ga0265342_100642242 253
16 3300046516 Ga0495628_0021726 Ga0495628_0021726_1911_2717 253
17 3300003771 Ga0055526_1010741 Ga0055526_10107412 255
18 3300003773 Ga0055537_1000315 Ga0055537_100031520 255
19 3300003775 Ga0055524_1015969 Ga0055524_10159693 255
20 3300003784 Ga0055534_1000100 Ga0055534_10001006 255
21 3300025263 Ga0209565_1000076 Ga0209565_100007635 255
22 3300025273 Ga0209673_1008488 Ga0209673_10084885 255
23 3300025291 Ga0209675_1000047 Ga0209675_100004735 255
24 3300025294 Ga0209025_1006938 Ga0209025_100693811 255
25 3300025295 Ga0209564_1000553 Ga0209564_100055329 255
26 3300025297 Ga0209758_1011181 Ga0209758_10111812 255
27 3300025299 Ga0209256_1002942 Ga0209256_10029428 255
28 3300046463 Ga0495653_0008865 Ga0495653_0008865_6614_7396 255
29 iso_pu_bacteria 2548876994 2550696606 255
30 3300039062 Ga0400483_160367 Ga0400483_160367_730_1503 256
31 3300025225 Ga0209566_100786 Ga0209566_10078612 257
32 3300025229 Ga0209147_100034 Ga0209147_10003486 257
33 3300046507 Ga0495606_0003628 Ga0495606_0003628_15161_15952 258
34 3300046528 Ga0495642_0048064 Ga0495642_0048064_893_1684 258
35 3300046543 Ga0495645_0021906 Ga0495645_0021906_368_1159 258
36 3300046678 Ga0495599_0074568 Ga0495599_0074568_65_856 258
37 3300046692 Ga0495671_0237397 Ga0495671_0237397_80_871 258
38 3300046694 Ga0495649_0026534 Ga0495649_0026534_2062_2853 258
39 3300046794 Ga0495589_0046992 Ga0495589_0046992_537_1328 258
40 3300046809 Ga0495600_0131593 Ga0495600_0131593_610_1401 258
41 3300047319 Ga0495674_0189074 Ga0495674_0189074_202_993 258
42 3300047444 Ga0495675_0193411 Ga0495675_0193411_319_1110 258
43 iso_pu_bacteria 2808606384 2808969506 258
44 iso_pu_bacteria 2808606390 2809004337 258
45 iso_pu_bacteria 2808606391 2809012915 258
46 iso_pu_bacteria 8039098773 8039101273 258
47 iso_pu_bacteria 2508501125 2509126549 259
48 iso_pu_bacteria 2513237166 2514053829 259
49 iso_pu_bacteria 2562617112 2563065097 259
50 iso_pu_bacteria 2599185239 2599735094 259
51 iso_pu_bacteria 2600255067 2600811491 259
52 iso_pu_bacteria 2711768613 2713481916 259
53 iso_pu_bacteria 2738541296 2738821072 259
54 iso_pu_bacteria 2738541298 2738833554 259
55 iso_pu_bacteria 2738541306 2738876961 259
56 iso_pu_bacteria 2738543002 2739186710 259
57 iso_pu_bacteria 2738543008 2739223554 259
58 iso_pu_bacteria 2738543013 2739250694 259
59 iso_pu_bacteria 2808606384 2808974207 259
60 iso_pu_bacteria 2808606390 2809008993 259
61 iso_pu_bacteria 2808606391 2809016144 259
62 iso_pu_bacteria 2818991445 2819595282 259
63 iso_pu_bacteria 2818991452 2819632002 259
64 iso_pu_bacteria 2857357740 2857366158 259
65 iso_pu_bacteria 2863421361 2863422401 259
66 iso_pu_bacteria 2884811622 2884812644 259
67 iso_pu_bacteria 2884836552 2884841124 259
68 iso_pu_bacteria 2884852848 2884855999 259
69 iso_pu_bacteria 2896154374 2896157076 259
70 iso_pu_bacteria 2904483920 2904484727 259
71 iso_pu_bacteria 2904541872 2904547002 259
72 iso_pu_bacteria 2904564687 2904564896 259
73 iso_pu_bacteria 2904571731 2904572408 259
74 iso_pu_bacteria 2919527303 2919530470 259
75 iso_pu_bacteria 2921643360 2921655268 259
76 iso_pu_bacteria 2928170801 2928172172 259
77 iso_pu_bacteria 2928536128 2928537734 259
78 iso_pu_bacteria 2929160207 2929164474 259
79 iso_pu_bacteria 2945934425 2945939367 259
80 iso_pu_bacteria 2954767861 2954768297 259
81 iso_pu_bacteria 2990703756 2990706710 259
82 iso_pu_bacteria 641736151 642424634 259
83 iso_pu_bacteria 8018845410 8018852039 259
84 iso_pu_bacteria 8021120328 8021120442 259
85 iso_pu_bacteria 8048746797 8048748775 259
86 3300046454 Ga0495592_0035395 Ga0495592_0035395_1150_1947 260
87 3300046454 Ga0495592_0072482 Ga0495592_0072482_190_987 260
88 3300046458 Ga0495591_001975 Ga0495591_001975_739_1536 260
89 3300046459 Ga0495629_0000432 Ga0495629_0000432_3012_3809 260
90 3300046462 Ga0495651_0037980 Ga0495651_0037980_2376_3173 260
91 3300046463 Ga0495653_0018434 Ga0495653_0018434_1222_2019 260
92 3300046473 Ga0495582_0007807 Ga0495582_0007807_254_1051 260
93 3300046476 Ga0495662_0003788 Ga0495662_0003788_6473_7270 260
94 3300046477 Ga0495664_0000813 Ga0495664_0000813_4837_5634 260
95 3300046500 Ga0495596_0005232 Ga0495596_0005232_2438_3235 260
96 3300046511 Ga0495608_0001030 Ga0495608_0001030_8676_9473 260
97 3300046517 Ga0495630_0003995 Ga0495630_0003995_7620_8417 260
98 3300046526 Ga0495666_0000120 Ga0495666_0000120_1593_2390 260
99 3300046529 Ga0495652_0407105 Ga0495652_0407105_57_854 260
100 3300046531 Ga0495665_0000239 Ga0495665_0000239_5105_5902 260
101 3300046533 Ga0495640_0001503 Ga0495640_0001503_10495_11292 260
102 3300046536 Ga0495587_0019682 Ga0495587_0019682_92_889 260
103 3300046543 Ga0495645_0110359 Ga0495645_0110359_166_963 260
104 3300046557 Ga0495622_0000115 Ga0495622_0000115_58562_59359 260
105 3300046648 Ga0495611_0029670 Ga0495611_0029670_731_1528 260
106 3300046663 Ga0495635_0004416 Ga0495635_0004416_1168_1965 260
107 3300046665 Ga0495661_0001916 Ga0495661_0001916_4422_5219 260
108 3300046675 Ga0495657_0047863 Ga0495657_0047863_1529_2326 260
109 3300046678 Ga0495599_0034104 Ga0495599_0034104_1824_2621 260
110 3300046679 Ga0495623_0002004 Ga0495623_0002004_5580_6377 260
111 3300046680 Ga0495646_0012933 Ga0495646_0012933_1661_2458 260
112 3300046689 Ga0495613_0028567 Ga0495613_0028567_65_862 260
113 3300046690 Ga0495624_0007388 Ga0495624_0007388_6733_7530 260
114 3300046690 Ga0495624_0046645 Ga0495624_0046645_1143_1940 260
115 3300046692 Ga0495671_0019792 Ga0495671_0019792_1132_1929 260
116 3300046794 Ga0495589_0012645 Ga0495589_0012645_2593_3390 260
117 3300046809 Ga0495600_0004212 Ga0495600_0004212_2109_2906 260
118 3300047315 Ga0495581_0003591 Ga0495581_0003591_4974_5771 260
119 3300047317 Ga0495604_0101326 Ga0495604_0101326_1133_1930 260
120 3300047321 Ga0495676_0015232 Ga0495676_0015232_5149_5946 260
121 3300047322 Ga0495680_0055439 Ga0495680_0055439_1138_1935 260
122 3300047322 Ga0495680_0285779 Ga0495680_0285779_64_861 260
123 3300047323 Ga0495683_0010823 Ga0495683_0010823_1906_2703 260
124 3300047444 Ga0495675_0001188 Ga0495675_0001188_13318_14115 260
125 3300047446 Ga0495679_000478 Ga0495679_000478_27861_28658 260
126 3300047469 Ga0495673_0001172 Ga0495673_0001172_20006_20803 260
127 3300047470 Ga0495681_0113434 Ga0495681_0113434_130_927 260
128 3300047673 Ga0495593_0013364 Ga0495593_0013364_1981_2778 260
129 3300048088 Ga0495602_0013684 Ga0495602_0013684_2438_3235 260
130 3300048089 Ga0495614_0001485 Ga0495614_0001485_9014_9811 260
131 3300048905 Ga0496102_0039206 Ga0496102_0039206_2728_3525 260
132 3300048905 Ga0496102_0106370 Ga0496102_0106370_622_1419 260
133 3300048920 Ga0496117_0002393 Ga0496117_0002393_13927_14724 260
134 3300048920 Ga0496117_0007634 Ga0496117_0007634_1478_2275 260
135 3300048921 Ga0496118_0000647 Ga0496118_0000647_619_1416 260
136 3300048921 Ga0496118_0003472 Ga0496118_0003472_13866_14663 260
137 3300048929 Ga0496126_0000105 Ga0496126_0000105_50347_51144 260
138 3300049460 Ga0495682_0013848 Ga0495682_0013848_612_1409 260
139 3300005842 Ga0068858_100128729 Ga0068858_1001287292 261
140 3300005843 Ga0068860_100056914 Ga0068860_1000569142 261
141 3300006931 Ga0097620_100053067 Ga0097620_1000530672 261
142 3300009101 Ga0105247_10359292 Ga0105247_103592921 261
143 3300011119 Ga0105246_10090335 Ga0105246_100903352 261
144 3300014968 Ga0157379_10075838 Ga0157379_100758382 261
145 3300005353 Ga0070669_100034775 Ga0070669_1000347753 262
146 3300005456 Ga0070678_100048846 Ga0070678_1000488462 262
147 3300005459 Ga0068867_100003791 Ga0068867_1000037917 262
148 3300005543 Ga0070672_100029329 Ga0070672_1000293295 262
149 3300005616 Ga0068852_100604131 Ga0068852_1006041311 262
150 3300005718 Ga0068866_10004840 Ga0068866_100048401 262
151 3300005719 Ga0068861_100001526 Ga0068861_1000015262 262
152 3300005842 Ga0068858_100310302 Ga0068858_1003103022 262
153 3300005843 Ga0068860_100001387 Ga0068860_10000138716 262
154 3300006881 Ga0068865_100000371 Ga0068865_10000037117 262
155 3300009553 Ga0105249_10083386 Ga0105249_100833862 262
156 3300013297 Ga0157378_10038368 Ga0157378_100383682 262
157 3300013306 Ga0163162_10000948 Ga0163162_1000094811 262
158 3300017792 Ga0163161_10109283 Ga0163161_101092832 262
159 3300025899 Ga0207642_10024742 Ga0207642_100247423 262
160 3300025923 Ga0207681_10021881 Ga0207681_100218813 262
161 3300025938 Ga0207704_10013981 Ga0207704_100139813 262
162 3300025940 Ga0207691_10045164 Ga0207691_100451645 262
163 3300025961 Ga0207712_10076205 Ga0207712_100762052 262
164 3300026035 Ga0207703_10341341 Ga0207703_103413412 262
165 3300026089 Ga0207648_10011597 Ga0207648_100115976 262
166 3300026118 Ga0207675_100015873 Ga0207675_1000158732 262
167 3300026121 Ga0207683_10078207 Ga0207683_100782074 262
168 3300026142 Ga0207698_10566753 Ga0207698_105667531 262
169 3300028381 Ga0268264_10002698 Ga0268264_1000269810 262
170 3300045976 Ga0466967_0708162 Ga0466967_0708162_17_814 262
171 3300001979 JGI24740J21852_10001143 JGI24740J21852_100011433 263
172 3300001989 JGI24739J22299_10009570 JGI24739J22299_100095703 263
173 3300002067 JGI24735J21928_10000373 JGI24735J21928_1000037313 263
174 3300002067 JGI24735J21928_10012354 JGI24735J21928_100123542 263
175 3300002075 JGI24738J21930_10000443 JGI24738J21930_1000044310 263
176 3300002704 JGI25155J39150_1000366 JGI25155J39150_10003667 263
177 3300002705 JGI25156J39149_1000649 JGI25156J39149_10006497 263
178 3300002705 JGI25156J39149_1007814 JGI25156J39149_10078141 263
179 3300002738 JGI25154J39366_1000534 JGI25154J39366_10005347 263
180 3300002741 JGI25157J39369_1000665 JGI25157J39369_10006657 263
181 3300003187 JGI25151J46595_10003224 JGI25151J46595_100032242 263
182 3300003214 JGI25165J46597_1000809 JGI25165J46597_100080920 263
183 3300003322 rootL2_10015957 rootL2_100159575 263
184 3300003322 rootL2_10248635 rootL2_102486352 263
185 3300003323 rootH1_10107075 rootH1_101070752 263
186 3300003354 JGI25160J50197_1000099 JGI25160J50197_10000994 263
187 3300003756 Ga0055533_1000085 Ga0055533_100008598 263
188 3300003756 Ga0055533_1002390 Ga0055533_10023905 263
189 3300003758 Ga0055532_1000001 Ga0055532_1000001188 263
190 3300003758 Ga0055532_1000453 Ga0055532_100045312 263
191 3300003759 Ga0055525_1000084 Ga0055525_1000084152 263
192 3300003760 Ga0055527_1000002 Ga0055527_1000002571 263
193 3300003761 Ga0055535_1000001 Ga0055535_1000001816 263
194 3300003761 Ga0055535_1000267 Ga0055535_100026716 263
195 3300003761 Ga0055535_1011018 Ga0055535_10110181 263
196 3300003762 Ga0055542_1000001 Ga0055542_1000001188 263
197 3300003762 Ga0055542_1000175 Ga0055542_100017543 263
198 3300003763 Ga0055529_1000026 Ga0055529_100002696 263
199 3300003763 Ga0055529_1000131 Ga0055529_100013116 263
200 3300003784 Ga0055534_1000538 Ga0055534_10005389 263
201 3300003790 Ga0055528_1003161 Ga0055528_10031613 263
202 3300004625 Ga0055543_1002594 Ga0055543_10025942 263
203 3300005262 Ga0065165_1000119 Ga0065165_100011950 263
204 3300005262 Ga0065165_1000246 Ga0065165_100024610 263
205 3300005262 Ga0065165_1070105 Ga0065165_10701051 263
206 3300005289 Ga0065704_10275148 Ga0065704_102751481 263
207 3300005331 Ga0070670_100011963 Ga0070670_1000119633 263
208 3300005335 Ga0070666_10374608 Ga0070666_103746081 263
209 3300005366 Ga0070659_100097304 Ga0070659_1000973042 263
210 3300005367 Ga0070667_100019088 Ga0070667_1000190882 263
211 3300005455 Ga0070663_100019014 Ga0070663_1000190144 263
212 3300005455 Ga0070663_100113582 Ga0070663_1001135821 263
213 3300005456 Ga0070678_100059197 Ga0070678_1000591972 263
214 3300005548 Ga0070665_100140959 Ga0070665_1001409592 263
215 3300005548 Ga0070665_100445739 Ga0070665_1004457391 263
216 3300005563 Ga0068855_100291933 Ga0068855_1002919332 263
217 3300005614 Ga0068856_100528818 Ga0068856_1005288182 263
218 3300005616 Ga0068852_100129141 Ga0068852_1001291412 263
219 3300005841 Ga0068863_100326917 Ga0068863_1003269172 263
220 3300009036 Ga0105244_10132344 Ga0105244_101323442 263
221 3300009092 Ga0105250_10115611 Ga0105250_101156111 263
222 3300009093 Ga0105240_10013230 Ga0105240_100132304 263
223 3300009093 Ga0105240_10087772 Ga0105240_100877724 263
224 3300009093 Ga0105240_10415964 Ga0105240_104159642 263
225 3300009174 Ga0105241_10439860 Ga0105241_104398602 263
226 3300009176 Ga0105242_10408823 Ga0105242_104088232 263
227 3300009177 Ga0105248_10018714 Ga0105248_100187149 263
228 3300009177 Ga0105248_10073805 Ga0105248_100738052 263
229 3300009545 Ga0105237_10014914 Ga0105237_100149147 263
230 3300009551 Ga0105238_10018816 Ga0105238_100188165 263
231 3300010375 Ga0105239_10009446 Ga0105239_100094463 263
232 3300011119 Ga0105246_10064217 Ga0105246_100642172 263
233 3300013100 Ga0157373_10007445 Ga0157373_100074452 263
234 3300013105 Ga0157369_10000456 Ga0157369_1000045643 263
235 3300013105 Ga0157369_10082556 Ga0157369_100825562 263
236 3300013306 Ga0163162_10000793 Ga0163162_100007932 263
237 3300013306 Ga0163162_10045284 Ga0163162_100452843 263
238 3300013308 Ga0157375_10217630 Ga0157375_102176302 263
239 3300014326 Ga0157380_10220260 Ga0157380_102202602 263
240 3300014497 Ga0182008_10000207 Ga0182008_1000020711 263
241 3300014969 Ga0157376_10320339 Ga0157376_103203391 263
242 3300015261 Ga0182006_1024307 Ga0182006_10243071 263
243 3300015261 Ga0182006_1035752 Ga0182006_10357522 263
244 3300015262 Ga0182007_10000185 Ga0182007_1000018525 263
245 3300017792 Ga0163161_10003747 Ga0163161_100037474 263
246 3300025206 Ga0209435_100080 Ga0209435_1000809 263
247 3300025226 Ga0209674_100005 Ga0209674_100005558 263
248 3300025226 Ga0209674_100078 Ga0209674_100078149 263
249 3300025228 Ga0209672_100001 Ga0209672_1000011019 263
250 3300025228 Ga0209672_100031 Ga0209672_10003180 263
251 3300025228 Ga0209672_100158 Ga0209672_10015822 263
252 3300025229 Ga0209147_100001 Ga0209147_1000011019 263
253 3300025229 Ga0209147_100004 Ga0209147_1000041267 263
254 3300025229 Ga0209147_100040 Ga0209147_100040198 263
255 3300025230 Ga0209563_100025 Ga0209563_100025153 263
256 3300025230 Ga0209563_103001 Ga0209563_1030012 263
257 3300025233 Ga0209437_100117 Ga0209437_10011795 263
258 3300025242 Ga0209258_100001 Ga0209258_1000011019 263
259 3300025242 Ga0209258_100061 Ga0209258_100061202 263
260 3300025242 Ga0209258_100788 Ga0209258_1007889 263
261 3300025246 Ga0209646_1000481 Ga0209646_100048112 263
262 3300025250 Ga0209026_1000729 Ga0209026_10007299 263
263 3300025254 Ga0209148_1000003 Ga0209148_10000031019 263
264 3300025254 Ga0209148_1000070 Ga0209148_1000070219 263
265 3300025256 Ga0209759_1000029 Ga0209759_1000029177 263
266 3300025256 Ga0209759_1000087 Ga0209759_1000087126 263
267 3300025256 Ga0209759_1000440 Ga0209759_10004409 263
268 3300025256 Ga0209759_1000815 Ga0209759_100081511 263
269 3300025256 Ga0209759_1004244 Ga0209759_10042442 263
270 3300025261 Ga0209233_1000043 Ga0209233_1000043445 263
271 3300025263 Ga0209565_1006273 Ga0209565_10062731 263
272 3300025272 Ga0209455_1000001 Ga0209455_10000011019 263
273 3300025272 Ga0209455_1000069 Ga0209455_100006960 263
274 3300025273 Ga0209673_1000026 Ga0209673_1000026199 263
275 3300025284 Ga0209130_1002434 Ga0209130_10024343 263
276 3300025284 Ga0209130_1004456 Ga0209130_10044563 263
277 3300025291 Ga0209675_1000859 Ga0209675_10008594 263
278 3300025292 Ga0209676_1006609 Ga0209676_10066093 263
279 3300025294 Ga0209025_1000133 Ga0209025_100013398 263
280 3300025294 Ga0209025_1000342 Ga0209025_100034287 263
281 3300025294 Ga0209025_1040896 Ga0209025_10408962 263
282 3300025295 Ga0209564_1003544 Ga0209564_10035446 263
283 3300025298 Ga0209050_1001725 Ga0209050_100172511 263
284 3300025299 Ga0209256_1000544 Ga0209256_100054425 263
285 3300025302 Ga0207426_1000215 Ga0207426_100021549 263
286 3300025302 Ga0207426_1003763 Ga0207426_10037634 263
287 3300025303 Ga0209051_1050524 Ga0209051_10505242 263
288 3300025735 Ga0207713_1004266 Ga0207713_10042663 263
289 3300025903 Ga0207680_10103786 Ga0207680_101037862 263
290 3300025903 Ga0207680_10119693 Ga0207680_101196931 263
291 3300025904 Ga0207647_10016751 Ga0207647_100167516 263
292 3300025904 Ga0207647_10085536 Ga0207647_100855361 263
293 3300025913 Ga0207695_10016943 Ga0207695_100169433 263
294 3300025913 Ga0207695_10253648 Ga0207695_102536482 263
295 3300025913 Ga0207695_10295599 Ga0207695_102955992 263
296 3300025914 Ga0207671_10060153 Ga0207671_100601532 263
297 3300025924 Ga0207694_10020992 Ga0207694_100209923 263
298 3300025924 Ga0207694_10177367 Ga0207694_101773672 263
299 3300025925 Ga0207650_10016686 Ga0207650_100166863 263
300 3300025931 Ga0207644_10106844 Ga0207644_101068442 263
301 3300025941 Ga0207711_10073342 Ga0207711_100733422 263
302 3300025949 Ga0207667_10020362 Ga0207667_100203622 263
303 3300025949 Ga0207667_10241642 Ga0207667_102416422 263
304 3300025986 Ga0207658_10028141 Ga0207658_100281414 263
305 3300026067 Ga0207678_10237222 Ga0207678_102372222 263
306 3300026116 Ga0207674_10290127 Ga0207674_102901272 263
307 3300026121 Ga0207683_10174164 Ga0207683_101741642 263
308 3300027312 Ga0209371_1000971 Ga0209371_100097111 263
309 3300028379 Ga0268266_10433660 Ga0268266_104336601 263
310 3300028379 Ga0268266_10535846 Ga0268266_105358462 263
311 3300030500 Ga0268256_1000821 Ga0268256_100082111 263
312 3300030744 Ga0316181_1053488 Ga0316181_10534882 263
313 3300030745 Ga0316182_1212983 Ga0316182_12129833 263
314 3300031241 Ga0265325_10202811 Ga0265325_102028111 263
315 3300031251 Ga0265327_10006362 Ga0265327_100063623 263
316 3300031911 Ga0307412_10000059 Ga0307412_1000005949 263
317 3300037312 Ga0395899_0012056 Ga0395899_0012056_3771_4562 263
318 3300037418 Ga0395900_0001667 Ga0395900_0001667_3389_4180 263
319 3300037418 Ga0395900_0041760 Ga0395900_0041760_1949_2740 263
320 3300037418 Ga0395900_0116412 Ga0395900_0116412_698_1489 263
321 3300037466 Ga0395898_0004523 Ga0395898_0004523_6154_6945 263
322 3300037471 Ga0395905_0000020 Ga0395905_0000020_296572_297363 263
323 3300037471 Ga0395905_0020275 Ga0395905_0020275_3643_4449 263
324 3300037471 Ga0395905_0139245 Ga0395905_0139245_857_1648 263
325 3300037471 Ga0395905_0372555 Ga0395905_0372555_354_1145 263
326 3300038443 Ga0395901_0000095 Ga0395901_0000095_69067_69858 263
327 3300038443 Ga0395901_0081262 Ga0395901_0081262_839_1630 263
328 3300044656 Ga0466969_0000534 Ga0466969_0000534_9017_9838 263
329 3300044658 Ga0466972_0041504 Ga0466972_0041504_24_815 263
330 3300044672 Ga0466982_0008424 Ga0466982_0008424_2849_3640 263
331 3300044683 Ga0466965_0005137 Ga0466965_0005137_75_1001 263
332 3300044683 Ga0466965_0247169 Ga0466965_0247169_82_873 263
333 3300044684 Ga0466966_0001355 Ga0466966_0001355_7186_8007 263
334 3300044684 Ga0466966_0168932 Ga0466966_0168932_392_1183 263
335 3300044693 Ga0466961_0001415 Ga0466961_0001415_4743_5534 263
336 3300044693 Ga0466961_0003278 Ga0466961_0003278_4271_5062 263
337 3300044765 Ga0466970_0032201 Ga0466970_0032201_1679_2500 263
338 3300044765 Ga0466970_0131257 Ga0466970_0131257_308_1099 263
339 3300044765 Ga0466970_0219295 Ga0466970_0219295_222_1013 263
340 3300044901 Ga0466960_0054056 Ga0466960_0054056_515_1306 263
341 3300045049 Ga0466959_0021533 Ga0466959_0021533_2687_3478 263
342 3300045049 Ga0466959_0139905 Ga0466959_0139905_612_1433 263
343 3300046454 Ga0495592_0002222 Ga0495592_0002222_10071_10862 263
344 3300046455 Ga0495603_0011710 Ga0495603_0011710_26_817 263
345 3300046457 Ga0495590_0000092 Ga0495590_0000092_25176_25967 263
346 3300046457 Ga0495590_0009089 Ga0495590_0009089_2427_3218 263
347 3300046457 Ga0495590_0015933 Ga0495590_0015933_848_1639 263
348 3300046457 Ga0495590_0091739 Ga0495590_0091739_31_822 263
349 3300046459 Ga0495629_0010469 Ga0495629_0010469_1172_1963 263
350 3300046460 Ga0495638_0059567 Ga0495638_0059567_94_885 263
351 3300046462 Ga0495651_0150363 Ga0495651_0150363_613_1404 263
352 3300046463 Ga0495653_0038202 Ga0495653_0038202_2364_3155 263
353 3300046463 Ga0495653_0057096 Ga0495653_0057096_1363_2154 263
354 3300046471 Ga0495650_0003970 Ga0495650_0003970_6476_7267 263
355 3300046471 Ga0495650_0077004 Ga0495650_0077004_339_1130 263
356 3300046472 Ga0495580_0098520 Ga0495580_0098520_250_1041 263
357 3300046473 Ga0495582_0059010 Ga0495582_0059010_990_1781 263
358 3300046474 Ga0495605_0003123 Ga0495605_0003123_1294_2085 263
359 3300046474 Ga0495605_0086101 Ga0495605_0086101_422_1213 263
360 3300046477 Ga0495664_0014049 Ga0495664_0014049_1178_1969 263
361 3300046477 Ga0495664_0114487 Ga0495664_0114487_649_1440 263
362 3300046477 Ga0495664_0200477 Ga0495664_0200477_14_805 263
363 3300046501 Ga0495607_0110608 Ga0495607_0110608_241_1032 263
364 3300046506 Ga0495583_0003496 Ga0495583_0003496_4538_5329 263
365 3300046507 Ga0495606_0020198 Ga0495606_0020198_323_1114 263
366 3300046507 Ga0495606_0029281 Ga0495606_0029281_716_1507 263
367 3300046507 Ga0495606_0031695 Ga0495606_0031695_1248_2039 263
368 3300046507 Ga0495606_0133281 Ga0495606_0133281_292_1083 263
369 3300046511 Ga0495608_0000402 Ga0495608_0000402_7653_8444 263
370 3300046512 Ga0495610_0000624 Ga0495610_0000624_31053_31844 263
371 3300046512 Ga0495610_0152924 Ga0495610_0152924_32_823 263
372 3300046513 Ga0495616_0068026 Ga0495616_0068026_813_1604 263
373 3300046513 Ga0495616_0190379 Ga0495616_0190379_93_884 263
374 3300046514 Ga0495618_0005572 Ga0495618_0005572_4203_4994 263
375 3300046516 Ga0495628_0037532 Ga0495628_0037532_555_1346 263
376 3300046516 Ga0495628_0178465 Ga0495628_0178465_545_1336 263
377 3300046517 Ga0495630_0160011 Ga0495630_0160011_338_1129 263
378 3300046518 Ga0495631_0100307 Ga0495631_0100307_259_1050 263
379 3300046522 Ga0495643_0155386 Ga0495643_0155386_112_903 263
380 3300046523 Ga0495644_0106116 Ga0495644_0106116_65_856 263
381 3300046526 Ga0495666_0000878 Ga0495666_0000878_12257_13048 263
382 3300046526 Ga0495666_0202837 Ga0495666_0202837_30_821 263
383 3300046528 Ga0495642_0004439 Ga0495642_0004439_1396_2187 263
384 3300046529 Ga0495652_0001389 Ga0495652_0001389_21085_21876 263
385 3300046529 Ga0495652_0198458 Ga0495652_0198458_322_1113 263
386 3300046531 Ga0495665_0000973 Ga0495665_0000973_12257_13048 263
387 3300046533 Ga0495640_0002062 Ga0495640_0002062_1024_1815 263
388 3300046535 Ga0495586_0079736 Ga0495586_0079736_473_1264 263
389 3300046539 Ga0495621_0040892 Ga0495621_0040892_457_1248 263
390 3300046542 Ga0495597_0001164 Ga0495597_0001164_13761_14552 263
391 3300046558 Ga0495633_0177513 Ga0495633_0177513_89_880 263
392 3300046615 Ga0495656_0019443 Ga0495656_0019443_1426_2217 263
393 3300046642 Ga0495634_0003103 Ga0495634_0003103_7630_8421 263
394 3300046648 Ga0495611_0151985 Ga0495611_0151985_112_903 263
395 3300046660 Ga0495625_0002351 Ga0495625_0002351_12172_12963 263
396 3300046663 Ga0495635_0000831 Ga0495635_0000831_13640_14431 263
397 3300046674 Ga0495588_0062706 Ga0495588_0062706_220_1011 263
398 3300046678 Ga0495599_0263396 Ga0495599_0263396_169_960 263
399 3300046680 Ga0495646_0051695 Ga0495646_0051695_408_1199 263
400 3300046680 Ga0495646_0066205 Ga0495646_0066205_606_1397 263
401 3300046684 Ga0495669_0014543 Ga0495669_0014543_345_1136 263
402 3300046684 Ga0495669_0014864 Ga0495669_0014864_215_1006 263
403 3300046690 Ga0495624_0001875 Ga0495624_0001875_10918_11709 263
404 3300046691 Ga0495670_0027512 Ga0495670_0027512_1565_2356 263
405 3300046692 Ga0495671_0119186 Ga0495671_0119186_444_1235 263
406 3300046694 Ga0495649_0000215 Ga0495649_0000215_10203_10994 263
407 3300046694 Ga0495649_0012734 Ga0495649_0012734_3340_4131 263
408 3300046694 Ga0495649_0096849 Ga0495649_0096849_526_1317 263
409 3300046794 Ga0495589_0026337 Ga0495589_0026337_481_1272 263
410 3300046794 Ga0495589_0073149 Ga0495589_0073149_224_1015 263
411 3300046809 Ga0495600_0000230 Ga0495600_0000230_16332_17123 263
412 3300046810 Ga0495660_0043818 Ga0495660_0043818_754_1545 263
413 3300046810 Ga0495660_0087042 Ga0495660_0087042_105_896 263
414 3300046810 Ga0495660_0155196 Ga0495660_0155196_238_1029 263
415 3300047315 Ga0495581_0000998 Ga0495581_0000998_2386_3177 263
416 3300047317 Ga0495604_0109200 Ga0495604_0109200_822_1613 263
417 3300047319 Ga0495674_0050986 Ga0495674_0050986_1368_2159 263
418 3300047319 Ga0495674_0291932 Ga0495674_0291932_355_1146 263
419 3300047321 Ga0495676_0201295 Ga0495676_0201295_338_1129 263
420 3300047323 Ga0495683_0001534 Ga0495683_0001534_11611_12402 263
421 3300047323 Ga0495683_0010627 Ga0495683_0010627_2188_2979 263
422 3300047323 Ga0495683_0050651 Ga0495683_0050651_23_814 263
423 3300047323 Ga0495683_0170868 Ga0495683_0170868_165_956 263
424 3300047443 Ga0495687_016907 Ga0495687_016907_2123_2914 263
425 3300047443 Ga0495687_017543 Ga0495687_017543_1189_1980 263
426 3300047444 Ga0495675_0001459 Ga0495675_0001459_1379_2170 263
427 3300047445 Ga0495677_0032430 Ga0495677_0032430_480_1271 263
428 3300047447 Ga0495685_016099 Ga0495685_016099_1608_2399 263
429 3300047469 Ga0495673_0069619 Ga0495673_0069619_584_1375 263
430 3300047469 Ga0495673_0098510 Ga0495673_0098510_91_882 263
431 3300047472 Ga0495686_0000181 Ga0495686_0000181_931_1722 263
432 3300047472 Ga0495686_0057601 Ga0495686_0057601_344_1135 263
433 3300047673 Ga0495593_0001222 Ga0495593_0001222_9011_9802 263
434 3300047673 Ga0495593_0030535 Ga0495593_0030535_2072_2863 263
435 3300047673 Ga0495593_0037705 Ga0495593_0037705_1287_2078 263
436 3300047673 Ga0495593_0163896 Ga0495593_0163896_292_1083 263
437 3300048088 Ga0495602_0027695 Ga0495602_0027695_535_1326 263
438 3300048088 Ga0495602_0076896 Ga0495602_0076896_860_1651 263
439 3300048088 Ga0495602_0220202 Ga0495602_0220202_87_878 263
440 3300048088 Ga0495602_0399010 Ga0495602_0399010_66_857 263
441 3300048089 Ga0495614_0000632 Ga0495614_0000632_10918_11709 263
442 3300048091 Ga0495626_0025539 Ga0495626_0025539_394_1185 263
443 3300048091 Ga0495626_0034869 Ga0495626_0034869_871_1662 263
444 3300048091 Ga0495626_0063657 Ga0495626_0063657_683_1474 263
445 3300048091 Ga0495626_0071960 Ga0495626_0071960_131_922 263
446 3300048903 Ga0496100_0000078 Ga0496100_0000078_2484_3275 263
447 3300048903 Ga0496100_0000932 Ga0496100_0000932_6255_7046 263
448 3300048903 Ga0496100_0002476 Ga0496100_0002476_745_1536 263
449 3300048904 Ga0496101_0000519 Ga0496101_0000519_16690_17481 263
450 3300048904 Ga0496101_0000538 Ga0496101_0000538_2550_3341 263
451 3300048904 Ga0496101_0043710 Ga0496101_0043710_1765_2556 263
452 3300048905 Ga0496102_0000165 Ga0496102_0000165_2402_3193 263
453 3300048905 Ga0496102_0003580 Ga0496102_0003580_7333_8124 263
454 3300048905 Ga0496102_0013163 Ga0496102_0013163_4395_5186 263
455 3300048905 Ga0496102_0081749 Ga0496102_0081749_287_1078 263
456 3300048906 Ga0496103_0000360 Ga0496103_0000360_33639_34430 263
457 3300048906 Ga0496103_0000644 Ga0496103_0000644_21912_22703 263
458 3300048906 Ga0496103_0014851 Ga0496103_0014851_1189_1980 263
459 3300048907 Ga0496104_0002481 Ga0496104_0002481_10063_10854 263
460 3300048907 Ga0496104_0008205 Ga0496104_0008205_754_1545 263
461 3300048907 Ga0496104_0149761 Ga0496104_0149761_925_1716 263
462 3300048908 Ga0496105_0000375 Ga0496105_0000375_7160_7951 263
463 3300048909 Ga0496106_0000045 Ga0496106_0000045_6602_7393 263
464 3300048909 Ga0496106_0005706 Ga0496106_0005706_1064_1891 263
465 3300048909 Ga0496106_0013224 Ga0496106_0013224_38_829 263
466 3300048909 Ga0496106_0022374 Ga0496106_0022374_2243_3034 263
467 3300048910 Ga0496107_0005245 Ga0496107_0005245_558_1349 263
468 3300048910 Ga0496107_0061491 Ga0496107_0061491_1862_2653 263
469 3300048910 Ga0496107_0484641 Ga0496107_0484641_48_839 263
470 3300048912 Ga0496109_0042598 Ga0496109_0042598_2553_3380 263
471 3300048912 Ga0496109_0308223 Ga0496109_0308223_633_1424 263
472 3300048913 Ga0496110_0003384 Ga0496110_0003384_10282_11073 263
473 3300048913 Ga0496110_0060777 Ga0496110_0060777_2290_3117 263
474 3300048913 Ga0496110_0113947 Ga0496110_0113947_369_1160 263
475 3300048913 Ga0496110_0253973 Ga0496110_0253973_190_981 263
476 3300048914 Ga0496111_0018131 Ga0496111_0018131_3280_4071 263
477 3300048914 Ga0496111_0066681 Ga0496111_0066681_1018_1809 263
478 3300048915 Ga0496112_0011630 Ga0496112_0011630_5161_5952 263
479 3300048915 Ga0496112_0024005 Ga0496112_0024005_500_1291 263
480 3300048916 Ga0496113_0003212 Ga0496113_0003212_5508_6299 263
481 3300048916 Ga0496113_0080747 Ga0496113_0080747_439_1230 263
482 3300048917 Ga0496114_0039656 Ga0496114_0039656_1747_2538 263
483 3300048919 Ga0496116_0001434 Ga0496116_0001434_5381_6172 263
484 3300048919 Ga0496116_0067321 Ga0496116_0067321_1029_1820 263
485 3300048920 Ga0496117_0000707 Ga0496117_0000707_2389_3180 263
486 3300048920 Ga0496117_0002321 Ga0496117_0002321_15395_16186 263
487 3300048920 Ga0496117_0007204 Ga0496117_0007204_4366_5157 263
488 3300048920 Ga0496117_0015333 Ga0496117_0015333_2061_2852 263
489 3300048920 Ga0496117_0072054 Ga0496117_0072054_461_1252 263
490 3300048921 Ga0496118_0000283 Ga0496118_0000283_86027_86818 263
491 3300048921 Ga0496118_0008341 Ga0496118_0008341_1825_2616 263
492 3300048921 Ga0496118_0012458 Ga0496118_0012458_521_1312 263
493 3300048921 Ga0496118_0024001 Ga0496118_0024001_1765_2556 263
494 3300048921 Ga0496118_0051414 Ga0496118_0051414_197_988 263
495 3300048922 Ga0496119_0038458 Ga0496119_0038458_2269_3060 263
496 3300048923 Ga0496120_0066373 Ga0496120_0066373_82_873 263
497 3300048924 Ga0496121_0002547 Ga0496121_0002547_6779_7570 263
498 3300048924 Ga0496121_0002717 Ga0496121_0002717_17338_18129 263
499 3300048924 Ga0496121_0008605 Ga0496121_0008605_4576_5367 263
500 3300048924 Ga0496121_0011190 Ga0496121_0011190_6097_6888 263
501 3300048924 Ga0496121_0017457 Ga0496121_0017457_6047_6838 263
502 3300048924 Ga0496121_0024609 Ga0496121_0024609_3028_3819 263
503 3300048925 Ga0496122_0006237 Ga0496122_0006237_7006_7797 263
504 3300048925 Ga0496122_0056368 Ga0496122_0056368_837_1628 263
505 3300048925 Ga0496122_0079799 Ga0496122_0079799_1207_1998 263
506 3300048926 Ga0496123_0006105 Ga0496123_0006105_7162_7953 263
507 3300048926 Ga0496123_0015633 Ga0496123_0015633_2797_3588 263
508 3300048926 Ga0496123_0189826 Ga0496123_0189826_45_836 263
509 3300048927 Ga0496124_0006512 Ga0496124_0006512_1711_2502 263
510 3300048927 Ga0496124_0010208 Ga0496124_0010208_8065_8856 263
511 3300048927 Ga0496124_0178290 Ga0496124_0178290_769_1560 263
512 3300048927 Ga0496124_0187702 Ga0496124_0187702_125_916 263
513 3300048928 Ga0496125_0007063 Ga0496125_0007063_1992_2783 263
514 3300048928 Ga0496125_0071998 Ga0496125_0071998_174_965 263
515 3300048929 Ga0496126_0000031 Ga0496126_0000031_263352_264143 263
516 3300048929 Ga0496126_0354917 Ga0496126_0354917_66_857 263
517 3300049569 Ga0501032_0267834 Ga0501032_0267834_178_975 263
518 3300049586 Ga0501070_0009081 Ga0501070_0009081_771_1568 263
519 3300049742 Ga0501080_0184125 Ga0501080_0184125_146_943 263
520 3300053111 Ga0500572_054582 Ga0500572_054582_213_1004 263
521 3300053121 Ga0500607_007274 Ga0500607_007274_1858_2649 263
522 3300053730 Ga0500645_057158 Ga0500645_057158_195_986 263
523 3300061719 Ga0466962_0006725 Ga0466962_0006725_2943_3734 263
524 iso_pu_bacteria 8055301274 8055302250 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

59

249

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

63

305

0.93

PF23441

56

305

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9482 11 258
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.947 11 258
1uzl-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9452 12 261
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.945 11 258
1uls-assembly1.cif.gz_C crystal structure of tt0140 from thermus thermophilus hb8 0.9448 11 258
ID Description Score Start End Superfamily
af_Q0ISZ5_12_118_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 11 91 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 7 190 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.947 11 258 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9464 12 259 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 99 194 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A535TRS1-F1-model_v4 SDR family oxidoreductase 0.9652 11 128
AF-U4KRH9-F1-model_v4 Putative acetoin dehydrogenase BudC (EC 1.1.1.303) 0.954 10 191 GO:0052587
AF-A0A429CA30-F1-model_v4 3-hydroxybutyrate dehydrogenase 0.9517 8 254 GO:0003858
AF-A0A6I5VG95-F1-model_v4 SDR family oxidoreductase 0.951 7 260 GO:0016616
AF-A0A384AZA9-F1-model_v4 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) 0.9472 14 190 GO:0006633
GO:0016616
GO:0048038

Feature Viewer

pLDDT pTM Quality
92.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map