F459167

General Info

Members Datasets Scaffolds Average Seq Length
524 213 524 157

Family's Representative Sequence

Representative Sequence 3300042015|Ga0439462_0082122|Ga0439462_0082122_156_713
Length 185
Sequence MGVGHGGQVLYLRAWLRIGKPHRLVVGTMINAGFTELLLGLLAILLLVAAVIDVRTFTISNSLNLSIALLAPLYWLSIALPLWPNAAIQLAVGAGVFTLLAGAFYAGMMGGGDVKLAAALALWFSPASTVKFLVLMSLAGGVLTLVVVALHRARGKAGRPEIPYGVAIAFGGLVILTQRFLNQFA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
202 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
203 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
204 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
210 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
211 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 2.86
Rhizosphere 96.37
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1024051 3300001915 Bacteria 937
2 JGI24740J21852_10001677 3300001979 Bacteria 10166
3 JGI24740J21852_10006406 3300001979 Bacteria 4879
4 JGI24739J22299_10010205 3300001989 Bacteria 3489
5 JGI24739J22299_10018551 3300001989 Bacteria 2499
6 JGI24737J22298_10000221 3300001990 Bacteria 18699
7 JGI24737J22298_10034433 3300001990 Bacteria 1570
8 JGI24737J22298_10048327 3300001990 Bacteria 1295
9 JGI24737J22298_10100641 3300001990 Bacteria 856
10 JGI24743J22301_10006580 3300001991 Bacteria 1987
11 JGI24735J21928_10093067 3300002067 Bacteria 865
12 JGI24750J21931_1007719 3300002070 Bacteria 1357
13 JGI24745J21846_1005138 3300002073 Bacteria 1421
14 JGI24738J21930_10008528 3300002075 Bacteria 2330
15 JGI24744J21845_10029985 3300002077 Bacteria 1044
16 JGI24034J26672_10028609 3300002239 Bacteria 900
17 Ga0065715_10009313 3300005293 Bacteria 2865
18 Ga0065715_10036540 3300005293 Bacteria 1458
19 Ga0070658_10077516 3300005327 Bacteria 2727
20 Ga0070658_10187940 3300005327 Bacteria 1740
21 Ga0070658_11414388 3300005327 Bacteria 603
22 Ga0070676_10002314 3300005328 Bacteria 9742
23 Ga0070676_10004745 3300005328 Bacteria 7190
24 Ga0070676_10012510 3300005328 Bacteria 4636
25 Ga0070676_10038089 3300005328 Bacteria 2776
26 Ga0070676_10424335 3300005328 Bacteria 930
27 Ga0070683_100093326 3300005329 Bacteria 2827
28 Ga0070670_100005417 3300005331 Bacteria 10767
29 Ga0070670_100044489 3300005331 Bacteria 3818
30 Ga0070670_100047275 3300005331 Bacteria 3702
31 Ga0070670_100253196 3300005331 Bacteria 1534
32 Ga0070670_101099541 3300005331 Bacteria 725
33 Ga0070670_101204550 3300005331 Unclassified 692
34 Ga0070677_10017076 3300005333 Bacteria 2592
35 Ga0070677_10047171 3300005333 Bacteria 1726
36 Ga0068869_100000662 3300005334 Bacteria 19510
37 Ga0068869_100013127 3300005334 Bacteria 5500
38 Ga0068869_100187507 3300005334 Bacteria 1625
39 Ga0068869_100524880 3300005334 Bacteria 991
40 Ga0070666_10016286 3300005335 Bacteria 4755
41 Ga0070666_10016307 3300005335 Bacteria 4751
42 Ga0070666_10109944 3300005335 Bacteria 1905
43 Ga0070680_100122607 3300005336 Bacteria 2170
44 Ga0070680_100672210 3300005336 Bacteria 891
45 Ga0070682_100229205 3300005337 Bacteria 1327
46 Ga0070682_100665627 3300005337 Bacteria 831
47 Ga0068868_100001411 3300005338 Bacteria 16565
48 Ga0068868_100117591 3300005338 Bacteria 2166
49 Ga0068868_100346260 3300005338 Bacteria 1272
50 Ga0070660_100010601 3300005339 Bacteria 6515
51 Ga0070660_100064014 3300005339 Bacteria 2860
52 Ga0070660_100091564 3300005339 Bacteria 2399
53 Ga0070660_100128812 3300005339 Bacteria 2024
54 Ga0070660_100492905 3300005339 Bacteria 1019
55 Ga0070660_100545835 3300005339 Bacteria 967
56 Ga0070660_100733816 3300005339 Bacteria 829
57 Ga0070660_100953178 3300005339 Bacteria 724
58 Ga0070660_101087949 3300005339 Bacteria 676
59 Ga0070691_10208438 3300005341 Bacteria 1030
60 Ga0070661_100882323 3300005344 Bacteria 737
61 Ga0070668_100007531 3300005347 Bacteria 8085
62 Ga0070668_100040876 3300005347 Bacteria 3550
63 Ga0070668_100098504 3300005347 Bacteria 2314
64 Ga0070669_100000682 3300005353 Bacteria 24837
65 Ga0070669_100025231 3300005353 Bacteria 4269
66 Ga0070669_100114258 3300005353 Bacteria 2052
67 Ga0070675_100003697 3300005354 Bacteria 11623
68 Ga0070675_100042801 3300005354 Bacteria 3701
69 Ga0070675_100133608 3300005354 Bacteria 2116
70 Ga0070675_100266298 3300005354 Bacteria 1503
71 Ga0070671_100007783 3300005355 Bacteria 8561
72 Ga0070671_100043661 3300005355 Bacteria 3725
73 Ga0070671_100058477 3300005355 Bacteria 3209
74 Ga0070674_100052696 3300005356 Bacteria 2807
75 Ga0070673_100000833 3300005364 Bacteria 17279
76 Ga0070673_100009304 3300005364 Bacteria 6592
77 Ga0070673_100033051 3300005364 Bacteria 3901
78 Ga0070673_100066431 3300005364 Bacteria 2881
79 Ga0070659_100000950 3300005366 Bacteria 21306
80 Ga0070659_100001481 3300005366 Bacteria 16916
81 Ga0070659_100039104 3300005366 Bacteria 3702
82 Ga0070659_100334758 3300005366 Bacteria 1267
83 Ga0070659_100438140 3300005366 Bacteria 1107
84 Ga0070667_100000776 3300005367 Bacteria 30243
85 Ga0070667_100006561 3300005367 Bacteria 9673
86 Ga0070667_100013906 3300005367 Bacteria 6654
87 Ga0070667_100058875 3300005367 Bacteria 3248
88 Ga0070667_100252556 3300005367 Bacteria 1577
89 Ga0070667_100455961 3300005367 Bacteria 1169
90 Ga0070667_101047906 3300005367 Bacteria 762
91 Ga0070694_100003228 3300005444 Bacteria 9732
92 Ga0070663_100005818 3300005455 Bacteria 7365
93 Ga0070663_100022238 3300005455 Bacteria 4236
94 Ga0070663_100521755 3300005455 Bacteria 989
95 Ga0070663_101906632 3300005455 Bacteria 534
96 Ga0070662_100006881 3300005457 Bacteria 7357
97 Ga0070662_100022242 3300005457 Bacteria 4337
98 Ga0070662_100034774 3300005457 Bacteria 3555
99 Ga0070662_100049099 3300005457 Bacteria 3042
100 Ga0070662_100141249 3300005457 Bacteria 1866
101 Ga0070681_10090766 3300005458 Bacteria 3005
102 Ga0070681_10163066 3300005458 Bacteria 2153
103 Ga0070681_10378623 3300005458 Bacteria 1326
104 Ga0068867_100033101 3300005459 Bacteria 3741
105 Ga0068867_100035018 3300005459 Bacteria 3640
106 Ga0068867_101687128 3300005459 Bacteria 594
107 Ga0070679_100033899 3300005530 Bacteria 5057
108 Ga0070679_100753421 3300005530 Bacteria 917
109 Ga0070679_100808397 3300005530 Bacteria 881
110 Ga0070684_100218702 3300005535 Bacteria 1738
111 Ga0068853_100001659 3300005539 Bacteria 16300
112 Ga0068853_100139035 3300005539 Bacteria 2179
113 Ga0068853_100233159 3300005539 Bacteria 1684
114 Ga0068853_100835526 3300005539 Bacteria 883
115 Ga0070672_100000589 3300005543 Bacteria 21279
116 Ga0070672_100097092 3300005543 Bacteria 2385
117 Ga0070672_100307710 3300005543 Bacteria 1344
118 Ga0070672_101346839 3300005543 Bacteria 638
119 Ga0070695_100134661 3300005545 Bacteria 1706
120 Ga0070695_101690110 3300005545 Bacteria 530
121 Ga0070696_100019918 3300005546 Bacteria 4547
122 Ga0070693_100009371 3300005547 Bacteria 4864
123 Ga0070693_100172114 3300005547 Bacteria 1388
124 Ga0070665_100071855 3300005548 Bacteria 3467
125 Ga0070665_100533889 3300005548 Bacteria 1185
126 Ga0070704_100180504 3300005549 Bacteria 1688
127 Ga0068855_100008531 3300005563 Bacteria 12386
128 Ga0068855_100889489 3300005563 Bacteria 941
129 Ga0070664_100008433 3300005564 Bacteria 8333
130 Ga0070664_100009351 3300005564 Bacteria 7946
131 Ga0070664_100095934 3300005564 Bacteria 2573
132 Ga0070664_100320269 3300005564 Bacteria 1405
133 Ga0070664_100939337 3300005564 Bacteria 812
134 Ga0070664_102022803 3300005564 Bacteria 547
135 Ga0068857_100000692 3300005577 Bacteria 25055
136 Ga0068857_100128610 3300005577 Bacteria 2283
137 Ga0068854_100001058 3300005578 Bacteria 16545
138 Ga0068854_100003715 3300005578 Bacteria 9548
139 Ga0068854_100014106 3300005578 Bacteria 5260
140 Ga0068852_100024796 3300005616 Bacteria 4851
141 Ga0068852_100181698 3300005616 Bacteria 1978
142 Ga0068859_100002632 3300005617 Bacteria 18266
143 Ga0068859_100007420 3300005617 Bacteria 11132
144 Ga0068859_100016870 3300005617 Bacteria 7330
145 Ga0068859_100032223 3300005617 Bacteria 5265
146 Ga0068859_100034904 3300005617 Bacteria 5046
147 Ga0068864_100000287 3300005618 Bacteria 44806
148 Ga0068864_100000748 3300005618 Bacteria 27277
149 Ga0068864_100000894 3300005618 Bacteria 25097
150 Ga0068864_100013544 3300005618 Bacteria 6761
151 Ga0068864_101089932 3300005618 Bacteria 794
152 Ga0068866_10770154 3300005718 Bacteria 666
153 Ga0068861_100024292 3300005719 Bacteria 4382
154 Ga0068861_100946812 3300005719 Bacteria 819
155 Ga0068851_10559861 3300005834 Bacteria 692
156 Ga0068870_10247865 3300005840 Bacteria 1103
157 Ga0068863_100002077 3300005841 Bacteria 19858
158 Ga0068863_100050840 3300005841 Bacteria 3928
159 Ga0068863_100062372 3300005841 Bacteria 3525
160 Ga0068863_100120017 3300005841 Bacteria 2506
161 Ga0068863_100585507 3300005841 Bacteria 1103
162 Ga0068858_100000579 3300005842 Bacteria 38345
163 Ga0068858_100012043 3300005842 Bacteria 8153
164 Ga0068858_100032449 3300005842 Bacteria 4849
165 Ga0068858_100033541 3300005842 Bacteria 4762
166 Ga0068858_100459945 3300005842 Bacteria 1227
167 Ga0068860_100004159 3300005843 Bacteria 14831
168 Ga0068860_100006012 3300005843 Bacteria 12215
169 Ga0068860_100019373 3300005843 Bacteria 6599
170 Ga0068860_100025537 3300005843 Bacteria 5700
171 Ga0068862_100018299 3300005844 Bacteria 5835
172 Ga0068862_100096710 3300005844 Bacteria 2578
173 Ga0068862_100941099 3300005844 Bacteria 851
174 Ga0081539_10017580 3300005985 Bacteria 5011
175 Ga0070712_100118137 3300006175 Bacteria 1991
176 Ga0097621_100470385 3300006237 Bacteria 1135
177 Ga0075433_10203594 3300006852 Bacteria 1759
178 Ga0075434_100119783 3300006871 Bacteria 2646
179 Ga0068865_100077559 3300006881 Bacteria 2375
180 Ga0097620_100002632 3300006931 Bacteria 18266
181 Ga0097620_100007420 3300006931 Bacteria 11132
182 Ga0097620_100016869 3300006931 Bacteria 7330
183 Ga0097620_100032223 3300006931 Bacteria 5265
184 Ga0097620_100034904 3300006931 Bacteria 5046
185 Ga0075435_100190747 3300007076 Bacteria 1735
186 Ga0105251_10085545 3300009011 Bacteria 1453
187 Ga0105250_10005450 3300009092 Bacteria 5703
188 Ga0105240_10104592 3300009093 Bacteria 3438
189 Ga0105240_10172394 3300009093 Bacteria 2561
190 Ga0105245_10005839 3300009098 Bacteria 10806
191 Ga0105245_10030174 3300009098 Bacteria 4793
192 Ga0105247_10148459 3300009101 Bacteria 1543
193 Ga0105247_10179959 3300009101 Bacteria 1411
194 Ga0105243_10023746 3300009148 Bacteria 4673
195 Ga0105241_10098336 3300009174 Bacteria 2321
196 Ga0105242_10048328 3300009176 Bacteria 3458
197 Ga0105248_10000552 3300009177 Bacteria 42448
198 Ga0105248_10006033 3300009177 Bacteria 13304
199 Ga0105248_10010327 3300009177 Bacteria 10277
200 Ga0105248_10082850 3300009177 Bacteria 3608
201 Ga0105248_10260014 3300009177 Bacteria 1954
202 Ga0105238_10064099 3300009551 Bacteria 3675
203 Ga0105249_10020672 3300009553 Bacteria 5886
204 Ga0105249_10047596 3300009553 Bacteria 3908
205 Ga0105249_10329902 3300009553 Bacteria 1539
206 Ga0105239_10145487 3300010375 Bacteria 2643
207 Ga0105239_10284780 3300010375 Bacteria 1861
208 Ga0105246_10202665 3300011119 Bacteria 1543
209 Ga0157373_10005180 3300013100 Bacteria 9797
210 Ga0157373_10030128 3300013100 Bacteria 3905
211 Ga0157373_10126438 3300013100 Bacteria 1798
212 Ga0157373_10209815 3300013100 Bacteria 1373
213 Ga0157373_11055251 3300013100 Bacteria 608
214 Ga0157371_10004027 3300013102 Bacteria 13004
215 Ga0157371_10044632 3300013102 Bacteria 3155
216 Ga0157371_10048674 3300013102 Bacteria 3013
217 Ga0157371_10068264 3300013102 Bacteria 2516
218 Ga0157371_11283196 3300013102 Bacteria 566
219 Ga0157378_10011763 3300013297 Bacteria 7660
220 Ga0157378_11034548 3300013297 Bacteria 856
221 Ga0163162_10050160 3300013306 Bacteria 4185
222 Ga0163162_10052041 3300013306 Bacteria 4111
223 Ga0163162_10328724 3300013306 Bacteria 1661
224 Ga0163162_10429662 3300013306 Bacteria 1453
225 Ga0157372_10053038 3300013307 Bacteria 4518
226 Ga0157375_10409993 3300013308 Bacteria 1521
227 Ga0157375_11031427 3300013308 Bacteria 961
228 Ga0163163_10000390 3300014325 Bacteria 41759
229 Ga0163163_11929995 3300014325 Bacteria 650
230 Ga0157380_10004000 3300014326 Bacteria 10176
231 Ga0157380_10026397 3300014326 Bacteria 4410
232 Ga0157380_10026652 3300014326 Bacteria 4390
233 Ga0157377_10025447 3300014745 Bacteria 3156
234 Ga0157377_10381605 3300014745 Bacteria 954
235 Ga0157379_10180699 3300014968 Bacteria 1906
236 Ga0157379_10465856 3300014968 Bacteria 1168
237 Ga0157379_10848286 3300014968 Bacteria 864
238 Ga0157379_10919406 3300014968 Bacteria 831
239 Ga0213875_10002975 3300021388 Bacteria 9873
240 Ga0207673_1000994 3300025290 Bacteria 3046
241 Ga0207697_10000253 3300025315 Bacteria 29506
242 Ga0207656_10500629 3300025321 Bacteria 617
243 Ga0207696_1004959 3300025711 Bacteria 5615
244 Ga0207682_10001459 3300025893 Bacteria 10925
245 Ga0207682_10037597 3300025893 Bacteria 1961
246 Ga0207682_10185145 3300025893 Bacteria 952
247 Ga0207642_10017810 3300025899 Bacteria 2711
248 Ga0207710_10278561 3300025900 Bacteria 841
249 Ga0207688_10000652 3300025901 Bacteria 17096
250 Ga0207688_10607426 3300025901 Bacteria 689
251 Ga0207647_10000327 3300025904 Bacteria 38973
252 Ga0207647_10000760 3300025904 Bacteria 25232
253 Ga0207645_10007069 3300025907 Bacteria 7983
254 Ga0207645_10017352 3300025907 Bacteria 4752
255 Ga0207645_10061798 3300025907 Bacteria 2393
256 Ga0207643_10180326 3300025908 Bacteria 1278
257 Ga0207705_10408753 3300025909 Bacteria 1050
258 Ga0207707_10155977 3300025912 Bacteria 1997
259 Ga0207707_10282084 3300025912 Bacteria 1439
260 Ga0207707_10608263 3300025912 Bacteria 925
261 Ga0207695_10137659 3300025913 Bacteria 2393
262 Ga0207693_10040495 3300025915 Bacteria 3670
263 Ga0207660_10079087 3300025917 Bacteria 2411
264 Ga0207660_10254269 3300025917 Bacteria 1387
265 Ga0207657_10003476 3300025919 Bacteria 16805
266 Ga0207657_10009310 3300025919 Bacteria 9892
267 Ga0207657_10025878 3300025919 Bacteria 5404
268 Ga0207657_10062356 3300025919 Bacteria 3193
269 Ga0207657_10378404 3300025919 Bacteria 1115
270 Ga0207657_10519777 3300025919 Bacteria 932
271 Ga0207657_10633242 3300025919 Bacteria 833
272 Ga0207657_10853312 3300025919 Bacteria 703
273 Ga0207649_10104439 3300025920 Bacteria 1881
274 Ga0207649_10415378 3300025920 Bacteria 1009
275 Ga0207652_11599847 3300025921 Bacteria 556
276 Ga0207681_10018564 3300025923 Bacteria 4382
277 Ga0207681_10025163 3300025923 Bacteria 3826
278 Ga0207681_10060721 3300025923 Bacteria 2596
279 Ga0207681_10088083 3300025923 Bacteria 2210
280 Ga0207681_10126585 3300025923 Bacteria 1882
281 Ga0207650_10063190 3300025925 Bacteria 2767
282 Ga0207650_10068150 3300025925 Bacteria 2672
283 Ga0207650_10147802 3300025925 Bacteria 1852
284 Ga0207650_11353542 3300025925 Bacteria 606
285 Ga0207659_10004610 3300025926 Bacteria 8342
286 Ga0207659_10012653 3300025926 Bacteria 5380
287 Ga0207659_10117106 3300025926 Bacteria 2035
288 Ga0207659_10142012 3300025926 Bacteria 1865
289 Ga0207687_10003036 3300025927 Bacteria 11376
290 Ga0207687_10141139 3300025927 Bacteria 1828
291 Ga0207664_11310686 3300025929 Bacteria 644
292 Ga0207644_10021887 3300025931 Bacteria 4360
293 Ga0207644_10044552 3300025931 Bacteria 3152
294 Ga0207644_10102178 3300025931 Bacteria 2155
295 Ga0207644_10512081 3300025931 Bacteria 991
296 Ga0207690_10001585 3300025932 Bacteria 14215
297 Ga0207690_10002341 3300025932 Bacteria 11505
298 Ga0207690_10023323 3300025932 Bacteria 3861
299 Ga0207690_10185459 3300025932 Bacteria 1569
300 Ga0207706_10000143 3300025933 Bacteria 77680
301 Ga0207706_10000904 3300025933 Bacteria 30508
302 Ga0207706_10003074 3300025933 Bacteria 16047
303 Ga0207706_10004098 3300025933 Bacteria 13773
304 Ga0207706_10013609 3300025933 Bacteria 7389
305 Ga0207706_10215155 3300025933 Bacteria 1683
306 Ga0207669_10014002 3300025937 Bacteria 4007
307 Ga0207704_10047537 3300025938 Bacteria 2565
308 Ga0207704_10056039 3300025938 Bacteria 2412
309 Ga0207691_10000743 3300025940 Bacteria 32192
310 Ga0207691_10066655 3300025940 Bacteria 3257
311 Ga0207691_10146453 3300025940 Bacteria 2079
312 Ga0207691_10329549 3300025940 Bacteria 1308
313 Ga0207691_10847910 3300025940 Bacteria 766
314 Ga0207711_10000046 3300025941 Bacteria 153238
315 Ga0207711_10006545 3300025941 Bacteria 9811
316 Ga0207711_10059860 3300025941 Bacteria 3280
317 Ga0207711_10293281 3300025941 Bacteria 1499
318 Ga0207689_10000372 3300025942 Bacteria 42301
319 Ga0207689_10003887 3300025942 Bacteria 13614
320 Ga0207689_10012702 3300025942 Bacteria 7193
321 Ga0207661_10095396 3300025944 Bacteria 2487
322 Ga0207661_11149047 3300025944 Bacteria 715
323 Ga0207679_10039220 3300025945 Bacteria 3380
324 Ga0207679_10040787 3300025945 Bacteria 3326
325 Ga0207679_10189033 3300025945 Bacteria 1710
326 Ga0207679_10544793 3300025945 Bacteria 1040
327 Ga0207667_10069720 3300025949 Bacteria 3659
328 Ga0207667_10130037 3300025949 Bacteria 2593
329 Ga0207651_10000440 3300025960 Bacteria 17582
330 Ga0207651_10001136 3300025960 Bacteria 11874
331 Ga0207651_10199460 3300025960 Bacteria 1602
332 Ga0207651_10544690 3300025960 Bacteria 1008
333 Ga0207712_10000491 3300025961 Bacteria 32766
334 Ga0207712_10288626 3300025961 Bacteria 1342
335 Ga0207668_10050499 3300025972 Bacteria 2867
336 Ga0207668_10094425 3300025972 Bacteria 2205
337 Ga0207668_10098447 3300025972 Bacteria 2167
338 Ga0207668_10132596 3300025972 Bacteria 1904
339 Ga0207640_10009513 3300025981 Bacteria 5444
340 Ga0207640_10021292 3300025981 Bacteria 3863
341 Ga0207640_10106567 3300025981 Bacteria 1977
342 Ga0207658_10007445 3300025986 Bacteria 7463
343 Ga0207658_10017187 3300025986 Bacteria 4984
344 Ga0207658_10018485 3300025986 Bacteria 4813
345 Ga0207658_10066051 3300025986 Bacteria 2719
346 Ga0207658_10373405 3300025986 Bacteria 1247
347 Ga0207677_10023455 3300026023 Bacteria 3813
348 Ga0207677_10061824 3300026023 Bacteria 2595
349 Ga0207677_10113574 3300026023 Bacteria 2022
350 Ga0207677_10391352 3300026023 Bacteria 1176
351 Ga0207703_10002126 3300026035 Bacteria 17427
352 Ga0207703_10002982 3300026035 Bacteria 14350
353 Ga0207703_10003193 3300026035 Bacteria 13798
354 Ga0207703_10132812 3300026035 Bacteria 2152
355 Ga0207703_10642265 3300026035 Bacteria 1006
356 Ga0207639_10005382 3300026041 Bacteria 8654
357 Ga0207639_10037273 3300026041 Bacteria 3610
358 Ga0207639_10640146 3300026041 Bacteria 983
359 Ga0207678_10000308 3300026067 Bacteria 43995
360 Ga0207678_10008496 3300026067 Bacteria 9051
361 Ga0207678_10043334 3300026067 Bacteria 3894
362 Ga0207678_10251570 3300026067 Bacteria 1513
363 Ga0207678_10283700 3300026067 Bacteria 1422
364 Ga0207641_10001374 3300026088 Bacteria 24044
365 Ga0207641_10010491 3300026088 Bacteria 7604
366 Ga0207641_10016527 3300026088 Bacteria 6043
367 Ga0207641_10098576 3300026088 Bacteria 2570
368 Ga0207641_10120193 3300026088 Bacteria 2343
369 Ga0207648_10031677 3300026089 Bacteria 4674
370 Ga0207648_10169583 3300026089 Bacteria 1929
371 Ga0207676_10000345 3300026095 Bacteria 39937
372 Ga0207676_10003004 3300026095 Bacteria 12027
373 Ga0207676_10003557 3300026095 Bacteria 11013
374 Ga0207676_10210521 3300026095 Bacteria 1724
375 Ga0207674_10000345 3300026116 Bacteria 59803
376 Ga0207674_10009232 3300026116 Bacteria 11304
377 Ga0207674_10017364 3300026116 Bacteria 7852
378 Ga0207674_10119519 3300026116 Bacteria 2604
379 Ga0207674_10477782 3300026116 Bacteria 1205
380 Ga0207675_100008821 3300026118 Bacteria 9463
381 Ga0207675_100139258 3300026118 Bacteria 2304
382 Ga0207675_100214827 3300026118 Bacteria 1851
383 Ga0207683_11350793 3300026121 Bacteria 659
384 Ga0207698_10006585 3300026142 Bacteria 7262
385 Ga0207698_10326102 3300026142 Bacteria 1440
386 Ga0268266_10002013 3300028379 Bacteria 22668
387 Ga0268266_10316007 3300028379 Bacteria 1460
388 Ga0268266_10783773 3300028379 Bacteria 920
389 Ga0268266_10915950 3300028379 Bacteria 848
390 Ga0268265_10013286 3300028380 Bacteria 5595
391 Ga0268265_10028689 3300028380 Bacteria 3988
392 Ga0268265_10277797 3300028380 Bacteria 1497
393 Ga0268265_10503658 3300028380 Bacteria 1141
394 Ga0268264_10001319 3300028381 Bacteria 23348
395 Ga0268264_10002725 3300028381 Bacteria 15417
396 Ga0268264_10008787 3300028381 Bacteria 8382
397 Ga0268264_10112053 3300028381 Bacteria 2391
398 Ga0316182_1441053 3300030745 Bacteria 2578
399 Ga0307513_10133096 3300031456 Bacteria 2428
400 Ga0307413_10003489 3300031824 Bacteria 6626
401 Ga0307413_10007812 3300031824 Bacteria 4999
402 Ga0307410_10001011 3300031852 Bacteria 12185
403 Ga0307410_10091226 3300031852 Bacteria 2163
404 Ga0307410_10093383 3300031852 Bacteria 2141
405 Ga0307410_10150995 3300031852 Bacteria 1730
406 Ga0307410_10174796 3300031852 Bacteria 1621
407 Ga0307410_10620926 3300031852 Bacteria 903
408 Ga0307406_10098817 3300031901 Bacteria 1983
409 Ga0307406_10205252 3300031901 Bacteria 1454
410 Ga0307406_10657665 3300031901 Bacteria 870
411 Ga0307406_10742729 3300031901 Bacteria 823
412 Ga0307407_10026709 3300031903 Bacteria 3061
413 Ga0307407_10145405 3300031903 Bacteria 1534
414 Ga0307412_10027266 3300031911 Bacteria 3559
415 Ga0307412_10183549 3300031911 Bacteria 1576
416 Ga0307412_10605268 3300031911 Bacteria 929
417 Ga0307409_100022308 3300031995 Bacteria 4362
418 Ga0307409_100105244 3300031995 Bacteria 2352
419 Ga0307409_100349112 3300031995 Bacteria 1395
420 Ga0307409_100980770 3300031995 Bacteria 862
421 Ga0307416_100009904 3300032002 Bacteria 6269
422 Ga0307416_100135503 3300032002 Bacteria 2226
423 Ga0307416_100345203 3300032002 Bacteria 1504
424 Ga0307416_100480813 3300032002 Bacteria 1302
425 Ga0307414_10027349 3300032004 Bacteria 3684
426 Ga0307414_10054645 3300032004 Bacteria 2792
427 Ga0307414_10064693 3300032004 Bacteria 2605
428 Ga0307414_10073425 3300032004 Bacteria 2475
429 Ga0307414_10134435 3300032004 Bacteria 1925
430 Ga0307414_11440922 3300032004 Bacteria 640
431 Ga0307411_10060043 3300032005 Bacteria 2523
432 Ga0307411_10096919 3300032005 Bacteria 2074
433 Ga0307411_10153806 3300032005 Bacteria 1713
434 Ga0307411_10186773 3300032005 Bacteria 1578
435 Ga0307415_100005560 3300032126 Bacteria 6706
436 Ga0307415_100431191 3300032126 Bacteria 1134
437 Ga0307415_100514489 3300032126 Bacteria 1049
438 Ga0307415_100844273 3300032126 Bacteria 840
439 Ga0373928_0133261 3300035084 Bacteria 675
440 Ga0373941_0045677 3300035115 Bacteria 1372
441 Ga0373941_0270645 3300035115 Bacteria 669
442 Ga0395899_0150035 3300037312 Bacteria 1653
443 Ga0395899_0193494 3300037312 Bacteria 1422
444 Ga0395899_0289336 3300037312 Bacteria 1112
445 Ga0395900_0141297 3300037418 Bacteria 2465
446 Ga0395900_0171575 3300037418 Bacteria 2208
447 Ga0395900_0218774 3300037418 Bacteria 1921
448 Ga0395900_0252395 3300037418 Bacteria 1765
449 Ga0395900_0432079 3300037418 Bacteria 1276
450 Ga0395900_0699822 3300037418 Bacteria 947
451 Ga0395900_1734712 3300037418 Bacteria 535
452 Ga0395898_0188293 3300037466 Bacteria 1972
453 Ga0395898_0833153 3300037466 Bacteria 862
454 Ga0395905_0002924 3300037471 Bacteria 18610
455 Ga0395905_0048360 3300037471 Bacteria 3986
456 Ga0395905_0110907 3300037471 Bacteria 2576
457 Ga0395905_0112853 3300037471 Bacteria 2553
458 Ga0395905_0132064 3300037471 Bacteria 2348
459 Ga0395905_0138687 3300037471 Bacteria 2288
460 Ga0395905_0544999 3300037471 Bacteria 1061
461 Ga0395905_0767373 3300037471 Bacteria 867
462 Ga0395905_0818883 3300037471 Bacteria 834
463 Ga0395905_1059563 3300037471 Bacteria 714
464 Ga0395905_1438422 3300037471 Bacteria 593
465 Ga0436364_1447256 3300037853 Bacteria 12455
466 Ga0395901_0276078 3300038443 Bacteria 1747
467 Ga0395901_0420955 3300038443 Bacteria 1370
468 Ga0439436_0029541 3300041404 Bacteria 1597
469 Ga0439433_0012801 3300041999 Bacteria 1841
470 Ga0439449_0160448 3300042007 Bacteria 839
471 Ga0439457_168524 3300042014 Bacteria 532
472 Ga0439462_0039918 3300042015 Bacteria 1252
473 Ga0439462_0082122 3300042015 Bacteria 881
474 Ga0450898_049950 3300042134 Bacteria 807
475 Ga0439446_0068062 3300042156 Bacteria 1086
476 Ga0439464_0003467 3300042439 Bacteria 3980
477 Ga0450916_041660 3300042530 Unclassified 700
478 Ga0466961_0127961 3300044693 Bacteria 1593
479 Ga0466963_0098585 3300044694 Bacteria 1998
480 Ga0466963_0139434 3300044694 Bacteria 1679
481 Ga0466971_0195043 3300044719 Bacteria 955
482 Ga0466970_0038874 3300044765 Bacteria 2525
483 Ga0466957_0108511 3300044842 Bacteria 1758
484 Ga0466957_0135248 3300044842 Bacteria 1583
485 Ga0466960_0014000 3300044901 Bacteria 3420
486 Ga0466960_0968839 3300044901 Bacteria 521
487 Ga0466967_0064086 3300045976 Bacteria 3267
488 Ga0466967_0066837 3300045976 Bacteria 3204
489 Ga0466967_0423788 3300045976 Bacteria 1297
490 Ga0495642_0170210 3300046528 Bacteria 946
491 Ga0495668_0004223 3300046616 Bacteria 10344
492 Ga0495668_0222530 3300046616 Bacteria 1033
493 Ga0495669_0081947 3300046684 Bacteria 1482
494 Ga0495669_0096691 3300046684 Bacteria 1368
495 Ga0496100_0093742 3300048903 Bacteria 2055
496 Ga0496101_0021277 3300048904 Bacteria 4456
497 Ga0496102_1361926 3300048905 Bacteria 629
498 Ga0496103_0347571 3300048906 Bacteria 954
499 Ga0496106_0122019 3300048909 Bacteria 2037
500 Ga0496106_0545332 3300048909 Bacteria 931
501 Ga0496107_0050668 3300048910 Bacteria 2993
502 Ga0496107_0056415 3300048910 Bacteria 2838
503 Ga0496109_0067684 3300048912 Bacteria 3272
504 Ga0496110_0160557 3300048913 Bacteria 2037
505 Ga0496110_0919709 3300048913 Bacteria 781
506 Ga0496111_0007174 3300048914 Bacteria 7284
507 Ga0496111_0494240 3300048914 Bacteria 901
508 Ga0496112_0072247 3300048915 Bacteria 3410
509 Ga0496113_0075377 3300048916 Bacteria 2575
510 Ga0501074_0392681 3300049590 Bacteria 984
511 Ga0501202_054991 3300049652 Bacteria 889
512 Ga0501209_037464 3300049656 Bacteria 1266
513 Ga0501217_205911 3300049661 Bacteria 615
514 Ga0501235_074513 3300049669 Bacteria 806
515 Ga0501242_032233 3300049674 Bacteria 714
516 Ga0501249_059130 3300049679 Bacteria 886
517 Ga0501221_110631 3300049704 Bacteria 692
518 Ga0501079_0258631 3300049741 Bacteria 1361
519 Ga0501080_0100448 3300049742 Bacteria 2684
520 Ga0501266_010734 3300049763 Bacteria 1169
521 Ga0501268_005161 3300049765 Bacteria 1867
522 Ga0501212_087197 3300049851 Bacteria 572
523 nmdc:mga0a205_3422_c1 3300050515 Bacteria 14147
524 Ga0500658_0000044 3300053134 Bacteria 72423

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042134 Ga0450898_049950 Ga0450898_049950_58_528 137
2 3300005455 Ga0070663_100521755 Ga0070663_1005217552 147
3 3300049652 Ga0501202_054991 Ga0501202_054991_252_725 148
4 3300049669 Ga0501235_074513 Ga0501235_074513_34_507 148
5 3300049674 Ga0501242_032233 Ga0501242_032233_208_681 148
6 3300049679 Ga0501249_059130 Ga0501249_059130_396_869 148
7 3300049704 Ga0501221_110631 Ga0501221_110631_174_647 148
8 3300049851 Ga0501212_087197 Ga0501212_087197_82_555 148
9 3300048905 Ga0496102_1361926 Ga0496102_1361926_15_464 149
10 3300005339 Ga0070660_100128812 Ga0070660_1001288122 150
11 3300005985 Ga0081539_10017580 Ga0081539_100175803 150
12 3300037471 Ga0395905_0767373 Ga0395905_0767373_82_555 150
13 3300005331 Ga0070670_101099541 Ga0070670_1010995411 151
14 3300005338 Ga0068868_100117591 Ga0068868_1001175913 151
15 3300005364 Ga0070673_100033051 Ga0070673_1000330513 151
16 3300005367 Ga0070667_100000776 Ga0070667_1000007761 151
17 3300005617 Ga0068859_100002632 Ga0068859_10000263213 151
18 3300005618 Ga0068864_100000287 Ga0068864_10000028718 151
19 3300005841 Ga0068863_100002077 Ga0068863_10000207710 151
20 3300005842 Ga0068858_100000579 Ga0068858_1000005796 151
21 3300005843 Ga0068860_100004159 Ga0068860_1000041591 151
22 3300005844 Ga0068862_100941099 Ga0068862_1009410992 151
23 3300006931 Ga0097620_100002632 Ga0097620_10000263213 151
24 3300009011 Ga0105251_10085545 Ga0105251_100855452 151
25 3300009092 Ga0105250_10005450 Ga0105250_100054503 151
26 3300009101 Ga0105247_10179959 Ga0105247_101799592 151
27 3300009177 Ga0105248_10000552 Ga0105248_1000055213 151
28 3300009553 Ga0105249_10329902 Ga0105249_103299022 151
29 3300013306 Ga0163162_10052041 Ga0163162_100520415 151
30 3300014325 Ga0163163_10000390 Ga0163163_1000039037 151
31 3300014968 Ga0157379_10180699 Ga0157379_101806992 151
32 3300025711 Ga0207696_1004959 Ga0207696_10049593 151
33 3300025900 Ga0207710_10278561 Ga0207710_102785612 151
34 3300025923 Ga0207681_10088083 Ga0207681_100880832 151
35 3300025925 Ga0207650_11353542 Ga0207650_113535421 151
36 3300025931 Ga0207644_10021887 Ga0207644_100218871 151
37 3300025941 Ga0207711_10000046 Ga0207711_10000046134 151
38 3300025960 Ga0207651_10001136 Ga0207651_100011365 151
39 3300025961 Ga0207712_10288626 Ga0207712_102886262 151
40 3300025986 Ga0207658_10007445 Ga0207658_1000744510 151
41 3300026023 Ga0207677_10113574 Ga0207677_101135743 151
42 3300026035 Ga0207703_10002982 Ga0207703_1000298215 151
43 3300026067 Ga0207678_10251570 Ga0207678_102515702 151
44 3300026088 Ga0207641_10001374 Ga0207641_1000137412 151
45 3300026095 Ga0207676_10000345 Ga0207676_1000034538 151
46 3300028380 Ga0268265_10503658 Ga0268265_105036582 151
47 3300028381 Ga0268264_10001319 Ga0268264_1000131929 151
48 3300001990 JGI24737J22298_10100641 JGI24737J22298_101006411 154
49 3300013100 Ga0157373_10030128 Ga0157373_100301281 156
50 3300013102 Ga0157371_10048674 Ga0157371_100486743 156
51 3300030745 Ga0316182_1441053 Ga0316182_14410532 156
52 3300031911 Ga0307412_10183549 Ga0307412_101835492 156
53 3300032126 Ga0307415_100844273 Ga0307415_1008442731 156
54 3300042530 Ga0450916_041660 Ga0450916_041660_157_627 156
55 3300001915 JGI24741J21665_1024051 JGI24741J21665_10240511 157
56 3300001979 JGI24740J21852_10001677 JGI24740J21852_100016775 157
57 3300001979 JGI24740J21852_10006406 JGI24740J21852_100064063 157
58 3300001989 JGI24739J22299_10010205 JGI24739J22299_100102052 157
59 3300001989 JGI24739J22299_10018551 JGI24739J22299_100185513 157
60 3300001990 JGI24737J22298_10000221 JGI24737J22298_1000022112 157
61 3300001990 JGI24737J22298_10034433 JGI24737J22298_100344332 157
62 3300001990 JGI24737J22298_10048327 JGI24737J22298_100483272 157
63 3300001991 JGI24743J22301_10006580 JGI24743J22301_100065802 157
64 3300002067 JGI24735J21928_10093067 JGI24735J21928_100930672 157
65 3300002070 JGI24750J21931_1007719 JGI24750J21931_10077192 157
66 3300002073 JGI24745J21846_1005138 JGI24745J21846_10051382 157
67 3300002075 JGI24738J21930_10008528 JGI24738J21930_100085281 157
68 3300002077 JGI24744J21845_10029985 JGI24744J21845_100299852 157
69 3300002239 JGI24034J26672_10028609 JGI24034J26672_100286092 157
70 3300005293 Ga0065715_10009313 Ga0065715_100093133 157
71 3300005293 Ga0065715_10036540 Ga0065715_100365402 157
72 3300005327 Ga0070658_10077516 Ga0070658_100775163 157
73 3300005327 Ga0070658_10187940 Ga0070658_101879401 157
74 3300005327 Ga0070658_11414388 Ga0070658_114143881 157
75 3300005328 Ga0070676_10002314 Ga0070676_100023142 157
76 3300005328 Ga0070676_10004745 Ga0070676_100047452 157
77 3300005328 Ga0070676_10012510 Ga0070676_100125105 157
78 3300005328 Ga0070676_10038089 Ga0070676_100380892 157
79 3300005328 Ga0070676_10424335 Ga0070676_104243352 157
80 3300005329 Ga0070683_100093326 Ga0070683_1000933263 157
81 3300005331 Ga0070670_100005417 Ga0070670_10000541710 157
82 3300005331 Ga0070670_100044489 Ga0070670_1000444893 157
83 3300005331 Ga0070670_100047275 Ga0070670_1000472753 157
84 3300005331 Ga0070670_100253196 Ga0070670_1002531961 157
85 3300005331 Ga0070670_101204550 Ga0070670_1012045501 157
86 3300005333 Ga0070677_10017076 Ga0070677_100170763 157
87 3300005333 Ga0070677_10047171 Ga0070677_100471712 157
88 3300005334 Ga0068869_100000662 Ga0068869_1000006624 157
89 3300005334 Ga0068869_100013127 Ga0068869_1000131271 157
90 3300005334 Ga0068869_100187507 Ga0068869_1001875072 157
91 3300005334 Ga0068869_100524880 Ga0068869_1005248802 157
92 3300005335 Ga0070666_10016286 Ga0070666_100162865 157
93 3300005335 Ga0070666_10016307 Ga0070666_100163072 157
94 3300005335 Ga0070666_10109944 Ga0070666_101099442 157
95 3300005336 Ga0070680_100122607 Ga0070680_1001226073 157
96 3300005336 Ga0070680_100672210 Ga0070680_1006722102 157
97 3300005337 Ga0070682_100229205 Ga0070682_1002292051 157
98 3300005337 Ga0070682_100665627 Ga0070682_1006656272 157
99 3300005338 Ga0068868_100001411 Ga0068868_10000141121 157
100 3300005338 Ga0068868_100346260 Ga0068868_1003462602 157
101 3300005339 Ga0070660_100010601 Ga0070660_1000106017 157
102 3300005339 Ga0070660_100064014 Ga0070660_1000640142 157
103 3300005339 Ga0070660_100091564 Ga0070660_1000915642 157
104 3300005339 Ga0070660_100492905 Ga0070660_1004929051 157
105 3300005339 Ga0070660_100545835 Ga0070660_1005458352 157
106 3300005339 Ga0070660_100733816 Ga0070660_1007338161 157
107 3300005339 Ga0070660_100953178 Ga0070660_1009531781 157
108 3300005339 Ga0070660_101087949 Ga0070660_1010879491 157
109 3300005341 Ga0070691_10208438 Ga0070691_102084382 157
110 3300005344 Ga0070661_100882323 Ga0070661_1008823231 157
111 3300005347 Ga0070668_100007531 Ga0070668_1000075313 157
112 3300005347 Ga0070668_100040876 Ga0070668_1000408762 157
113 3300005347 Ga0070668_100098504 Ga0070668_1000985042 157
114 3300005353 Ga0070669_100000682 Ga0070669_10000068210 157
115 3300005353 Ga0070669_100025231 Ga0070669_1000252313 157
116 3300005353 Ga0070669_100114258 Ga0070669_1001142581 157
117 3300005354 Ga0070675_100003697 Ga0070675_1000036979 157
118 3300005354 Ga0070675_100042801 Ga0070675_1000428013 157
119 3300005354 Ga0070675_100133608 Ga0070675_1001336083 157
120 3300005354 Ga0070675_100266298 Ga0070675_1002662982 157
121 3300005355 Ga0070671_100007783 Ga0070671_1000077837 157
122 3300005355 Ga0070671_100043661 Ga0070671_1000436612 157
123 3300005355 Ga0070671_100058477 Ga0070671_1000584773 157
124 3300005356 Ga0070674_100052696 Ga0070674_1000526962 157
125 3300005364 Ga0070673_100000833 Ga0070673_1000008334 157
126 3300005364 Ga0070673_100009304 Ga0070673_1000093045 157
127 3300005364 Ga0070673_100066431 Ga0070673_1000664312 157
128 3300005366 Ga0070659_100000950 Ga0070659_1000009509 157
129 3300005366 Ga0070659_100001481 Ga0070659_10000148110 157
130 3300005366 Ga0070659_100039104 Ga0070659_1000391042 157
131 3300005366 Ga0070659_100334758 Ga0070659_1003347581 157
132 3300005366 Ga0070659_100438140 Ga0070659_1004381402 157
133 3300005367 Ga0070667_100006561 Ga0070667_1000065619 157
134 3300005367 Ga0070667_100013906 Ga0070667_1000139064 157
135 3300005367 Ga0070667_100058875 Ga0070667_1000588753 157
136 3300005367 Ga0070667_100252556 Ga0070667_1002525562 157
137 3300005367 Ga0070667_100455961 Ga0070667_1004559612 157
138 3300005367 Ga0070667_101047906 Ga0070667_1010479062 157
139 3300005444 Ga0070694_100003228 Ga0070694_1000032289 157
140 3300005455 Ga0070663_100005818 Ga0070663_1000058185 157
141 3300005455 Ga0070663_100022238 Ga0070663_1000222383 157
142 3300005455 Ga0070663_101906632 Ga0070663_1019066321 157
143 3300005457 Ga0070662_100006881 Ga0070662_1000068816 157
144 3300005457 Ga0070662_100022242 Ga0070662_1000222421 157
145 3300005457 Ga0070662_100034774 Ga0070662_1000347742 157
146 3300005457 Ga0070662_100049099 Ga0070662_1000490993 157
147 3300005457 Ga0070662_100141249 Ga0070662_1001412492 157
148 3300005458 Ga0070681_10090766 Ga0070681_100907662 157
149 3300005458 Ga0070681_10163066 Ga0070681_101630662 157
150 3300005458 Ga0070681_10378623 Ga0070681_103786232 157
151 3300005459 Ga0068867_100033101 Ga0068867_1000331014 157
152 3300005459 Ga0068867_100035018 Ga0068867_1000350182 157
153 3300005459 Ga0068867_101687128 Ga0068867_1016871281 157
154 3300005530 Ga0070679_100033899 Ga0070679_1000338992 157
155 3300005530 Ga0070679_100753421 Ga0070679_1007534211 157
156 3300005530 Ga0070679_100808397 Ga0070679_1008083971 157
157 3300005535 Ga0070684_100218702 Ga0070684_1002187022 157
158 3300005539 Ga0068853_100001659 Ga0068853_10000165912 157
159 3300005539 Ga0068853_100139035 Ga0068853_1001390352 157
160 3300005539 Ga0068853_100233159 Ga0068853_1002331592 157
161 3300005539 Ga0068853_100835526 Ga0068853_1008355261 157
162 3300005543 Ga0070672_100000589 Ga0070672_10000058911 157
163 3300005543 Ga0070672_100097092 Ga0070672_1000970922 157
164 3300005543 Ga0070672_100307710 Ga0070672_1003077102 157
165 3300005543 Ga0070672_101346839 Ga0070672_1013468391 157
166 3300005545 Ga0070695_100134661 Ga0070695_1001346612 157
167 3300005545 Ga0070695_101690110 Ga0070695_1016901101 157
168 3300005546 Ga0070696_100019918 Ga0070696_1000199185 157
169 3300005547 Ga0070693_100009371 Ga0070693_1000093716 157
170 3300005547 Ga0070693_100172114 Ga0070693_1001721142 157
171 3300005548 Ga0070665_100071855 Ga0070665_1000718554 157
172 3300005548 Ga0070665_100533889 Ga0070665_1005338892 157
173 3300005549 Ga0070704_100180504 Ga0070704_1001805042 157
174 3300005563 Ga0068855_100008531 Ga0068855_1000085319 157
175 3300005563 Ga0068855_100889489 Ga0068855_1008894891 157
176 3300005564 Ga0070664_100008433 Ga0070664_1000084332 157
177 3300005564 Ga0070664_100009351 Ga0070664_1000093518 157
178 3300005564 Ga0070664_100095934 Ga0070664_1000959342 157
179 3300005564 Ga0070664_100320269 Ga0070664_1003202692 157
180 3300005564 Ga0070664_100939337 Ga0070664_1009393372 157
181 3300005564 Ga0070664_102022803 Ga0070664_1020228031 157
182 3300005577 Ga0068857_100000692 Ga0068857_1000006923 157
183 3300005577 Ga0068857_100128610 Ga0068857_1001286102 157
184 3300005578 Ga0068854_100001058 Ga0068854_10000105821 157
185 3300005578 Ga0068854_100003715 Ga0068854_1000037153 157
186 3300005578 Ga0068854_100014106 Ga0068854_1000141063 157
187 3300005616 Ga0068852_100024796 Ga0068852_1000247966 157
188 3300005616 Ga0068852_100181698 Ga0068852_1001816982 157
189 3300005617 Ga0068859_100007420 Ga0068859_1000074208 157
190 3300005617 Ga0068859_100016870 Ga0068859_1000168701 157
191 3300005617 Ga0068859_100032223 Ga0068859_1000322236 157
192 3300005617 Ga0068859_100034904 Ga0068859_1000349043 157
193 3300005618 Ga0068864_100000748 Ga0068864_10000074820 157
194 3300005618 Ga0068864_100000894 Ga0068864_1000008944 157
195 3300005618 Ga0068864_100013544 Ga0068864_1000135447 157
196 3300005618 Ga0068864_101089932 Ga0068864_1010899321 157
197 3300005718 Ga0068866_10770154 Ga0068866_107701542 157
198 3300005719 Ga0068861_100024292 Ga0068861_1000242922 157
199 3300005719 Ga0068861_100946812 Ga0068861_1009468121 157
200 3300005834 Ga0068851_10559861 Ga0068851_105598612 157
201 3300005840 Ga0068870_10247865 Ga0068870_102478652 157
202 3300005841 Ga0068863_100050840 Ga0068863_1000508403 157
203 3300005841 Ga0068863_100062372 Ga0068863_1000623722 157
204 3300005841 Ga0068863_100120017 Ga0068863_1001200174 157
205 3300005841 Ga0068863_100585507 Ga0068863_1005855072 157
206 3300005842 Ga0068858_100012043 Ga0068858_1000120431 157
207 3300005842 Ga0068858_100032449 Ga0068858_1000324495 157
208 3300005842 Ga0068858_100033541 Ga0068858_1000335414 157
209 3300005842 Ga0068858_100459945 Ga0068858_1004599452 157
210 3300005843 Ga0068860_100006012 Ga0068860_1000060127 157
211 3300005843 Ga0068860_100019373 Ga0068860_1000193736 157
212 3300005843 Ga0068860_100025537 Ga0068860_1000255375 157
213 3300005844 Ga0068862_100018299 Ga0068862_1000182995 157
214 3300005844 Ga0068862_100096710 Ga0068862_1000967102 157
215 3300006175 Ga0070712_100118137 Ga0070712_1001181372 157
216 3300006237 Ga0097621_100470385 Ga0097621_1004703852 157
217 3300006852 Ga0075433_10203594 Ga0075433_102035942 157
218 3300006871 Ga0075434_100119783 Ga0075434_1001197833 157
219 3300006881 Ga0068865_100077559 Ga0068865_1000775593 157
220 3300006931 Ga0097620_100007420 Ga0097620_1000074208 157
221 3300006931 Ga0097620_100016869 Ga0097620_1000168691 157
222 3300006931 Ga0097620_100032223 Ga0097620_1000322232 157
223 3300006931 Ga0097620_100034904 Ga0097620_1000349043 157
224 3300007076 Ga0075435_100190747 Ga0075435_1001907472 157
225 3300009093 Ga0105240_10104592 Ga0105240_101045922 157
226 3300009093 Ga0105240_10172394 Ga0105240_101723942 157
227 3300009098 Ga0105245_10005839 Ga0105245_100058392 157
228 3300009098 Ga0105245_10030174 Ga0105245_100301742 157
229 3300009101 Ga0105247_10148459 Ga0105247_101484592 157
230 3300009148 Ga0105243_10023746 Ga0105243_100237462 157
231 3300009174 Ga0105241_10098336 Ga0105241_100983362 157
232 3300009176 Ga0105242_10048328 Ga0105242_100483284 157
233 3300009177 Ga0105248_10006033 Ga0105248_100060331 157
234 3300009177 Ga0105248_10010327 Ga0105248_100103278 157
235 3300009177 Ga0105248_10082850 Ga0105248_100828502 157
236 3300009177 Ga0105248_10260014 Ga0105248_102600142 157
237 3300009551 Ga0105238_10064099 Ga0105238_100640995 157
238 3300009553 Ga0105249_10020672 Ga0105249_100206725 157
239 3300009553 Ga0105249_10047596 Ga0105249_100475961 157
240 3300010375 Ga0105239_10145487 Ga0105239_101454873 157
241 3300010375 Ga0105239_10284780 Ga0105239_102847802 157
242 3300011119 Ga0105246_10202665 Ga0105246_102026652 157
243 3300013100 Ga0157373_10005180 Ga0157373_100051805 157
244 3300013100 Ga0157373_10126438 Ga0157373_101264382 157
245 3300013100 Ga0157373_10209815 Ga0157373_102098152 157
246 3300013100 Ga0157373_11055251 Ga0157373_110552511 157
247 3300013102 Ga0157371_10004027 Ga0157371_100040277 157
248 3300013102 Ga0157371_10044632 Ga0157371_100446322 157
249 3300013102 Ga0157371_10068264 Ga0157371_100682642 157
250 3300013102 Ga0157371_11283196 Ga0157371_112831961 157
251 3300013297 Ga0157378_10011763 Ga0157378_100117639 157
252 3300013297 Ga0157378_11034548 Ga0157378_110345482 157
253 3300013306 Ga0163162_10050160 Ga0163162_100501605 157
254 3300013306 Ga0163162_10328724 Ga0163162_103287242 157
255 3300013306 Ga0163162_10429662 Ga0163162_104296622 157
256 3300013307 Ga0157372_10053038 Ga0157372_100530382 157
257 3300013308 Ga0157375_10409993 Ga0157375_104099932 157
258 3300013308 Ga0157375_11031427 Ga0157375_110314272 157
259 3300014325 Ga0163163_11929995 Ga0163163_119299952 157
260 3300014326 Ga0157380_10004000 Ga0157380_100040006 157
261 3300014326 Ga0157380_10026397 Ga0157380_100263976 157
262 3300014326 Ga0157380_10026652 Ga0157380_100266525 157
263 3300014745 Ga0157377_10025447 Ga0157377_100254472 157
264 3300014745 Ga0157377_10381605 Ga0157377_103816052 157
265 3300014968 Ga0157379_10465856 Ga0157379_104658562 157
266 3300014968 Ga0157379_10848286 Ga0157379_108482862 157
267 3300014968 Ga0157379_10919406 Ga0157379_109194062 157
268 3300021388 Ga0213875_10002975 Ga0213875_100029752 157
269 3300025290 Ga0207673_1000994 Ga0207673_10009942 157
270 3300025315 Ga0207697_10000253 Ga0207697_100002539 157
271 3300025321 Ga0207656_10500629 Ga0207656_105006291 157
272 3300025893 Ga0207682_10001459 Ga0207682_100014593 157
273 3300025893 Ga0207682_10037597 Ga0207682_100375972 157
274 3300025893 Ga0207682_10185145 Ga0207682_101851451 157
275 3300025899 Ga0207642_10017810 Ga0207642_100178103 157
276 3300025901 Ga0207688_10000652 Ga0207688_100006526 157
277 3300025901 Ga0207688_10607426 Ga0207688_106074261 157
278 3300025904 Ga0207647_10000327 Ga0207647_1000032732 157
279 3300025904 Ga0207647_10000760 Ga0207647_100007604 157
280 3300025907 Ga0207645_10007069 Ga0207645_100070698 157
281 3300025907 Ga0207645_10017352 Ga0207645_100173524 157
282 3300025907 Ga0207645_10061798 Ga0207645_100617982 157
283 3300025908 Ga0207643_10180326 Ga0207643_101803262 157
284 3300025909 Ga0207705_10408753 Ga0207705_104087532 157
285 3300025912 Ga0207707_10155977 Ga0207707_101559772 157
286 3300025912 Ga0207707_10282084 Ga0207707_102820842 157
287 3300025912 Ga0207707_10608263 Ga0207707_106082632 157
288 3300025913 Ga0207695_10137659 Ga0207695_101376592 157
289 3300025915 Ga0207693_10040495 Ga0207693_100404954 157
290 3300025917 Ga0207660_10079087 Ga0207660_100790873 157
291 3300025917 Ga0207660_10254269 Ga0207660_102542692 157
292 3300025919 Ga0207657_10003476 Ga0207657_1000347620 157
293 3300025919 Ga0207657_10009310 Ga0207657_1000931011 157
294 3300025919 Ga0207657_10025878 Ga0207657_100258784 157
295 3300025919 Ga0207657_10062356 Ga0207657_100623564 157
296 3300025919 Ga0207657_10378404 Ga0207657_103784042 157
297 3300025919 Ga0207657_10519777 Ga0207657_105197771 157
298 3300025919 Ga0207657_10633242 Ga0207657_106332423 157
299 3300025919 Ga0207657_10853312 Ga0207657_108533122 157
300 3300025920 Ga0207649_10104439 Ga0207649_101044392 157
301 3300025920 Ga0207649_10415378 Ga0207649_104153782 157
302 3300025921 Ga0207652_11599847 Ga0207652_115998471 157
303 3300025923 Ga0207681_10018564 Ga0207681_100185644 157
304 3300025923 Ga0207681_10025163 Ga0207681_100251634 157
305 3300025923 Ga0207681_10060721 Ga0207681_100607212 157
306 3300025923 Ga0207681_10126585 Ga0207681_101265852 157
307 3300025925 Ga0207650_10063190 Ga0207650_100631903 157
308 3300025925 Ga0207650_10068150 Ga0207650_100681503 157
309 3300025925 Ga0207650_10147802 Ga0207650_101478022 157
310 3300025926 Ga0207659_10004610 Ga0207659_100046109 157
311 3300025926 Ga0207659_10012653 Ga0207659_100126534 157
312 3300025926 Ga0207659_10117106 Ga0207659_101171062 157
313 3300025926 Ga0207659_10142012 Ga0207659_101420122 157
314 3300025927 Ga0207687_10003036 Ga0207687_100030362 157
315 3300025927 Ga0207687_10141139 Ga0207687_101411392 157
316 3300025929 Ga0207664_11310686 Ga0207664_113106862 157
317 3300025931 Ga0207644_10044552 Ga0207644_100445522 157
318 3300025931 Ga0207644_10102178 Ga0207644_101021782 157
319 3300025931 Ga0207644_10512081 Ga0207644_105120812 157
320 3300025932 Ga0207690_10001585 Ga0207690_100015855 157
321 3300025932 Ga0207690_10002341 Ga0207690_1000234110 157
322 3300025932 Ga0207690_10023323 Ga0207690_100233232 157
323 3300025932 Ga0207690_10185459 Ga0207690_101854592 157
324 3300025933 Ga0207706_10000143 Ga0207706_1000014310 157
325 3300025933 Ga0207706_10000904 Ga0207706_1000090433 157
326 3300025933 Ga0207706_10003074 Ga0207706_100030749 157
327 3300025933 Ga0207706_10004098 Ga0207706_100040985 157
328 3300025933 Ga0207706_10013609 Ga0207706_100136094 157
329 3300025933 Ga0207706_10215155 Ga0207706_102151552 157
330 3300025937 Ga0207669_10014002 Ga0207669_100140022 157
331 3300025938 Ga0207704_10047537 Ga0207704_100475373 157
332 3300025938 Ga0207704_10056039 Ga0207704_100560392 157
333 3300025940 Ga0207691_10000743 Ga0207691_1000074333 157
334 3300025940 Ga0207691_10066655 Ga0207691_100666551 157
335 3300025940 Ga0207691_10146453 Ga0207691_101464532 157
336 3300025940 Ga0207691_10329549 Ga0207691_103295491 157
337 3300025940 Ga0207691_10847910 Ga0207691_108479102 157
338 3300025941 Ga0207711_10006545 Ga0207711_1000654510 157
339 3300025941 Ga0207711_10059860 Ga0207711_100598604 157
340 3300025941 Ga0207711_10293281 Ga0207711_102932812 157
341 3300025942 Ga0207689_10000372 Ga0207689_1000037233 157
342 3300025942 Ga0207689_10003887 Ga0207689_1000388714 157
343 3300025942 Ga0207689_10012702 Ga0207689_100127025 157
344 3300025944 Ga0207661_10095396 Ga0207661_100953963 157
345 3300025944 Ga0207661_11149047 Ga0207661_111490472 157
346 3300025945 Ga0207679_10039220 Ga0207679_100392202 157
347 3300025945 Ga0207679_10040787 Ga0207679_100407873 157
348 3300025945 Ga0207679_10189033 Ga0207679_101890332 157
349 3300025945 Ga0207679_10544793 Ga0207679_105447932 157
350 3300025949 Ga0207667_10069720 Ga0207667_100697204 157
351 3300025949 Ga0207667_10130037 Ga0207667_101300373 157
352 3300025960 Ga0207651_10000440 Ga0207651_1000044015 157
353 3300025960 Ga0207651_10199460 Ga0207651_101994602 157
354 3300025960 Ga0207651_10544690 Ga0207651_105446902 157
355 3300025961 Ga0207712_10000491 Ga0207712_100004913 157
356 3300025972 Ga0207668_10050499 Ga0207668_100504992 157
357 3300025972 Ga0207668_10094425 Ga0207668_100944252 157
358 3300025972 Ga0207668_10098447 Ga0207668_100984472 157
359 3300025972 Ga0207668_10132596 Ga0207668_101325962 157
360 3300025981 Ga0207640_10009513 Ga0207640_100095132 157
361 3300025981 Ga0207640_10021292 Ga0207640_100212921 157
362 3300025981 Ga0207640_10106567 Ga0207640_101065673 157
363 3300025986 Ga0207658_10017187 Ga0207658_100171874 157
364 3300025986 Ga0207658_10018485 Ga0207658_100184853 157
365 3300025986 Ga0207658_10066051 Ga0207658_100660513 157
366 3300025986 Ga0207658_10373405 Ga0207658_103734052 157
367 3300026023 Ga0207677_10023455 Ga0207677_100234555 157
368 3300026023 Ga0207677_10061824 Ga0207677_100618243 157
369 3300026023 Ga0207677_10391352 Ga0207677_103913522 157
370 3300026035 Ga0207703_10002126 Ga0207703_1000212617 157
371 3300026035 Ga0207703_10003193 Ga0207703_1000319311 157
372 3300026035 Ga0207703_10132812 Ga0207703_101328123 157
373 3300026035 Ga0207703_10642265 Ga0207703_106422652 157
374 3300026041 Ga0207639_10005382 Ga0207639_100053822 157
375 3300026041 Ga0207639_10037273 Ga0207639_100372733 157
376 3300026041 Ga0207639_10640146 Ga0207639_106401462 157
377 3300026067 Ga0207678_10000308 Ga0207678_100003089 157
378 3300026067 Ga0207678_10008496 Ga0207678_100084966 157
379 3300026067 Ga0207678_10043334 Ga0207678_100433343 157
380 3300026067 Ga0207678_10283700 Ga0207678_102837002 157
381 3300026088 Ga0207641_10010491 Ga0207641_100104916 157
382 3300026088 Ga0207641_10016527 Ga0207641_100165273 157
383 3300026088 Ga0207641_10098576 Ga0207641_100985764 157
384 3300026088 Ga0207641_10120193 Ga0207641_101201932 157
385 3300026089 Ga0207648_10031677 Ga0207648_100316772 157
386 3300026089 Ga0207648_10169583 Ga0207648_101695832 157
387 3300026095 Ga0207676_10003004 Ga0207676_100030042 157
388 3300026095 Ga0207676_10003557 Ga0207676_100035579 157
389 3300026095 Ga0207676_10210521 Ga0207676_102105212 157
390 3300026116 Ga0207674_10000345 Ga0207674_1000034562 157
391 3300026116 Ga0207674_10009232 Ga0207674_100092328 157
392 3300026116 Ga0207674_10017364 Ga0207674_100173646 157
393 3300026116 Ga0207674_10119519 Ga0207674_101195192 157
394 3300026116 Ga0207674_10477782 Ga0207674_104777822 157
395 3300026118 Ga0207675_100008821 Ga0207675_1000088215 157
396 3300026118 Ga0207675_100139258 Ga0207675_1001392582 157
397 3300026118 Ga0207675_100214827 Ga0207675_1002148271 157
398 3300026121 Ga0207683_11350793 Ga0207683_113507931 157
399 3300026142 Ga0207698_10006585 Ga0207698_100065857 157
400 3300026142 Ga0207698_10326102 Ga0207698_103261022 157
401 3300028379 Ga0268266_10002013 Ga0268266_1000201311 157
402 3300028379 Ga0268266_10316007 Ga0268266_103160072 157
403 3300028379 Ga0268266_10783773 Ga0268266_107837732 157
404 3300028379 Ga0268266_10915950 Ga0268266_109159501 157
405 3300028380 Ga0268265_10013286 Ga0268265_100132861 157
406 3300028380 Ga0268265_10028689 Ga0268265_100286892 157
407 3300028380 Ga0268265_10277797 Ga0268265_102777972 157
408 3300028381 Ga0268264_10002725 Ga0268264_1000272510 157
409 3300028381 Ga0268264_10008787 Ga0268264_100087873 157
410 3300028381 Ga0268264_10112053 Ga0268264_101120532 157
411 3300031456 Ga0307513_10133096 Ga0307513_101330962 157
412 3300031824 Ga0307413_10003489 Ga0307413_100034898 157
413 3300031824 Ga0307413_10007812 Ga0307413_100078122 157
414 3300031852 Ga0307410_10001011 Ga0307410_100010117 157
415 3300031852 Ga0307410_10091226 Ga0307410_100912263 157
416 3300031852 Ga0307410_10093383 Ga0307410_100933831 157
417 3300031852 Ga0307410_10150995 Ga0307410_101509952 157
418 3300031852 Ga0307410_10174796 Ga0307410_101747962 157
419 3300031852 Ga0307410_10620926 Ga0307410_106209261 157
420 3300031901 Ga0307406_10098817 Ga0307406_100988173 157
421 3300031901 Ga0307406_10205252 Ga0307406_102052521 157
422 3300031901 Ga0307406_10657665 Ga0307406_106576652 157
423 3300031901 Ga0307406_10742729 Ga0307406_107427291 157
424 3300031903 Ga0307407_10026709 Ga0307407_100267093 157
425 3300031903 Ga0307407_10145405 Ga0307407_101454052 157
426 3300031911 Ga0307412_10027266 Ga0307412_100272662 157
427 3300031911 Ga0307412_10605268 Ga0307412_106052682 157
428 3300031995 Ga0307409_100022308 Ga0307409_1000223084 157
429 3300031995 Ga0307409_100105244 Ga0307409_1001052442 157
430 3300031995 Ga0307409_100349112 Ga0307409_1003491122 157
431 3300031995 Ga0307409_100980770 Ga0307409_1009807702 157
432 3300032002 Ga0307416_100009904 Ga0307416_1000099046 157
433 3300032002 Ga0307416_100135503 Ga0307416_1001355033 157
434 3300032002 Ga0307416_100345203 Ga0307416_1003452032 157
435 3300032002 Ga0307416_100480813 Ga0307416_1004808132 157
436 3300032004 Ga0307414_10027349 Ga0307414_100273492 157
437 3300032004 Ga0307414_10054645 Ga0307414_100546453 157
438 3300032004 Ga0307414_10064693 Ga0307414_100646932 157
439 3300032004 Ga0307414_10073425 Ga0307414_100734253 157
440 3300032004 Ga0307414_10134435 Ga0307414_101344352 157
441 3300032004 Ga0307414_11440922 Ga0307414_114409221 157
442 3300032005 Ga0307411_10060043 Ga0307411_100600432 157
443 3300032005 Ga0307411_10096919 Ga0307411_100969192 157
444 3300032005 Ga0307411_10153806 Ga0307411_101538062 157
445 3300032005 Ga0307411_10186773 Ga0307411_101867732 157
446 3300032126 Ga0307415_100005560 Ga0307415_1000055603 157
447 3300032126 Ga0307415_100431191 Ga0307415_1004311911 157
448 3300032126 Ga0307415_100514489 Ga0307415_1005144892 157
449 3300035084 Ga0373928_0133261 Ga0373928_0133261_16_492 157
450 3300035115 Ga0373941_0045677 Ga0373941_0045677_157_630 157
451 3300035115 Ga0373941_0270645 Ga0373941_0270645_91_564 157
452 3300037312 Ga0395899_0150035 Ga0395899_0150035_521_994 157
453 3300037312 Ga0395899_0193494 Ga0395899_0193494_62_535 157
454 3300037312 Ga0395899_0289336 Ga0395899_0289336_91_564 157
455 3300037418 Ga0395900_0141297 Ga0395900_0141297_1475_1948 157
456 3300037418 Ga0395900_0171575 Ga0395900_0171575_14_487 157
457 3300037418 Ga0395900_0218774 Ga0395900_0218774_686_1159 157
458 3300037418 Ga0395900_0252395 Ga0395900_0252395_10_483 157
459 3300037418 Ga0395900_0432079 Ga0395900_0432079_378_851 157
460 3300037418 Ga0395900_0699822 Ga0395900_0699822_52_525 157
461 3300037418 Ga0395900_1734712 Ga0395900_1734712_37_510 157
462 3300037466 Ga0395898_0188293 Ga0395898_0188293_1047_1520 157
463 3300037466 Ga0395898_0833153 Ga0395898_0833153_266_739 157
464 3300037471 Ga0395905_0002924 Ga0395905_0002924_8966_9439 157
465 3300037471 Ga0395905_0048360 Ga0395905_0048360_1447_1920 157
466 3300037471 Ga0395905_0110907 Ga0395905_0110907_562_1035 157
467 3300037471 Ga0395905_0112853 Ga0395905_0112853_1382_1855 157
468 3300037471 Ga0395905_0132064 Ga0395905_0132064_16_489 157
469 3300037471 Ga0395905_0138687 Ga0395905_0138687_1540_2016 157
470 3300037471 Ga0395905_0544999 Ga0395905_0544999_498_971 157
471 3300037471 Ga0395905_0818883 Ga0395905_0818883_232_705 157
472 3300037471 Ga0395905_1059563 Ga0395905_1059563_130_603 157
473 3300037471 Ga0395905_1438422 Ga0395905_1438422_105_578 157
474 3300037853 Ga0436364_1447256 Ga0436364_1447256_11052_11525 157
475 3300038443 Ga0395901_0276078 Ga0395901_0276078_355_828 157
476 3300038443 Ga0395901_0420955 Ga0395901_0420955_489_962 157
477 3300041404 Ga0439436_0029541 Ga0439436_0029541_774_1247 157
478 3300041999 Ga0439433_0012801 Ga0439433_0012801_1097_1582 157
479 3300042007 Ga0439449_0160448 Ga0439449_0160448_120_593 157
480 3300042014 Ga0439457_168524 Ga0439457_168524_44_517 157
481 3300042015 Ga0439462_0039918 Ga0439462_0039918_97_570 157
482 3300042015 Ga0439462_0082122 Ga0439462_0082122_156_713 157
483 3300042156 Ga0439446_0068062 Ga0439446_0068062_67_552 157
484 3300042439 Ga0439464_0003467 Ga0439464_0003467_558_1031 157
485 3300044693 Ga0466961_0127961 Ga0466961_0127961_362_835 157
486 3300044694 Ga0466963_0098585 Ga0466963_0098585_1224_1697 157
487 3300044694 Ga0466963_0139434 Ga0466963_0139434_440_913 157
488 3300044719 Ga0466971_0195043 Ga0466971_0195043_322_795 157
489 3300044765 Ga0466970_0038874 Ga0466970_0038874_1664_2137 157
490 3300044842 Ga0466957_0108511 Ga0466957_0108511_227_700 157
491 3300044842 Ga0466957_0135248 Ga0466957_0135248_749_1222 157
492 3300044901 Ga0466960_0014000 Ga0466960_0014000_135_608 157
493 3300044901 Ga0466960_0968839 Ga0466960_0968839_27_500 157
494 3300045976 Ga0466967_0064086 Ga0466967_0064086_1134_1607 157
495 3300045976 Ga0466967_0066837 Ga0466967_0066837_2667_3140 157
496 3300045976 Ga0466967_0423788 Ga0466967_0423788_274_747 157
497 3300046528 Ga0495642_0170210 Ga0495642_0170210_314_787 157
498 3300046616 Ga0495668_0004223 Ga0495668_0004223_588_1061 157
499 3300046616 Ga0495668_0222530 Ga0495668_0222530_151_624 157
500 3300046684 Ga0495669_0081947 Ga0495669_0081947_805_1281 157
501 3300046684 Ga0495669_0096691 Ga0495669_0096691_488_961 157
502 3300048903 Ga0496100_0093742 Ga0496100_0093742_1050_1523 157
503 3300048904 Ga0496101_0021277 Ga0496101_0021277_1505_1978 157
504 3300048906 Ga0496103_0347571 Ga0496103_0347571_369_845 157
505 3300048909 Ga0496106_0122019 Ga0496106_0122019_62_535 157
506 3300048909 Ga0496106_0545332 Ga0496106_0545332_168_644 157
507 3300048910 Ga0496107_0050668 Ga0496107_0050668_2278_2751 157
508 3300048910 Ga0496107_0056415 Ga0496107_0056415_1392_1865 157
509 3300048912 Ga0496109_0067684 Ga0496109_0067684_671_1144 157
510 3300048913 Ga0496110_0160557 Ga0496110_0160557_1088_1561 157
511 3300048913 Ga0496110_0919709 Ga0496110_0919709_283_759 157
512 3300048914 Ga0496111_0007174 Ga0496111_0007174_6364_6837 157
513 3300048914 Ga0496111_0494240 Ga0496111_0494240_255_728 157
514 3300048915 Ga0496112_0072247 Ga0496112_0072247_1489_1962 157
515 3300048916 Ga0496113_0075377 Ga0496113_0075377_1567_2040 157
516 3300049590 Ga0501074_0392681 Ga0501074_0392681_38_511 157
517 3300049656 Ga0501209_037464 Ga0501209_037464_717_1190 157
518 3300049661 Ga0501217_205911 Ga0501217_205911_55_528 157
519 3300049741 Ga0501079_0258631 Ga0501079_0258631_729_1202 157
520 3300049742 Ga0501080_0100448 Ga0501080_0100448_1468_1941 157
521 3300049763 Ga0501266_010734 Ga0501266_010734_429_902 157
522 3300049765 Ga0501268_005161 Ga0501268_005161_695_1168 157
523 3300050515 nmdc:mga0a205_3422_c1 nmdc:mga0a205_3422_c1_10245_10721 157
524 3300053134 Ga0500658_0000044 Ga0500658_0000044_12238_12711 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01478

Peptidase_A24

Type IV leader peptidase family

40

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s0x-assembly2.cif.gz_B-2 the crystal structure of gxgd membrane protease flak 0.6654 8 157
3s0x-assembly2.cif.gz_B-2 the crystal structure of gxgd membrane protease flak 0.6372 8 157
7no6-assembly1.cif.gz_B structure of the mature rsv ca lattice: group i, pentamer-hexamer interface, class 1 0.5636 85 150
3s0x-assembly1.cif.gz_A the crystal structure of gxgd membrane protease flak 0.5603 9 157
7no6-assembly1.cif.gz_C structure of the mature rsv ca lattice: group i, pentamer-hexamer interface, class 1 0.5513 85 153
ID Description Score Start End Superfamily
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7951 7 150 1.20.120.1220
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7758 7 150 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7278 1 148 1.20.120.1220
af_Q46836_122_264_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7191 1 148 1.20.120.1220
af_I6Y9M6_1_137_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7096 12 150 1.20.120.1220
ID Description Score Start End GO Terms
AF-A0A6J4SYE4-F1-model_v4 Type IV prepilin peptidase TadV/CpaA 0.9773 2 157 GO:0004190
GO:0016020
AF-A0A838VJT4-F1-model_v4 Prepilin peptidase 0.977 6 152 GO:0004190
GO:0005886
AF-A0A2P7QJ51-F1-model_v4 Peptidase 0.9714 7 157 GO:0004190
GO:0016020
AF-A0A6J4TXI1-F1-model_v4 Type IV prepilin peptidase TadV/CpaA 0.968 2 157 GO:0004190
GO:0005886
GO:0006465
AF-A0A6J4SYE4-F1-model_v4 Type IV prepilin peptidase TadV/CpaA 0.9651 2 157 GO:0004190
GO:0016020

Feature Viewer

pLDDT pTM Quality
91.56 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map