F459167
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 524 | 213 | 524 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300042015|Ga0439462_0082122|Ga0439462_0082122_156_713 |
| Length | 185 |
| Sequence | MGVGHGGQVLYLRAWLRIGKPHRLVVGTMINAGFTELLLGLLAILLLVAAVIDVRTFTISNSLNLSIALLAPLYWLSIALPLWPNAAIQLAVGAGVFTLLAGAFYAGMMGGGDVKLAAALALWFSPASTVKFLVLMSLAGGVLTLVVVALHRARGKAGRPEIPYGVAIAFGGLVILTQRFLNQFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 170 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 171 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 172 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 173 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 174 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 175 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 176 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 177 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 201 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 202 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 203 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 205 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 206 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 207 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 210 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 211 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 212 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.19 |
| Nodule | 0 |
| Rhizoplane | 2.86 |
| Rhizosphere | 96.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1024051 | 3300001915 | Bacteria | 937 |
| 2 | JGI24740J21852_10001677 | 3300001979 | Bacteria | 10166 |
| 3 | JGI24740J21852_10006406 | 3300001979 | Bacteria | 4879 |
| 4 | JGI24739J22299_10010205 | 3300001989 | Bacteria | 3489 |
| 5 | JGI24739J22299_10018551 | 3300001989 | Bacteria | 2499 |
| 6 | JGI24737J22298_10000221 | 3300001990 | Bacteria | 18699 |
| 7 | JGI24737J22298_10034433 | 3300001990 | Bacteria | 1570 |
| 8 | JGI24737J22298_10048327 | 3300001990 | Bacteria | 1295 |
| 9 | JGI24737J22298_10100641 | 3300001990 | Bacteria | 856 |
| 10 | JGI24743J22301_10006580 | 3300001991 | Bacteria | 1987 |
| 11 | JGI24735J21928_10093067 | 3300002067 | Bacteria | 865 |
| 12 | JGI24750J21931_1007719 | 3300002070 | Bacteria | 1357 |
| 13 | JGI24745J21846_1005138 | 3300002073 | Bacteria | 1421 |
| 14 | JGI24738J21930_10008528 | 3300002075 | Bacteria | 2330 |
| 15 | JGI24744J21845_10029985 | 3300002077 | Bacteria | 1044 |
| 16 | JGI24034J26672_10028609 | 3300002239 | Bacteria | 900 |
| 17 | Ga0065715_10009313 | 3300005293 | Bacteria | 2865 |
| 18 | Ga0065715_10036540 | 3300005293 | Bacteria | 1458 |
| 19 | Ga0070658_10077516 | 3300005327 | Bacteria | 2727 |
| 20 | Ga0070658_10187940 | 3300005327 | Bacteria | 1740 |
| 21 | Ga0070658_11414388 | 3300005327 | Bacteria | 603 |
| 22 | Ga0070676_10002314 | 3300005328 | Bacteria | 9742 |
| 23 | Ga0070676_10004745 | 3300005328 | Bacteria | 7190 |
| 24 | Ga0070676_10012510 | 3300005328 | Bacteria | 4636 |
| 25 | Ga0070676_10038089 | 3300005328 | Bacteria | 2776 |
| 26 | Ga0070676_10424335 | 3300005328 | Bacteria | 930 |
| 27 | Ga0070683_100093326 | 3300005329 | Bacteria | 2827 |
| 28 | Ga0070670_100005417 | 3300005331 | Bacteria | 10767 |
| 29 | Ga0070670_100044489 | 3300005331 | Bacteria | 3818 |
| 30 | Ga0070670_100047275 | 3300005331 | Bacteria | 3702 |
| 31 | Ga0070670_100253196 | 3300005331 | Bacteria | 1534 |
| 32 | Ga0070670_101099541 | 3300005331 | Bacteria | 725 |
| 33 | Ga0070670_101204550 | 3300005331 | Unclassified | 692 |
| 34 | Ga0070677_10017076 | 3300005333 | Bacteria | 2592 |
| 35 | Ga0070677_10047171 | 3300005333 | Bacteria | 1726 |
| 36 | Ga0068869_100000662 | 3300005334 | Bacteria | 19510 |
| 37 | Ga0068869_100013127 | 3300005334 | Bacteria | 5500 |
| 38 | Ga0068869_100187507 | 3300005334 | Bacteria | 1625 |
| 39 | Ga0068869_100524880 | 3300005334 | Bacteria | 991 |
| 40 | Ga0070666_10016286 | 3300005335 | Bacteria | 4755 |
| 41 | Ga0070666_10016307 | 3300005335 | Bacteria | 4751 |
| 42 | Ga0070666_10109944 | 3300005335 | Bacteria | 1905 |
| 43 | Ga0070680_100122607 | 3300005336 | Bacteria | 2170 |
| 44 | Ga0070680_100672210 | 3300005336 | Bacteria | 891 |
| 45 | Ga0070682_100229205 | 3300005337 | Bacteria | 1327 |
| 46 | Ga0070682_100665627 | 3300005337 | Bacteria | 831 |
| 47 | Ga0068868_100001411 | 3300005338 | Bacteria | 16565 |
| 48 | Ga0068868_100117591 | 3300005338 | Bacteria | 2166 |
| 49 | Ga0068868_100346260 | 3300005338 | Bacteria | 1272 |
| 50 | Ga0070660_100010601 | 3300005339 | Bacteria | 6515 |
| 51 | Ga0070660_100064014 | 3300005339 | Bacteria | 2860 |
| 52 | Ga0070660_100091564 | 3300005339 | Bacteria | 2399 |
| 53 | Ga0070660_100128812 | 3300005339 | Bacteria | 2024 |
| 54 | Ga0070660_100492905 | 3300005339 | Bacteria | 1019 |
| 55 | Ga0070660_100545835 | 3300005339 | Bacteria | 967 |
| 56 | Ga0070660_100733816 | 3300005339 | Bacteria | 829 |
| 57 | Ga0070660_100953178 | 3300005339 | Bacteria | 724 |
| 58 | Ga0070660_101087949 | 3300005339 | Bacteria | 676 |
| 59 | Ga0070691_10208438 | 3300005341 | Bacteria | 1030 |
| 60 | Ga0070661_100882323 | 3300005344 | Bacteria | 737 |
| 61 | Ga0070668_100007531 | 3300005347 | Bacteria | 8085 |
| 62 | Ga0070668_100040876 | 3300005347 | Bacteria | 3550 |
| 63 | Ga0070668_100098504 | 3300005347 | Bacteria | 2314 |
| 64 | Ga0070669_100000682 | 3300005353 | Bacteria | 24837 |
| 65 | Ga0070669_100025231 | 3300005353 | Bacteria | 4269 |
| 66 | Ga0070669_100114258 | 3300005353 | Bacteria | 2052 |
| 67 | Ga0070675_100003697 | 3300005354 | Bacteria | 11623 |
| 68 | Ga0070675_100042801 | 3300005354 | Bacteria | 3701 |
| 69 | Ga0070675_100133608 | 3300005354 | Bacteria | 2116 |
| 70 | Ga0070675_100266298 | 3300005354 | Bacteria | 1503 |
| 71 | Ga0070671_100007783 | 3300005355 | Bacteria | 8561 |
| 72 | Ga0070671_100043661 | 3300005355 | Bacteria | 3725 |
| 73 | Ga0070671_100058477 | 3300005355 | Bacteria | 3209 |
| 74 | Ga0070674_100052696 | 3300005356 | Bacteria | 2807 |
| 75 | Ga0070673_100000833 | 3300005364 | Bacteria | 17279 |
| 76 | Ga0070673_100009304 | 3300005364 | Bacteria | 6592 |
| 77 | Ga0070673_100033051 | 3300005364 | Bacteria | 3901 |
| 78 | Ga0070673_100066431 | 3300005364 | Bacteria | 2881 |
| 79 | Ga0070659_100000950 | 3300005366 | Bacteria | 21306 |
| 80 | Ga0070659_100001481 | 3300005366 | Bacteria | 16916 |
| 81 | Ga0070659_100039104 | 3300005366 | Bacteria | 3702 |
| 82 | Ga0070659_100334758 | 3300005366 | Bacteria | 1267 |
| 83 | Ga0070659_100438140 | 3300005366 | Bacteria | 1107 |
| 84 | Ga0070667_100000776 | 3300005367 | Bacteria | 30243 |
| 85 | Ga0070667_100006561 | 3300005367 | Bacteria | 9673 |
| 86 | Ga0070667_100013906 | 3300005367 | Bacteria | 6654 |
| 87 | Ga0070667_100058875 | 3300005367 | Bacteria | 3248 |
| 88 | Ga0070667_100252556 | 3300005367 | Bacteria | 1577 |
| 89 | Ga0070667_100455961 | 3300005367 | Bacteria | 1169 |
| 90 | Ga0070667_101047906 | 3300005367 | Bacteria | 762 |
| 91 | Ga0070694_100003228 | 3300005444 | Bacteria | 9732 |
| 92 | Ga0070663_100005818 | 3300005455 | Bacteria | 7365 |
| 93 | Ga0070663_100022238 | 3300005455 | Bacteria | 4236 |
| 94 | Ga0070663_100521755 | 3300005455 | Bacteria | 989 |
| 95 | Ga0070663_101906632 | 3300005455 | Bacteria | 534 |
| 96 | Ga0070662_100006881 | 3300005457 | Bacteria | 7357 |
| 97 | Ga0070662_100022242 | 3300005457 | Bacteria | 4337 |
| 98 | Ga0070662_100034774 | 3300005457 | Bacteria | 3555 |
| 99 | Ga0070662_100049099 | 3300005457 | Bacteria | 3042 |
| 100 | Ga0070662_100141249 | 3300005457 | Bacteria | 1866 |
| 101 | Ga0070681_10090766 | 3300005458 | Bacteria | 3005 |
| 102 | Ga0070681_10163066 | 3300005458 | Bacteria | 2153 |
| 103 | Ga0070681_10378623 | 3300005458 | Bacteria | 1326 |
| 104 | Ga0068867_100033101 | 3300005459 | Bacteria | 3741 |
| 105 | Ga0068867_100035018 | 3300005459 | Bacteria | 3640 |
| 106 | Ga0068867_101687128 | 3300005459 | Bacteria | 594 |
| 107 | Ga0070679_100033899 | 3300005530 | Bacteria | 5057 |
| 108 | Ga0070679_100753421 | 3300005530 | Bacteria | 917 |
| 109 | Ga0070679_100808397 | 3300005530 | Bacteria | 881 |
| 110 | Ga0070684_100218702 | 3300005535 | Bacteria | 1738 |
| 111 | Ga0068853_100001659 | 3300005539 | Bacteria | 16300 |
| 112 | Ga0068853_100139035 | 3300005539 | Bacteria | 2179 |
| 113 | Ga0068853_100233159 | 3300005539 | Bacteria | 1684 |
| 114 | Ga0068853_100835526 | 3300005539 | Bacteria | 883 |
| 115 | Ga0070672_100000589 | 3300005543 | Bacteria | 21279 |
| 116 | Ga0070672_100097092 | 3300005543 | Bacteria | 2385 |
| 117 | Ga0070672_100307710 | 3300005543 | Bacteria | 1344 |
| 118 | Ga0070672_101346839 | 3300005543 | Bacteria | 638 |
| 119 | Ga0070695_100134661 | 3300005545 | Bacteria | 1706 |
| 120 | Ga0070695_101690110 | 3300005545 | Bacteria | 530 |
| 121 | Ga0070696_100019918 | 3300005546 | Bacteria | 4547 |
| 122 | Ga0070693_100009371 | 3300005547 | Bacteria | 4864 |
| 123 | Ga0070693_100172114 | 3300005547 | Bacteria | 1388 |
| 124 | Ga0070665_100071855 | 3300005548 | Bacteria | 3467 |
| 125 | Ga0070665_100533889 | 3300005548 | Bacteria | 1185 |
| 126 | Ga0070704_100180504 | 3300005549 | Bacteria | 1688 |
| 127 | Ga0068855_100008531 | 3300005563 | Bacteria | 12386 |
| 128 | Ga0068855_100889489 | 3300005563 | Bacteria | 941 |
| 129 | Ga0070664_100008433 | 3300005564 | Bacteria | 8333 |
| 130 | Ga0070664_100009351 | 3300005564 | Bacteria | 7946 |
| 131 | Ga0070664_100095934 | 3300005564 | Bacteria | 2573 |
| 132 | Ga0070664_100320269 | 3300005564 | Bacteria | 1405 |
| 133 | Ga0070664_100939337 | 3300005564 | Bacteria | 812 |
| 134 | Ga0070664_102022803 | 3300005564 | Bacteria | 547 |
| 135 | Ga0068857_100000692 | 3300005577 | Bacteria | 25055 |
| 136 | Ga0068857_100128610 | 3300005577 | Bacteria | 2283 |
| 137 | Ga0068854_100001058 | 3300005578 | Bacteria | 16545 |
| 138 | Ga0068854_100003715 | 3300005578 | Bacteria | 9548 |
| 139 | Ga0068854_100014106 | 3300005578 | Bacteria | 5260 |
| 140 | Ga0068852_100024796 | 3300005616 | Bacteria | 4851 |
| 141 | Ga0068852_100181698 | 3300005616 | Bacteria | 1978 |
| 142 | Ga0068859_100002632 | 3300005617 | Bacteria | 18266 |
| 143 | Ga0068859_100007420 | 3300005617 | Bacteria | 11132 |
| 144 | Ga0068859_100016870 | 3300005617 | Bacteria | 7330 |
| 145 | Ga0068859_100032223 | 3300005617 | Bacteria | 5265 |
| 146 | Ga0068859_100034904 | 3300005617 | Bacteria | 5046 |
| 147 | Ga0068864_100000287 | 3300005618 | Bacteria | 44806 |
| 148 | Ga0068864_100000748 | 3300005618 | Bacteria | 27277 |
| 149 | Ga0068864_100000894 | 3300005618 | Bacteria | 25097 |
| 150 | Ga0068864_100013544 | 3300005618 | Bacteria | 6761 |
| 151 | Ga0068864_101089932 | 3300005618 | Bacteria | 794 |
| 152 | Ga0068866_10770154 | 3300005718 | Bacteria | 666 |
| 153 | Ga0068861_100024292 | 3300005719 | Bacteria | 4382 |
| 154 | Ga0068861_100946812 | 3300005719 | Bacteria | 819 |
| 155 | Ga0068851_10559861 | 3300005834 | Bacteria | 692 |
| 156 | Ga0068870_10247865 | 3300005840 | Bacteria | 1103 |
| 157 | Ga0068863_100002077 | 3300005841 | Bacteria | 19858 |
| 158 | Ga0068863_100050840 | 3300005841 | Bacteria | 3928 |
| 159 | Ga0068863_100062372 | 3300005841 | Bacteria | 3525 |
| 160 | Ga0068863_100120017 | 3300005841 | Bacteria | 2506 |
| 161 | Ga0068863_100585507 | 3300005841 | Bacteria | 1103 |
| 162 | Ga0068858_100000579 | 3300005842 | Bacteria | 38345 |
| 163 | Ga0068858_100012043 | 3300005842 | Bacteria | 8153 |
| 164 | Ga0068858_100032449 | 3300005842 | Bacteria | 4849 |
| 165 | Ga0068858_100033541 | 3300005842 | Bacteria | 4762 |
| 166 | Ga0068858_100459945 | 3300005842 | Bacteria | 1227 |
| 167 | Ga0068860_100004159 | 3300005843 | Bacteria | 14831 |
| 168 | Ga0068860_100006012 | 3300005843 | Bacteria | 12215 |
| 169 | Ga0068860_100019373 | 3300005843 | Bacteria | 6599 |
| 170 | Ga0068860_100025537 | 3300005843 | Bacteria | 5700 |
| 171 | Ga0068862_100018299 | 3300005844 | Bacteria | 5835 |
| 172 | Ga0068862_100096710 | 3300005844 | Bacteria | 2578 |
| 173 | Ga0068862_100941099 | 3300005844 | Bacteria | 851 |
| 174 | Ga0081539_10017580 | 3300005985 | Bacteria | 5011 |
| 175 | Ga0070712_100118137 | 3300006175 | Bacteria | 1991 |
| 176 | Ga0097621_100470385 | 3300006237 | Bacteria | 1135 |
| 177 | Ga0075433_10203594 | 3300006852 | Bacteria | 1759 |
| 178 | Ga0075434_100119783 | 3300006871 | Bacteria | 2646 |
| 179 | Ga0068865_100077559 | 3300006881 | Bacteria | 2375 |
| 180 | Ga0097620_100002632 | 3300006931 | Bacteria | 18266 |
| 181 | Ga0097620_100007420 | 3300006931 | Bacteria | 11132 |
| 182 | Ga0097620_100016869 | 3300006931 | Bacteria | 7330 |
| 183 | Ga0097620_100032223 | 3300006931 | Bacteria | 5265 |
| 184 | Ga0097620_100034904 | 3300006931 | Bacteria | 5046 |
| 185 | Ga0075435_100190747 | 3300007076 | Bacteria | 1735 |
| 186 | Ga0105251_10085545 | 3300009011 | Bacteria | 1453 |
| 187 | Ga0105250_10005450 | 3300009092 | Bacteria | 5703 |
| 188 | Ga0105240_10104592 | 3300009093 | Bacteria | 3438 |
| 189 | Ga0105240_10172394 | 3300009093 | Bacteria | 2561 |
| 190 | Ga0105245_10005839 | 3300009098 | Bacteria | 10806 |
| 191 | Ga0105245_10030174 | 3300009098 | Bacteria | 4793 |
| 192 | Ga0105247_10148459 | 3300009101 | Bacteria | 1543 |
| 193 | Ga0105247_10179959 | 3300009101 | Bacteria | 1411 |
| 194 | Ga0105243_10023746 | 3300009148 | Bacteria | 4673 |
| 195 | Ga0105241_10098336 | 3300009174 | Bacteria | 2321 |
| 196 | Ga0105242_10048328 | 3300009176 | Bacteria | 3458 |
| 197 | Ga0105248_10000552 | 3300009177 | Bacteria | 42448 |
| 198 | Ga0105248_10006033 | 3300009177 | Bacteria | 13304 |
| 199 | Ga0105248_10010327 | 3300009177 | Bacteria | 10277 |
| 200 | Ga0105248_10082850 | 3300009177 | Bacteria | 3608 |
| 201 | Ga0105248_10260014 | 3300009177 | Bacteria | 1954 |
| 202 | Ga0105238_10064099 | 3300009551 | Bacteria | 3675 |
| 203 | Ga0105249_10020672 | 3300009553 | Bacteria | 5886 |
| 204 | Ga0105249_10047596 | 3300009553 | Bacteria | 3908 |
| 205 | Ga0105249_10329902 | 3300009553 | Bacteria | 1539 |
| 206 | Ga0105239_10145487 | 3300010375 | Bacteria | 2643 |
| 207 | Ga0105239_10284780 | 3300010375 | Bacteria | 1861 |
| 208 | Ga0105246_10202665 | 3300011119 | Bacteria | 1543 |
| 209 | Ga0157373_10005180 | 3300013100 | Bacteria | 9797 |
| 210 | Ga0157373_10030128 | 3300013100 | Bacteria | 3905 |
| 211 | Ga0157373_10126438 | 3300013100 | Bacteria | 1798 |
| 212 | Ga0157373_10209815 | 3300013100 | Bacteria | 1373 |
| 213 | Ga0157373_11055251 | 3300013100 | Bacteria | 608 |
| 214 | Ga0157371_10004027 | 3300013102 | Bacteria | 13004 |
| 215 | Ga0157371_10044632 | 3300013102 | Bacteria | 3155 |
| 216 | Ga0157371_10048674 | 3300013102 | Bacteria | 3013 |
| 217 | Ga0157371_10068264 | 3300013102 | Bacteria | 2516 |
| 218 | Ga0157371_11283196 | 3300013102 | Bacteria | 566 |
| 219 | Ga0157378_10011763 | 3300013297 | Bacteria | 7660 |
| 220 | Ga0157378_11034548 | 3300013297 | Bacteria | 856 |
| 221 | Ga0163162_10050160 | 3300013306 | Bacteria | 4185 |
| 222 | Ga0163162_10052041 | 3300013306 | Bacteria | 4111 |
| 223 | Ga0163162_10328724 | 3300013306 | Bacteria | 1661 |
| 224 | Ga0163162_10429662 | 3300013306 | Bacteria | 1453 |
| 225 | Ga0157372_10053038 | 3300013307 | Bacteria | 4518 |
| 226 | Ga0157375_10409993 | 3300013308 | Bacteria | 1521 |
| 227 | Ga0157375_11031427 | 3300013308 | Bacteria | 961 |
| 228 | Ga0163163_10000390 | 3300014325 | Bacteria | 41759 |
| 229 | Ga0163163_11929995 | 3300014325 | Bacteria | 650 |
| 230 | Ga0157380_10004000 | 3300014326 | Bacteria | 10176 |
| 231 | Ga0157380_10026397 | 3300014326 | Bacteria | 4410 |
| 232 | Ga0157380_10026652 | 3300014326 | Bacteria | 4390 |
| 233 | Ga0157377_10025447 | 3300014745 | Bacteria | 3156 |
| 234 | Ga0157377_10381605 | 3300014745 | Bacteria | 954 |
| 235 | Ga0157379_10180699 | 3300014968 | Bacteria | 1906 |
| 236 | Ga0157379_10465856 | 3300014968 | Bacteria | 1168 |
| 237 | Ga0157379_10848286 | 3300014968 | Bacteria | 864 |
| 238 | Ga0157379_10919406 | 3300014968 | Bacteria | 831 |
| 239 | Ga0213875_10002975 | 3300021388 | Bacteria | 9873 |
| 240 | Ga0207673_1000994 | 3300025290 | Bacteria | 3046 |
| 241 | Ga0207697_10000253 | 3300025315 | Bacteria | 29506 |
| 242 | Ga0207656_10500629 | 3300025321 | Bacteria | 617 |
| 243 | Ga0207696_1004959 | 3300025711 | Bacteria | 5615 |
| 244 | Ga0207682_10001459 | 3300025893 | Bacteria | 10925 |
| 245 | Ga0207682_10037597 | 3300025893 | Bacteria | 1961 |
| 246 | Ga0207682_10185145 | 3300025893 | Bacteria | 952 |
| 247 | Ga0207642_10017810 | 3300025899 | Bacteria | 2711 |
| 248 | Ga0207710_10278561 | 3300025900 | Bacteria | 841 |
| 249 | Ga0207688_10000652 | 3300025901 | Bacteria | 17096 |
| 250 | Ga0207688_10607426 | 3300025901 | Bacteria | 689 |
| 251 | Ga0207647_10000327 | 3300025904 | Bacteria | 38973 |
| 252 | Ga0207647_10000760 | 3300025904 | Bacteria | 25232 |
| 253 | Ga0207645_10007069 | 3300025907 | Bacteria | 7983 |
| 254 | Ga0207645_10017352 | 3300025907 | Bacteria | 4752 |
| 255 | Ga0207645_10061798 | 3300025907 | Bacteria | 2393 |
| 256 | Ga0207643_10180326 | 3300025908 | Bacteria | 1278 |
| 257 | Ga0207705_10408753 | 3300025909 | Bacteria | 1050 |
| 258 | Ga0207707_10155977 | 3300025912 | Bacteria | 1997 |
| 259 | Ga0207707_10282084 | 3300025912 | Bacteria | 1439 |
| 260 | Ga0207707_10608263 | 3300025912 | Bacteria | 925 |
| 261 | Ga0207695_10137659 | 3300025913 | Bacteria | 2393 |
| 262 | Ga0207693_10040495 | 3300025915 | Bacteria | 3670 |
| 263 | Ga0207660_10079087 | 3300025917 | Bacteria | 2411 |
| 264 | Ga0207660_10254269 | 3300025917 | Bacteria | 1387 |
| 265 | Ga0207657_10003476 | 3300025919 | Bacteria | 16805 |
| 266 | Ga0207657_10009310 | 3300025919 | Bacteria | 9892 |
| 267 | Ga0207657_10025878 | 3300025919 | Bacteria | 5404 |
| 268 | Ga0207657_10062356 | 3300025919 | Bacteria | 3193 |
| 269 | Ga0207657_10378404 | 3300025919 | Bacteria | 1115 |
| 270 | Ga0207657_10519777 | 3300025919 | Bacteria | 932 |
| 271 | Ga0207657_10633242 | 3300025919 | Bacteria | 833 |
| 272 | Ga0207657_10853312 | 3300025919 | Bacteria | 703 |
| 273 | Ga0207649_10104439 | 3300025920 | Bacteria | 1881 |
| 274 | Ga0207649_10415378 | 3300025920 | Bacteria | 1009 |
| 275 | Ga0207652_11599847 | 3300025921 | Bacteria | 556 |
| 276 | Ga0207681_10018564 | 3300025923 | Bacteria | 4382 |
| 277 | Ga0207681_10025163 | 3300025923 | Bacteria | 3826 |
| 278 | Ga0207681_10060721 | 3300025923 | Bacteria | 2596 |
| 279 | Ga0207681_10088083 | 3300025923 | Bacteria | 2210 |
| 280 | Ga0207681_10126585 | 3300025923 | Bacteria | 1882 |
| 281 | Ga0207650_10063190 | 3300025925 | Bacteria | 2767 |
| 282 | Ga0207650_10068150 | 3300025925 | Bacteria | 2672 |
| 283 | Ga0207650_10147802 | 3300025925 | Bacteria | 1852 |
| 284 | Ga0207650_11353542 | 3300025925 | Bacteria | 606 |
| 285 | Ga0207659_10004610 | 3300025926 | Bacteria | 8342 |
| 286 | Ga0207659_10012653 | 3300025926 | Bacteria | 5380 |
| 287 | Ga0207659_10117106 | 3300025926 | Bacteria | 2035 |
| 288 | Ga0207659_10142012 | 3300025926 | Bacteria | 1865 |
| 289 | Ga0207687_10003036 | 3300025927 | Bacteria | 11376 |
| 290 | Ga0207687_10141139 | 3300025927 | Bacteria | 1828 |
| 291 | Ga0207664_11310686 | 3300025929 | Bacteria | 644 |
| 292 | Ga0207644_10021887 | 3300025931 | Bacteria | 4360 |
| 293 | Ga0207644_10044552 | 3300025931 | Bacteria | 3152 |
| 294 | Ga0207644_10102178 | 3300025931 | Bacteria | 2155 |
| 295 | Ga0207644_10512081 | 3300025931 | Bacteria | 991 |
| 296 | Ga0207690_10001585 | 3300025932 | Bacteria | 14215 |
| 297 | Ga0207690_10002341 | 3300025932 | Bacteria | 11505 |
| 298 | Ga0207690_10023323 | 3300025932 | Bacteria | 3861 |
| 299 | Ga0207690_10185459 | 3300025932 | Bacteria | 1569 |
| 300 | Ga0207706_10000143 | 3300025933 | Bacteria | 77680 |
| 301 | Ga0207706_10000904 | 3300025933 | Bacteria | 30508 |
| 302 | Ga0207706_10003074 | 3300025933 | Bacteria | 16047 |
| 303 | Ga0207706_10004098 | 3300025933 | Bacteria | 13773 |
| 304 | Ga0207706_10013609 | 3300025933 | Bacteria | 7389 |
| 305 | Ga0207706_10215155 | 3300025933 | Bacteria | 1683 |
| 306 | Ga0207669_10014002 | 3300025937 | Bacteria | 4007 |
| 307 | Ga0207704_10047537 | 3300025938 | Bacteria | 2565 |
| 308 | Ga0207704_10056039 | 3300025938 | Bacteria | 2412 |
| 309 | Ga0207691_10000743 | 3300025940 | Bacteria | 32192 |
| 310 | Ga0207691_10066655 | 3300025940 | Bacteria | 3257 |
| 311 | Ga0207691_10146453 | 3300025940 | Bacteria | 2079 |
| 312 | Ga0207691_10329549 | 3300025940 | Bacteria | 1308 |
| 313 | Ga0207691_10847910 | 3300025940 | Bacteria | 766 |
| 314 | Ga0207711_10000046 | 3300025941 | Bacteria | 153238 |
| 315 | Ga0207711_10006545 | 3300025941 | Bacteria | 9811 |
| 316 | Ga0207711_10059860 | 3300025941 | Bacteria | 3280 |
| 317 | Ga0207711_10293281 | 3300025941 | Bacteria | 1499 |
| 318 | Ga0207689_10000372 | 3300025942 | Bacteria | 42301 |
| 319 | Ga0207689_10003887 | 3300025942 | Bacteria | 13614 |
| 320 | Ga0207689_10012702 | 3300025942 | Bacteria | 7193 |
| 321 | Ga0207661_10095396 | 3300025944 | Bacteria | 2487 |
| 322 | Ga0207661_11149047 | 3300025944 | Bacteria | 715 |
| 323 | Ga0207679_10039220 | 3300025945 | Bacteria | 3380 |
| 324 | Ga0207679_10040787 | 3300025945 | Bacteria | 3326 |
| 325 | Ga0207679_10189033 | 3300025945 | Bacteria | 1710 |
| 326 | Ga0207679_10544793 | 3300025945 | Bacteria | 1040 |
| 327 | Ga0207667_10069720 | 3300025949 | Bacteria | 3659 |
| 328 | Ga0207667_10130037 | 3300025949 | Bacteria | 2593 |
| 329 | Ga0207651_10000440 | 3300025960 | Bacteria | 17582 |
| 330 | Ga0207651_10001136 | 3300025960 | Bacteria | 11874 |
| 331 | Ga0207651_10199460 | 3300025960 | Bacteria | 1602 |
| 332 | Ga0207651_10544690 | 3300025960 | Bacteria | 1008 |
| 333 | Ga0207712_10000491 | 3300025961 | Bacteria | 32766 |
| 334 | Ga0207712_10288626 | 3300025961 | Bacteria | 1342 |
| 335 | Ga0207668_10050499 | 3300025972 | Bacteria | 2867 |
| 336 | Ga0207668_10094425 | 3300025972 | Bacteria | 2205 |
| 337 | Ga0207668_10098447 | 3300025972 | Bacteria | 2167 |
| 338 | Ga0207668_10132596 | 3300025972 | Bacteria | 1904 |
| 339 | Ga0207640_10009513 | 3300025981 | Bacteria | 5444 |
| 340 | Ga0207640_10021292 | 3300025981 | Bacteria | 3863 |
| 341 | Ga0207640_10106567 | 3300025981 | Bacteria | 1977 |
| 342 | Ga0207658_10007445 | 3300025986 | Bacteria | 7463 |
| 343 | Ga0207658_10017187 | 3300025986 | Bacteria | 4984 |
| 344 | Ga0207658_10018485 | 3300025986 | Bacteria | 4813 |
| 345 | Ga0207658_10066051 | 3300025986 | Bacteria | 2719 |
| 346 | Ga0207658_10373405 | 3300025986 | Bacteria | 1247 |
| 347 | Ga0207677_10023455 | 3300026023 | Bacteria | 3813 |
| 348 | Ga0207677_10061824 | 3300026023 | Bacteria | 2595 |
| 349 | Ga0207677_10113574 | 3300026023 | Bacteria | 2022 |
| 350 | Ga0207677_10391352 | 3300026023 | Bacteria | 1176 |
| 351 | Ga0207703_10002126 | 3300026035 | Bacteria | 17427 |
| 352 | Ga0207703_10002982 | 3300026035 | Bacteria | 14350 |
| 353 | Ga0207703_10003193 | 3300026035 | Bacteria | 13798 |
| 354 | Ga0207703_10132812 | 3300026035 | Bacteria | 2152 |
| 355 | Ga0207703_10642265 | 3300026035 | Bacteria | 1006 |
| 356 | Ga0207639_10005382 | 3300026041 | Bacteria | 8654 |
| 357 | Ga0207639_10037273 | 3300026041 | Bacteria | 3610 |
| 358 | Ga0207639_10640146 | 3300026041 | Bacteria | 983 |
| 359 | Ga0207678_10000308 | 3300026067 | Bacteria | 43995 |
| 360 | Ga0207678_10008496 | 3300026067 | Bacteria | 9051 |
| 361 | Ga0207678_10043334 | 3300026067 | Bacteria | 3894 |
| 362 | Ga0207678_10251570 | 3300026067 | Bacteria | 1513 |
| 363 | Ga0207678_10283700 | 3300026067 | Bacteria | 1422 |
| 364 | Ga0207641_10001374 | 3300026088 | Bacteria | 24044 |
| 365 | Ga0207641_10010491 | 3300026088 | Bacteria | 7604 |
| 366 | Ga0207641_10016527 | 3300026088 | Bacteria | 6043 |
| 367 | Ga0207641_10098576 | 3300026088 | Bacteria | 2570 |
| 368 | Ga0207641_10120193 | 3300026088 | Bacteria | 2343 |
| 369 | Ga0207648_10031677 | 3300026089 | Bacteria | 4674 |
| 370 | Ga0207648_10169583 | 3300026089 | Bacteria | 1929 |
| 371 | Ga0207676_10000345 | 3300026095 | Bacteria | 39937 |
| 372 | Ga0207676_10003004 | 3300026095 | Bacteria | 12027 |
| 373 | Ga0207676_10003557 | 3300026095 | Bacteria | 11013 |
| 374 | Ga0207676_10210521 | 3300026095 | Bacteria | 1724 |
| 375 | Ga0207674_10000345 | 3300026116 | Bacteria | 59803 |
| 376 | Ga0207674_10009232 | 3300026116 | Bacteria | 11304 |
| 377 | Ga0207674_10017364 | 3300026116 | Bacteria | 7852 |
| 378 | Ga0207674_10119519 | 3300026116 | Bacteria | 2604 |
| 379 | Ga0207674_10477782 | 3300026116 | Bacteria | 1205 |
| 380 | Ga0207675_100008821 | 3300026118 | Bacteria | 9463 |
| 381 | Ga0207675_100139258 | 3300026118 | Bacteria | 2304 |
| 382 | Ga0207675_100214827 | 3300026118 | Bacteria | 1851 |
| 383 | Ga0207683_11350793 | 3300026121 | Bacteria | 659 |
| 384 | Ga0207698_10006585 | 3300026142 | Bacteria | 7262 |
| 385 | Ga0207698_10326102 | 3300026142 | Bacteria | 1440 |
| 386 | Ga0268266_10002013 | 3300028379 | Bacteria | 22668 |
| 387 | Ga0268266_10316007 | 3300028379 | Bacteria | 1460 |
| 388 | Ga0268266_10783773 | 3300028379 | Bacteria | 920 |
| 389 | Ga0268266_10915950 | 3300028379 | Bacteria | 848 |
| 390 | Ga0268265_10013286 | 3300028380 | Bacteria | 5595 |
| 391 | Ga0268265_10028689 | 3300028380 | Bacteria | 3988 |
| 392 | Ga0268265_10277797 | 3300028380 | Bacteria | 1497 |
| 393 | Ga0268265_10503658 | 3300028380 | Bacteria | 1141 |
| 394 | Ga0268264_10001319 | 3300028381 | Bacteria | 23348 |
| 395 | Ga0268264_10002725 | 3300028381 | Bacteria | 15417 |
| 396 | Ga0268264_10008787 | 3300028381 | Bacteria | 8382 |
| 397 | Ga0268264_10112053 | 3300028381 | Bacteria | 2391 |
| 398 | Ga0316182_1441053 | 3300030745 | Bacteria | 2578 |
| 399 | Ga0307513_10133096 | 3300031456 | Bacteria | 2428 |
| 400 | Ga0307413_10003489 | 3300031824 | Bacteria | 6626 |
| 401 | Ga0307413_10007812 | 3300031824 | Bacteria | 4999 |
| 402 | Ga0307410_10001011 | 3300031852 | Bacteria | 12185 |
| 403 | Ga0307410_10091226 | 3300031852 | Bacteria | 2163 |
| 404 | Ga0307410_10093383 | 3300031852 | Bacteria | 2141 |
| 405 | Ga0307410_10150995 | 3300031852 | Bacteria | 1730 |
| 406 | Ga0307410_10174796 | 3300031852 | Bacteria | 1621 |
| 407 | Ga0307410_10620926 | 3300031852 | Bacteria | 903 |
| 408 | Ga0307406_10098817 | 3300031901 | Bacteria | 1983 |
| 409 | Ga0307406_10205252 | 3300031901 | Bacteria | 1454 |
| 410 | Ga0307406_10657665 | 3300031901 | Bacteria | 870 |
| 411 | Ga0307406_10742729 | 3300031901 | Bacteria | 823 |
| 412 | Ga0307407_10026709 | 3300031903 | Bacteria | 3061 |
| 413 | Ga0307407_10145405 | 3300031903 | Bacteria | 1534 |
| 414 | Ga0307412_10027266 | 3300031911 | Bacteria | 3559 |
| 415 | Ga0307412_10183549 | 3300031911 | Bacteria | 1576 |
| 416 | Ga0307412_10605268 | 3300031911 | Bacteria | 929 |
| 417 | Ga0307409_100022308 | 3300031995 | Bacteria | 4362 |
| 418 | Ga0307409_100105244 | 3300031995 | Bacteria | 2352 |
| 419 | Ga0307409_100349112 | 3300031995 | Bacteria | 1395 |
| 420 | Ga0307409_100980770 | 3300031995 | Bacteria | 862 |
| 421 | Ga0307416_100009904 | 3300032002 | Bacteria | 6269 |
| 422 | Ga0307416_100135503 | 3300032002 | Bacteria | 2226 |
| 423 | Ga0307416_100345203 | 3300032002 | Bacteria | 1504 |
| 424 | Ga0307416_100480813 | 3300032002 | Bacteria | 1302 |
| 425 | Ga0307414_10027349 | 3300032004 | Bacteria | 3684 |
| 426 | Ga0307414_10054645 | 3300032004 | Bacteria | 2792 |
| 427 | Ga0307414_10064693 | 3300032004 | Bacteria | 2605 |
| 428 | Ga0307414_10073425 | 3300032004 | Bacteria | 2475 |
| 429 | Ga0307414_10134435 | 3300032004 | Bacteria | 1925 |
| 430 | Ga0307414_11440922 | 3300032004 | Bacteria | 640 |
| 431 | Ga0307411_10060043 | 3300032005 | Bacteria | 2523 |
| 432 | Ga0307411_10096919 | 3300032005 | Bacteria | 2074 |
| 433 | Ga0307411_10153806 | 3300032005 | Bacteria | 1713 |
| 434 | Ga0307411_10186773 | 3300032005 | Bacteria | 1578 |
| 435 | Ga0307415_100005560 | 3300032126 | Bacteria | 6706 |
| 436 | Ga0307415_100431191 | 3300032126 | Bacteria | 1134 |
| 437 | Ga0307415_100514489 | 3300032126 | Bacteria | 1049 |
| 438 | Ga0307415_100844273 | 3300032126 | Bacteria | 840 |
| 439 | Ga0373928_0133261 | 3300035084 | Bacteria | 675 |
| 440 | Ga0373941_0045677 | 3300035115 | Bacteria | 1372 |
| 441 | Ga0373941_0270645 | 3300035115 | Bacteria | 669 |
| 442 | Ga0395899_0150035 | 3300037312 | Bacteria | 1653 |
| 443 | Ga0395899_0193494 | 3300037312 | Bacteria | 1422 |
| 444 | Ga0395899_0289336 | 3300037312 | Bacteria | 1112 |
| 445 | Ga0395900_0141297 | 3300037418 | Bacteria | 2465 |
| 446 | Ga0395900_0171575 | 3300037418 | Bacteria | 2208 |
| 447 | Ga0395900_0218774 | 3300037418 | Bacteria | 1921 |
| 448 | Ga0395900_0252395 | 3300037418 | Bacteria | 1765 |
| 449 | Ga0395900_0432079 | 3300037418 | Bacteria | 1276 |
| 450 | Ga0395900_0699822 | 3300037418 | Bacteria | 947 |
| 451 | Ga0395900_1734712 | 3300037418 | Bacteria | 535 |
| 452 | Ga0395898_0188293 | 3300037466 | Bacteria | 1972 |
| 453 | Ga0395898_0833153 | 3300037466 | Bacteria | 862 |
| 454 | Ga0395905_0002924 | 3300037471 | Bacteria | 18610 |
| 455 | Ga0395905_0048360 | 3300037471 | Bacteria | 3986 |
| 456 | Ga0395905_0110907 | 3300037471 | Bacteria | 2576 |
| 457 | Ga0395905_0112853 | 3300037471 | Bacteria | 2553 |
| 458 | Ga0395905_0132064 | 3300037471 | Bacteria | 2348 |
| 459 | Ga0395905_0138687 | 3300037471 | Bacteria | 2288 |
| 460 | Ga0395905_0544999 | 3300037471 | Bacteria | 1061 |
| 461 | Ga0395905_0767373 | 3300037471 | Bacteria | 867 |
| 462 | Ga0395905_0818883 | 3300037471 | Bacteria | 834 |
| 463 | Ga0395905_1059563 | 3300037471 | Bacteria | 714 |
| 464 | Ga0395905_1438422 | 3300037471 | Bacteria | 593 |
| 465 | Ga0436364_1447256 | 3300037853 | Bacteria | 12455 |
| 466 | Ga0395901_0276078 | 3300038443 | Bacteria | 1747 |
| 467 | Ga0395901_0420955 | 3300038443 | Bacteria | 1370 |
| 468 | Ga0439436_0029541 | 3300041404 | Bacteria | 1597 |
| 469 | Ga0439433_0012801 | 3300041999 | Bacteria | 1841 |
| 470 | Ga0439449_0160448 | 3300042007 | Bacteria | 839 |
| 471 | Ga0439457_168524 | 3300042014 | Bacteria | 532 |
| 472 | Ga0439462_0039918 | 3300042015 | Bacteria | 1252 |
| 473 | Ga0439462_0082122 | 3300042015 | Bacteria | 881 |
| 474 | Ga0450898_049950 | 3300042134 | Bacteria | 807 |
| 475 | Ga0439446_0068062 | 3300042156 | Bacteria | 1086 |
| 476 | Ga0439464_0003467 | 3300042439 | Bacteria | 3980 |
| 477 | Ga0450916_041660 | 3300042530 | Unclassified | 700 |
| 478 | Ga0466961_0127961 | 3300044693 | Bacteria | 1593 |
| 479 | Ga0466963_0098585 | 3300044694 | Bacteria | 1998 |
| 480 | Ga0466963_0139434 | 3300044694 | Bacteria | 1679 |
| 481 | Ga0466971_0195043 | 3300044719 | Bacteria | 955 |
| 482 | Ga0466970_0038874 | 3300044765 | Bacteria | 2525 |
| 483 | Ga0466957_0108511 | 3300044842 | Bacteria | 1758 |
| 484 | Ga0466957_0135248 | 3300044842 | Bacteria | 1583 |
| 485 | Ga0466960_0014000 | 3300044901 | Bacteria | 3420 |
| 486 | Ga0466960_0968839 | 3300044901 | Bacteria | 521 |
| 487 | Ga0466967_0064086 | 3300045976 | Bacteria | 3267 |
| 488 | Ga0466967_0066837 | 3300045976 | Bacteria | 3204 |
| 489 | Ga0466967_0423788 | 3300045976 | Bacteria | 1297 |
| 490 | Ga0495642_0170210 | 3300046528 | Bacteria | 946 |
| 491 | Ga0495668_0004223 | 3300046616 | Bacteria | 10344 |
| 492 | Ga0495668_0222530 | 3300046616 | Bacteria | 1033 |
| 493 | Ga0495669_0081947 | 3300046684 | Bacteria | 1482 |
| 494 | Ga0495669_0096691 | 3300046684 | Bacteria | 1368 |
| 495 | Ga0496100_0093742 | 3300048903 | Bacteria | 2055 |
| 496 | Ga0496101_0021277 | 3300048904 | Bacteria | 4456 |
| 497 | Ga0496102_1361926 | 3300048905 | Bacteria | 629 |
| 498 | Ga0496103_0347571 | 3300048906 | Bacteria | 954 |
| 499 | Ga0496106_0122019 | 3300048909 | Bacteria | 2037 |
| 500 | Ga0496106_0545332 | 3300048909 | Bacteria | 931 |
| 501 | Ga0496107_0050668 | 3300048910 | Bacteria | 2993 |
| 502 | Ga0496107_0056415 | 3300048910 | Bacteria | 2838 |
| 503 | Ga0496109_0067684 | 3300048912 | Bacteria | 3272 |
| 504 | Ga0496110_0160557 | 3300048913 | Bacteria | 2037 |
| 505 | Ga0496110_0919709 | 3300048913 | Bacteria | 781 |
| 506 | Ga0496111_0007174 | 3300048914 | Bacteria | 7284 |
| 507 | Ga0496111_0494240 | 3300048914 | Bacteria | 901 |
| 508 | Ga0496112_0072247 | 3300048915 | Bacteria | 3410 |
| 509 | Ga0496113_0075377 | 3300048916 | Bacteria | 2575 |
| 510 | Ga0501074_0392681 | 3300049590 | Bacteria | 984 |
| 511 | Ga0501202_054991 | 3300049652 | Bacteria | 889 |
| 512 | Ga0501209_037464 | 3300049656 | Bacteria | 1266 |
| 513 | Ga0501217_205911 | 3300049661 | Bacteria | 615 |
| 514 | Ga0501235_074513 | 3300049669 | Bacteria | 806 |
| 515 | Ga0501242_032233 | 3300049674 | Bacteria | 714 |
| 516 | Ga0501249_059130 | 3300049679 | Bacteria | 886 |
| 517 | Ga0501221_110631 | 3300049704 | Bacteria | 692 |
| 518 | Ga0501079_0258631 | 3300049741 | Bacteria | 1361 |
| 519 | Ga0501080_0100448 | 3300049742 | Bacteria | 2684 |
| 520 | Ga0501266_010734 | 3300049763 | Bacteria | 1169 |
| 521 | Ga0501268_005161 | 3300049765 | Bacteria | 1867 |
| 522 | Ga0501212_087197 | 3300049851 | Bacteria | 572 |
| 523 | nmdc:mga0a205_3422_c1 | 3300050515 | Bacteria | 14147 |
| 524 | Ga0500658_0000044 | 3300053134 | Bacteria | 72423 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042134 | Ga0450898_049950 | Ga0450898_049950_58_528 | 137 |
| 2 | 3300005455 | Ga0070663_100521755 | Ga0070663_1005217552 | 147 |
| 3 | 3300049652 | Ga0501202_054991 | Ga0501202_054991_252_725 | 148 |
| 4 | 3300049669 | Ga0501235_074513 | Ga0501235_074513_34_507 | 148 |
| 5 | 3300049674 | Ga0501242_032233 | Ga0501242_032233_208_681 | 148 |
| 6 | 3300049679 | Ga0501249_059130 | Ga0501249_059130_396_869 | 148 |
| 7 | 3300049704 | Ga0501221_110631 | Ga0501221_110631_174_647 | 148 |
| 8 | 3300049851 | Ga0501212_087197 | Ga0501212_087197_82_555 | 148 |
| 9 | 3300048905 | Ga0496102_1361926 | Ga0496102_1361926_15_464 | 149 |
| 10 | 3300005339 | Ga0070660_100128812 | Ga0070660_1001288122 | 150 |
| 11 | 3300005985 | Ga0081539_10017580 | Ga0081539_100175803 | 150 |
| 12 | 3300037471 | Ga0395905_0767373 | Ga0395905_0767373_82_555 | 150 |
| 13 | 3300005331 | Ga0070670_101099541 | Ga0070670_1010995411 | 151 |
| 14 | 3300005338 | Ga0068868_100117591 | Ga0068868_1001175913 | 151 |
| 15 | 3300005364 | Ga0070673_100033051 | Ga0070673_1000330513 | 151 |
| 16 | 3300005367 | Ga0070667_100000776 | Ga0070667_1000007761 | 151 |
| 17 | 3300005617 | Ga0068859_100002632 | Ga0068859_10000263213 | 151 |
| 18 | 3300005618 | Ga0068864_100000287 | Ga0068864_10000028718 | 151 |
| 19 | 3300005841 | Ga0068863_100002077 | Ga0068863_10000207710 | 151 |
| 20 | 3300005842 | Ga0068858_100000579 | Ga0068858_1000005796 | 151 |
| 21 | 3300005843 | Ga0068860_100004159 | Ga0068860_1000041591 | 151 |
| 22 | 3300005844 | Ga0068862_100941099 | Ga0068862_1009410992 | 151 |
| 23 | 3300006931 | Ga0097620_100002632 | Ga0097620_10000263213 | 151 |
| 24 | 3300009011 | Ga0105251_10085545 | Ga0105251_100855452 | 151 |
| 25 | 3300009092 | Ga0105250_10005450 | Ga0105250_100054503 | 151 |
| 26 | 3300009101 | Ga0105247_10179959 | Ga0105247_101799592 | 151 |
| 27 | 3300009177 | Ga0105248_10000552 | Ga0105248_1000055213 | 151 |
| 28 | 3300009553 | Ga0105249_10329902 | Ga0105249_103299022 | 151 |
| 29 | 3300013306 | Ga0163162_10052041 | Ga0163162_100520415 | 151 |
| 30 | 3300014325 | Ga0163163_10000390 | Ga0163163_1000039037 | 151 |
| 31 | 3300014968 | Ga0157379_10180699 | Ga0157379_101806992 | 151 |
| 32 | 3300025711 | Ga0207696_1004959 | Ga0207696_10049593 | 151 |
| 33 | 3300025900 | Ga0207710_10278561 | Ga0207710_102785612 | 151 |
| 34 | 3300025923 | Ga0207681_10088083 | Ga0207681_100880832 | 151 |
| 35 | 3300025925 | Ga0207650_11353542 | Ga0207650_113535421 | 151 |
| 36 | 3300025931 | Ga0207644_10021887 | Ga0207644_100218871 | 151 |
| 37 | 3300025941 | Ga0207711_10000046 | Ga0207711_10000046134 | 151 |
| 38 | 3300025960 | Ga0207651_10001136 | Ga0207651_100011365 | 151 |
| 39 | 3300025961 | Ga0207712_10288626 | Ga0207712_102886262 | 151 |
| 40 | 3300025986 | Ga0207658_10007445 | Ga0207658_1000744510 | 151 |
| 41 | 3300026023 | Ga0207677_10113574 | Ga0207677_101135743 | 151 |
| 42 | 3300026035 | Ga0207703_10002982 | Ga0207703_1000298215 | 151 |
| 43 | 3300026067 | Ga0207678_10251570 | Ga0207678_102515702 | 151 |
| 44 | 3300026088 | Ga0207641_10001374 | Ga0207641_1000137412 | 151 |
| 45 | 3300026095 | Ga0207676_10000345 | Ga0207676_1000034538 | 151 |
| 46 | 3300028380 | Ga0268265_10503658 | Ga0268265_105036582 | 151 |
| 47 | 3300028381 | Ga0268264_10001319 | Ga0268264_1000131929 | 151 |
| 48 | 3300001990 | JGI24737J22298_10100641 | JGI24737J22298_101006411 | 154 |
| 49 | 3300013100 | Ga0157373_10030128 | Ga0157373_100301281 | 156 |
| 50 | 3300013102 | Ga0157371_10048674 | Ga0157371_100486743 | 156 |
| 51 | 3300030745 | Ga0316182_1441053 | Ga0316182_14410532 | 156 |
| 52 | 3300031911 | Ga0307412_10183549 | Ga0307412_101835492 | 156 |
| 53 | 3300032126 | Ga0307415_100844273 | Ga0307415_1008442731 | 156 |
| 54 | 3300042530 | Ga0450916_041660 | Ga0450916_041660_157_627 | 156 |
| 55 | 3300001915 | JGI24741J21665_1024051 | JGI24741J21665_10240511 | 157 |
| 56 | 3300001979 | JGI24740J21852_10001677 | JGI24740J21852_100016775 | 157 |
| 57 | 3300001979 | JGI24740J21852_10006406 | JGI24740J21852_100064063 | 157 |
| 58 | 3300001989 | JGI24739J22299_10010205 | JGI24739J22299_100102052 | 157 |
| 59 | 3300001989 | JGI24739J22299_10018551 | JGI24739J22299_100185513 | 157 |
| 60 | 3300001990 | JGI24737J22298_10000221 | JGI24737J22298_1000022112 | 157 |
| 61 | 3300001990 | JGI24737J22298_10034433 | JGI24737J22298_100344332 | 157 |
| 62 | 3300001990 | JGI24737J22298_10048327 | JGI24737J22298_100483272 | 157 |
| 63 | 3300001991 | JGI24743J22301_10006580 | JGI24743J22301_100065802 | 157 |
| 64 | 3300002067 | JGI24735J21928_10093067 | JGI24735J21928_100930672 | 157 |
| 65 | 3300002070 | JGI24750J21931_1007719 | JGI24750J21931_10077192 | 157 |
| 66 | 3300002073 | JGI24745J21846_1005138 | JGI24745J21846_10051382 | 157 |
| 67 | 3300002075 | JGI24738J21930_10008528 | JGI24738J21930_100085281 | 157 |
| 68 | 3300002077 | JGI24744J21845_10029985 | JGI24744J21845_100299852 | 157 |
| 69 | 3300002239 | JGI24034J26672_10028609 | JGI24034J26672_100286092 | 157 |
| 70 | 3300005293 | Ga0065715_10009313 | Ga0065715_100093133 | 157 |
| 71 | 3300005293 | Ga0065715_10036540 | Ga0065715_100365402 | 157 |
| 72 | 3300005327 | Ga0070658_10077516 | Ga0070658_100775163 | 157 |
| 73 | 3300005327 | Ga0070658_10187940 | Ga0070658_101879401 | 157 |
| 74 | 3300005327 | Ga0070658_11414388 | Ga0070658_114143881 | 157 |
| 75 | 3300005328 | Ga0070676_10002314 | Ga0070676_100023142 | 157 |
| 76 | 3300005328 | Ga0070676_10004745 | Ga0070676_100047452 | 157 |
| 77 | 3300005328 | Ga0070676_10012510 | Ga0070676_100125105 | 157 |
| 78 | 3300005328 | Ga0070676_10038089 | Ga0070676_100380892 | 157 |
| 79 | 3300005328 | Ga0070676_10424335 | Ga0070676_104243352 | 157 |
| 80 | 3300005329 | Ga0070683_100093326 | Ga0070683_1000933263 | 157 |
| 81 | 3300005331 | Ga0070670_100005417 | Ga0070670_10000541710 | 157 |
| 82 | 3300005331 | Ga0070670_100044489 | Ga0070670_1000444893 | 157 |
| 83 | 3300005331 | Ga0070670_100047275 | Ga0070670_1000472753 | 157 |
| 84 | 3300005331 | Ga0070670_100253196 | Ga0070670_1002531961 | 157 |
| 85 | 3300005331 | Ga0070670_101204550 | Ga0070670_1012045501 | 157 |
| 86 | 3300005333 | Ga0070677_10017076 | Ga0070677_100170763 | 157 |
| 87 | 3300005333 | Ga0070677_10047171 | Ga0070677_100471712 | 157 |
| 88 | 3300005334 | Ga0068869_100000662 | Ga0068869_1000006624 | 157 |
| 89 | 3300005334 | Ga0068869_100013127 | Ga0068869_1000131271 | 157 |
| 90 | 3300005334 | Ga0068869_100187507 | Ga0068869_1001875072 | 157 |
| 91 | 3300005334 | Ga0068869_100524880 | Ga0068869_1005248802 | 157 |
| 92 | 3300005335 | Ga0070666_10016286 | Ga0070666_100162865 | 157 |
| 93 | 3300005335 | Ga0070666_10016307 | Ga0070666_100163072 | 157 |
| 94 | 3300005335 | Ga0070666_10109944 | Ga0070666_101099442 | 157 |
| 95 | 3300005336 | Ga0070680_100122607 | Ga0070680_1001226073 | 157 |
| 96 | 3300005336 | Ga0070680_100672210 | Ga0070680_1006722102 | 157 |
| 97 | 3300005337 | Ga0070682_100229205 | Ga0070682_1002292051 | 157 |
| 98 | 3300005337 | Ga0070682_100665627 | Ga0070682_1006656272 | 157 |
| 99 | 3300005338 | Ga0068868_100001411 | Ga0068868_10000141121 | 157 |
| 100 | 3300005338 | Ga0068868_100346260 | Ga0068868_1003462602 | 157 |
| 101 | 3300005339 | Ga0070660_100010601 | Ga0070660_1000106017 | 157 |
| 102 | 3300005339 | Ga0070660_100064014 | Ga0070660_1000640142 | 157 |
| 103 | 3300005339 | Ga0070660_100091564 | Ga0070660_1000915642 | 157 |
| 104 | 3300005339 | Ga0070660_100492905 | Ga0070660_1004929051 | 157 |
| 105 | 3300005339 | Ga0070660_100545835 | Ga0070660_1005458352 | 157 |
| 106 | 3300005339 | Ga0070660_100733816 | Ga0070660_1007338161 | 157 |
| 107 | 3300005339 | Ga0070660_100953178 | Ga0070660_1009531781 | 157 |
| 108 | 3300005339 | Ga0070660_101087949 | Ga0070660_1010879491 | 157 |
| 109 | 3300005341 | Ga0070691_10208438 | Ga0070691_102084382 | 157 |
| 110 | 3300005344 | Ga0070661_100882323 | Ga0070661_1008823231 | 157 |
| 111 | 3300005347 | Ga0070668_100007531 | Ga0070668_1000075313 | 157 |
| 112 | 3300005347 | Ga0070668_100040876 | Ga0070668_1000408762 | 157 |
| 113 | 3300005347 | Ga0070668_100098504 | Ga0070668_1000985042 | 157 |
| 114 | 3300005353 | Ga0070669_100000682 | Ga0070669_10000068210 | 157 |
| 115 | 3300005353 | Ga0070669_100025231 | Ga0070669_1000252313 | 157 |
| 116 | 3300005353 | Ga0070669_100114258 | Ga0070669_1001142581 | 157 |
| 117 | 3300005354 | Ga0070675_100003697 | Ga0070675_1000036979 | 157 |
| 118 | 3300005354 | Ga0070675_100042801 | Ga0070675_1000428013 | 157 |
| 119 | 3300005354 | Ga0070675_100133608 | Ga0070675_1001336083 | 157 |
| 120 | 3300005354 | Ga0070675_100266298 | Ga0070675_1002662982 | 157 |
| 121 | 3300005355 | Ga0070671_100007783 | Ga0070671_1000077837 | 157 |
| 122 | 3300005355 | Ga0070671_100043661 | Ga0070671_1000436612 | 157 |
| 123 | 3300005355 | Ga0070671_100058477 | Ga0070671_1000584773 | 157 |
| 124 | 3300005356 | Ga0070674_100052696 | Ga0070674_1000526962 | 157 |
| 125 | 3300005364 | Ga0070673_100000833 | Ga0070673_1000008334 | 157 |
| 126 | 3300005364 | Ga0070673_100009304 | Ga0070673_1000093045 | 157 |
| 127 | 3300005364 | Ga0070673_100066431 | Ga0070673_1000664312 | 157 |
| 128 | 3300005366 | Ga0070659_100000950 | Ga0070659_1000009509 | 157 |
| 129 | 3300005366 | Ga0070659_100001481 | Ga0070659_10000148110 | 157 |
| 130 | 3300005366 | Ga0070659_100039104 | Ga0070659_1000391042 | 157 |
| 131 | 3300005366 | Ga0070659_100334758 | Ga0070659_1003347581 | 157 |
| 132 | 3300005366 | Ga0070659_100438140 | Ga0070659_1004381402 | 157 |
| 133 | 3300005367 | Ga0070667_100006561 | Ga0070667_1000065619 | 157 |
| 134 | 3300005367 | Ga0070667_100013906 | Ga0070667_1000139064 | 157 |
| 135 | 3300005367 | Ga0070667_100058875 | Ga0070667_1000588753 | 157 |
| 136 | 3300005367 | Ga0070667_100252556 | Ga0070667_1002525562 | 157 |
| 137 | 3300005367 | Ga0070667_100455961 | Ga0070667_1004559612 | 157 |
| 138 | 3300005367 | Ga0070667_101047906 | Ga0070667_1010479062 | 157 |
| 139 | 3300005444 | Ga0070694_100003228 | Ga0070694_1000032289 | 157 |
| 140 | 3300005455 | Ga0070663_100005818 | Ga0070663_1000058185 | 157 |
| 141 | 3300005455 | Ga0070663_100022238 | Ga0070663_1000222383 | 157 |
| 142 | 3300005455 | Ga0070663_101906632 | Ga0070663_1019066321 | 157 |
| 143 | 3300005457 | Ga0070662_100006881 | Ga0070662_1000068816 | 157 |
| 144 | 3300005457 | Ga0070662_100022242 | Ga0070662_1000222421 | 157 |
| 145 | 3300005457 | Ga0070662_100034774 | Ga0070662_1000347742 | 157 |
| 146 | 3300005457 | Ga0070662_100049099 | Ga0070662_1000490993 | 157 |
| 147 | 3300005457 | Ga0070662_100141249 | Ga0070662_1001412492 | 157 |
| 148 | 3300005458 | Ga0070681_10090766 | Ga0070681_100907662 | 157 |
| 149 | 3300005458 | Ga0070681_10163066 | Ga0070681_101630662 | 157 |
| 150 | 3300005458 | Ga0070681_10378623 | Ga0070681_103786232 | 157 |
| 151 | 3300005459 | Ga0068867_100033101 | Ga0068867_1000331014 | 157 |
| 152 | 3300005459 | Ga0068867_100035018 | Ga0068867_1000350182 | 157 |
| 153 | 3300005459 | Ga0068867_101687128 | Ga0068867_1016871281 | 157 |
| 154 | 3300005530 | Ga0070679_100033899 | Ga0070679_1000338992 | 157 |
| 155 | 3300005530 | Ga0070679_100753421 | Ga0070679_1007534211 | 157 |
| 156 | 3300005530 | Ga0070679_100808397 | Ga0070679_1008083971 | 157 |
| 157 | 3300005535 | Ga0070684_100218702 | Ga0070684_1002187022 | 157 |
| 158 | 3300005539 | Ga0068853_100001659 | Ga0068853_10000165912 | 157 |
| 159 | 3300005539 | Ga0068853_100139035 | Ga0068853_1001390352 | 157 |
| 160 | 3300005539 | Ga0068853_100233159 | Ga0068853_1002331592 | 157 |
| 161 | 3300005539 | Ga0068853_100835526 | Ga0068853_1008355261 | 157 |
| 162 | 3300005543 | Ga0070672_100000589 | Ga0070672_10000058911 | 157 |
| 163 | 3300005543 | Ga0070672_100097092 | Ga0070672_1000970922 | 157 |
| 164 | 3300005543 | Ga0070672_100307710 | Ga0070672_1003077102 | 157 |
| 165 | 3300005543 | Ga0070672_101346839 | Ga0070672_1013468391 | 157 |
| 166 | 3300005545 | Ga0070695_100134661 | Ga0070695_1001346612 | 157 |
| 167 | 3300005545 | Ga0070695_101690110 | Ga0070695_1016901101 | 157 |
| 168 | 3300005546 | Ga0070696_100019918 | Ga0070696_1000199185 | 157 |
| 169 | 3300005547 | Ga0070693_100009371 | Ga0070693_1000093716 | 157 |
| 170 | 3300005547 | Ga0070693_100172114 | Ga0070693_1001721142 | 157 |
| 171 | 3300005548 | Ga0070665_100071855 | Ga0070665_1000718554 | 157 |
| 172 | 3300005548 | Ga0070665_100533889 | Ga0070665_1005338892 | 157 |
| 173 | 3300005549 | Ga0070704_100180504 | Ga0070704_1001805042 | 157 |
| 174 | 3300005563 | Ga0068855_100008531 | Ga0068855_1000085319 | 157 |
| 175 | 3300005563 | Ga0068855_100889489 | Ga0068855_1008894891 | 157 |
| 176 | 3300005564 | Ga0070664_100008433 | Ga0070664_1000084332 | 157 |
| 177 | 3300005564 | Ga0070664_100009351 | Ga0070664_1000093518 | 157 |
| 178 | 3300005564 | Ga0070664_100095934 | Ga0070664_1000959342 | 157 |
| 179 | 3300005564 | Ga0070664_100320269 | Ga0070664_1003202692 | 157 |
| 180 | 3300005564 | Ga0070664_100939337 | Ga0070664_1009393372 | 157 |
| 181 | 3300005564 | Ga0070664_102022803 | Ga0070664_1020228031 | 157 |
| 182 | 3300005577 | Ga0068857_100000692 | Ga0068857_1000006923 | 157 |
| 183 | 3300005577 | Ga0068857_100128610 | Ga0068857_1001286102 | 157 |
| 184 | 3300005578 | Ga0068854_100001058 | Ga0068854_10000105821 | 157 |
| 185 | 3300005578 | Ga0068854_100003715 | Ga0068854_1000037153 | 157 |
| 186 | 3300005578 | Ga0068854_100014106 | Ga0068854_1000141063 | 157 |
| 187 | 3300005616 | Ga0068852_100024796 | Ga0068852_1000247966 | 157 |
| 188 | 3300005616 | Ga0068852_100181698 | Ga0068852_1001816982 | 157 |
| 189 | 3300005617 | Ga0068859_100007420 | Ga0068859_1000074208 | 157 |
| 190 | 3300005617 | Ga0068859_100016870 | Ga0068859_1000168701 | 157 |
| 191 | 3300005617 | Ga0068859_100032223 | Ga0068859_1000322236 | 157 |
| 192 | 3300005617 | Ga0068859_100034904 | Ga0068859_1000349043 | 157 |
| 193 | 3300005618 | Ga0068864_100000748 | Ga0068864_10000074820 | 157 |
| 194 | 3300005618 | Ga0068864_100000894 | Ga0068864_1000008944 | 157 |
| 195 | 3300005618 | Ga0068864_100013544 | Ga0068864_1000135447 | 157 |
| 196 | 3300005618 | Ga0068864_101089932 | Ga0068864_1010899321 | 157 |
| 197 | 3300005718 | Ga0068866_10770154 | Ga0068866_107701542 | 157 |
| 198 | 3300005719 | Ga0068861_100024292 | Ga0068861_1000242922 | 157 |
| 199 | 3300005719 | Ga0068861_100946812 | Ga0068861_1009468121 | 157 |
| 200 | 3300005834 | Ga0068851_10559861 | Ga0068851_105598612 | 157 |
| 201 | 3300005840 | Ga0068870_10247865 | Ga0068870_102478652 | 157 |
| 202 | 3300005841 | Ga0068863_100050840 | Ga0068863_1000508403 | 157 |
| 203 | 3300005841 | Ga0068863_100062372 | Ga0068863_1000623722 | 157 |
| 204 | 3300005841 | Ga0068863_100120017 | Ga0068863_1001200174 | 157 |
| 205 | 3300005841 | Ga0068863_100585507 | Ga0068863_1005855072 | 157 |
| 206 | 3300005842 | Ga0068858_100012043 | Ga0068858_1000120431 | 157 |
| 207 | 3300005842 | Ga0068858_100032449 | Ga0068858_1000324495 | 157 |
| 208 | 3300005842 | Ga0068858_100033541 | Ga0068858_1000335414 | 157 |
| 209 | 3300005842 | Ga0068858_100459945 | Ga0068858_1004599452 | 157 |
| 210 | 3300005843 | Ga0068860_100006012 | Ga0068860_1000060127 | 157 |
| 211 | 3300005843 | Ga0068860_100019373 | Ga0068860_1000193736 | 157 |
| 212 | 3300005843 | Ga0068860_100025537 | Ga0068860_1000255375 | 157 |
| 213 | 3300005844 | Ga0068862_100018299 | Ga0068862_1000182995 | 157 |
| 214 | 3300005844 | Ga0068862_100096710 | Ga0068862_1000967102 | 157 |
| 215 | 3300006175 | Ga0070712_100118137 | Ga0070712_1001181372 | 157 |
| 216 | 3300006237 | Ga0097621_100470385 | Ga0097621_1004703852 | 157 |
| 217 | 3300006852 | Ga0075433_10203594 | Ga0075433_102035942 | 157 |
| 218 | 3300006871 | Ga0075434_100119783 | Ga0075434_1001197833 | 157 |
| 219 | 3300006881 | Ga0068865_100077559 | Ga0068865_1000775593 | 157 |
| 220 | 3300006931 | Ga0097620_100007420 | Ga0097620_1000074208 | 157 |
| 221 | 3300006931 | Ga0097620_100016869 | Ga0097620_1000168691 | 157 |
| 222 | 3300006931 | Ga0097620_100032223 | Ga0097620_1000322232 | 157 |
| 223 | 3300006931 | Ga0097620_100034904 | Ga0097620_1000349043 | 157 |
| 224 | 3300007076 | Ga0075435_100190747 | Ga0075435_1001907472 | 157 |
| 225 | 3300009093 | Ga0105240_10104592 | Ga0105240_101045922 | 157 |
| 226 | 3300009093 | Ga0105240_10172394 | Ga0105240_101723942 | 157 |
| 227 | 3300009098 | Ga0105245_10005839 | Ga0105245_100058392 | 157 |
| 228 | 3300009098 | Ga0105245_10030174 | Ga0105245_100301742 | 157 |
| 229 | 3300009101 | Ga0105247_10148459 | Ga0105247_101484592 | 157 |
| 230 | 3300009148 | Ga0105243_10023746 | Ga0105243_100237462 | 157 |
| 231 | 3300009174 | Ga0105241_10098336 | Ga0105241_100983362 | 157 |
| 232 | 3300009176 | Ga0105242_10048328 | Ga0105242_100483284 | 157 |
| 233 | 3300009177 | Ga0105248_10006033 | Ga0105248_100060331 | 157 |
| 234 | 3300009177 | Ga0105248_10010327 | Ga0105248_100103278 | 157 |
| 235 | 3300009177 | Ga0105248_10082850 | Ga0105248_100828502 | 157 |
| 236 | 3300009177 | Ga0105248_10260014 | Ga0105248_102600142 | 157 |
| 237 | 3300009551 | Ga0105238_10064099 | Ga0105238_100640995 | 157 |
| 238 | 3300009553 | Ga0105249_10020672 | Ga0105249_100206725 | 157 |
| 239 | 3300009553 | Ga0105249_10047596 | Ga0105249_100475961 | 157 |
| 240 | 3300010375 | Ga0105239_10145487 | Ga0105239_101454873 | 157 |
| 241 | 3300010375 | Ga0105239_10284780 | Ga0105239_102847802 | 157 |
| 242 | 3300011119 | Ga0105246_10202665 | Ga0105246_102026652 | 157 |
| 243 | 3300013100 | Ga0157373_10005180 | Ga0157373_100051805 | 157 |
| 244 | 3300013100 | Ga0157373_10126438 | Ga0157373_101264382 | 157 |
| 245 | 3300013100 | Ga0157373_10209815 | Ga0157373_102098152 | 157 |
| 246 | 3300013100 | Ga0157373_11055251 | Ga0157373_110552511 | 157 |
| 247 | 3300013102 | Ga0157371_10004027 | Ga0157371_100040277 | 157 |
| 248 | 3300013102 | Ga0157371_10044632 | Ga0157371_100446322 | 157 |
| 249 | 3300013102 | Ga0157371_10068264 | Ga0157371_100682642 | 157 |
| 250 | 3300013102 | Ga0157371_11283196 | Ga0157371_112831961 | 157 |
| 251 | 3300013297 | Ga0157378_10011763 | Ga0157378_100117639 | 157 |
| 252 | 3300013297 | Ga0157378_11034548 | Ga0157378_110345482 | 157 |
| 253 | 3300013306 | Ga0163162_10050160 | Ga0163162_100501605 | 157 |
| 254 | 3300013306 | Ga0163162_10328724 | Ga0163162_103287242 | 157 |
| 255 | 3300013306 | Ga0163162_10429662 | Ga0163162_104296622 | 157 |
| 256 | 3300013307 | Ga0157372_10053038 | Ga0157372_100530382 | 157 |
| 257 | 3300013308 | Ga0157375_10409993 | Ga0157375_104099932 | 157 |
| 258 | 3300013308 | Ga0157375_11031427 | Ga0157375_110314272 | 157 |
| 259 | 3300014325 | Ga0163163_11929995 | Ga0163163_119299952 | 157 |
| 260 | 3300014326 | Ga0157380_10004000 | Ga0157380_100040006 | 157 |
| 261 | 3300014326 | Ga0157380_10026397 | Ga0157380_100263976 | 157 |
| 262 | 3300014326 | Ga0157380_10026652 | Ga0157380_100266525 | 157 |
| 263 | 3300014745 | Ga0157377_10025447 | Ga0157377_100254472 | 157 |
| 264 | 3300014745 | Ga0157377_10381605 | Ga0157377_103816052 | 157 |
| 265 | 3300014968 | Ga0157379_10465856 | Ga0157379_104658562 | 157 |
| 266 | 3300014968 | Ga0157379_10848286 | Ga0157379_108482862 | 157 |
| 267 | 3300014968 | Ga0157379_10919406 | Ga0157379_109194062 | 157 |
| 268 | 3300021388 | Ga0213875_10002975 | Ga0213875_100029752 | 157 |
| 269 | 3300025290 | Ga0207673_1000994 | Ga0207673_10009942 | 157 |
| 270 | 3300025315 | Ga0207697_10000253 | Ga0207697_100002539 | 157 |
| 271 | 3300025321 | Ga0207656_10500629 | Ga0207656_105006291 | 157 |
| 272 | 3300025893 | Ga0207682_10001459 | Ga0207682_100014593 | 157 |
| 273 | 3300025893 | Ga0207682_10037597 | Ga0207682_100375972 | 157 |
| 274 | 3300025893 | Ga0207682_10185145 | Ga0207682_101851451 | 157 |
| 275 | 3300025899 | Ga0207642_10017810 | Ga0207642_100178103 | 157 |
| 276 | 3300025901 | Ga0207688_10000652 | Ga0207688_100006526 | 157 |
| 277 | 3300025901 | Ga0207688_10607426 | Ga0207688_106074261 | 157 |
| 278 | 3300025904 | Ga0207647_10000327 | Ga0207647_1000032732 | 157 |
| 279 | 3300025904 | Ga0207647_10000760 | Ga0207647_100007604 | 157 |
| 280 | 3300025907 | Ga0207645_10007069 | Ga0207645_100070698 | 157 |
| 281 | 3300025907 | Ga0207645_10017352 | Ga0207645_100173524 | 157 |
| 282 | 3300025907 | Ga0207645_10061798 | Ga0207645_100617982 | 157 |
| 283 | 3300025908 | Ga0207643_10180326 | Ga0207643_101803262 | 157 |
| 284 | 3300025909 | Ga0207705_10408753 | Ga0207705_104087532 | 157 |
| 285 | 3300025912 | Ga0207707_10155977 | Ga0207707_101559772 | 157 |
| 286 | 3300025912 | Ga0207707_10282084 | Ga0207707_102820842 | 157 |
| 287 | 3300025912 | Ga0207707_10608263 | Ga0207707_106082632 | 157 |
| 288 | 3300025913 | Ga0207695_10137659 | Ga0207695_101376592 | 157 |
| 289 | 3300025915 | Ga0207693_10040495 | Ga0207693_100404954 | 157 |
| 290 | 3300025917 | Ga0207660_10079087 | Ga0207660_100790873 | 157 |
| 291 | 3300025917 | Ga0207660_10254269 | Ga0207660_102542692 | 157 |
| 292 | 3300025919 | Ga0207657_10003476 | Ga0207657_1000347620 | 157 |
| 293 | 3300025919 | Ga0207657_10009310 | Ga0207657_1000931011 | 157 |
| 294 | 3300025919 | Ga0207657_10025878 | Ga0207657_100258784 | 157 |
| 295 | 3300025919 | Ga0207657_10062356 | Ga0207657_100623564 | 157 |
| 296 | 3300025919 | Ga0207657_10378404 | Ga0207657_103784042 | 157 |
| 297 | 3300025919 | Ga0207657_10519777 | Ga0207657_105197771 | 157 |
| 298 | 3300025919 | Ga0207657_10633242 | Ga0207657_106332423 | 157 |
| 299 | 3300025919 | Ga0207657_10853312 | Ga0207657_108533122 | 157 |
| 300 | 3300025920 | Ga0207649_10104439 | Ga0207649_101044392 | 157 |
| 301 | 3300025920 | Ga0207649_10415378 | Ga0207649_104153782 | 157 |
| 302 | 3300025921 | Ga0207652_11599847 | Ga0207652_115998471 | 157 |
| 303 | 3300025923 | Ga0207681_10018564 | Ga0207681_100185644 | 157 |
| 304 | 3300025923 | Ga0207681_10025163 | Ga0207681_100251634 | 157 |
| 305 | 3300025923 | Ga0207681_10060721 | Ga0207681_100607212 | 157 |
| 306 | 3300025923 | Ga0207681_10126585 | Ga0207681_101265852 | 157 |
| 307 | 3300025925 | Ga0207650_10063190 | Ga0207650_100631903 | 157 |
| 308 | 3300025925 | Ga0207650_10068150 | Ga0207650_100681503 | 157 |
| 309 | 3300025925 | Ga0207650_10147802 | Ga0207650_101478022 | 157 |
| 310 | 3300025926 | Ga0207659_10004610 | Ga0207659_100046109 | 157 |
| 311 | 3300025926 | Ga0207659_10012653 | Ga0207659_100126534 | 157 |
| 312 | 3300025926 | Ga0207659_10117106 | Ga0207659_101171062 | 157 |
| 313 | 3300025926 | Ga0207659_10142012 | Ga0207659_101420122 | 157 |
| 314 | 3300025927 | Ga0207687_10003036 | Ga0207687_100030362 | 157 |
| 315 | 3300025927 | Ga0207687_10141139 | Ga0207687_101411392 | 157 |
| 316 | 3300025929 | Ga0207664_11310686 | Ga0207664_113106862 | 157 |
| 317 | 3300025931 | Ga0207644_10044552 | Ga0207644_100445522 | 157 |
| 318 | 3300025931 | Ga0207644_10102178 | Ga0207644_101021782 | 157 |
| 319 | 3300025931 | Ga0207644_10512081 | Ga0207644_105120812 | 157 |
| 320 | 3300025932 | Ga0207690_10001585 | Ga0207690_100015855 | 157 |
| 321 | 3300025932 | Ga0207690_10002341 | Ga0207690_1000234110 | 157 |
| 322 | 3300025932 | Ga0207690_10023323 | Ga0207690_100233232 | 157 |
| 323 | 3300025932 | Ga0207690_10185459 | Ga0207690_101854592 | 157 |
| 324 | 3300025933 | Ga0207706_10000143 | Ga0207706_1000014310 | 157 |
| 325 | 3300025933 | Ga0207706_10000904 | Ga0207706_1000090433 | 157 |
| 326 | 3300025933 | Ga0207706_10003074 | Ga0207706_100030749 | 157 |
| 327 | 3300025933 | Ga0207706_10004098 | Ga0207706_100040985 | 157 |
| 328 | 3300025933 | Ga0207706_10013609 | Ga0207706_100136094 | 157 |
| 329 | 3300025933 | Ga0207706_10215155 | Ga0207706_102151552 | 157 |
| 330 | 3300025937 | Ga0207669_10014002 | Ga0207669_100140022 | 157 |
| 331 | 3300025938 | Ga0207704_10047537 | Ga0207704_100475373 | 157 |
| 332 | 3300025938 | Ga0207704_10056039 | Ga0207704_100560392 | 157 |
| 333 | 3300025940 | Ga0207691_10000743 | Ga0207691_1000074333 | 157 |
| 334 | 3300025940 | Ga0207691_10066655 | Ga0207691_100666551 | 157 |
| 335 | 3300025940 | Ga0207691_10146453 | Ga0207691_101464532 | 157 |
| 336 | 3300025940 | Ga0207691_10329549 | Ga0207691_103295491 | 157 |
| 337 | 3300025940 | Ga0207691_10847910 | Ga0207691_108479102 | 157 |
| 338 | 3300025941 | Ga0207711_10006545 | Ga0207711_1000654510 | 157 |
| 339 | 3300025941 | Ga0207711_10059860 | Ga0207711_100598604 | 157 |
| 340 | 3300025941 | Ga0207711_10293281 | Ga0207711_102932812 | 157 |
| 341 | 3300025942 | Ga0207689_10000372 | Ga0207689_1000037233 | 157 |
| 342 | 3300025942 | Ga0207689_10003887 | Ga0207689_1000388714 | 157 |
| 343 | 3300025942 | Ga0207689_10012702 | Ga0207689_100127025 | 157 |
| 344 | 3300025944 | Ga0207661_10095396 | Ga0207661_100953963 | 157 |
| 345 | 3300025944 | Ga0207661_11149047 | Ga0207661_111490472 | 157 |
| 346 | 3300025945 | Ga0207679_10039220 | Ga0207679_100392202 | 157 |
| 347 | 3300025945 | Ga0207679_10040787 | Ga0207679_100407873 | 157 |
| 348 | 3300025945 | Ga0207679_10189033 | Ga0207679_101890332 | 157 |
| 349 | 3300025945 | Ga0207679_10544793 | Ga0207679_105447932 | 157 |
| 350 | 3300025949 | Ga0207667_10069720 | Ga0207667_100697204 | 157 |
| 351 | 3300025949 | Ga0207667_10130037 | Ga0207667_101300373 | 157 |
| 352 | 3300025960 | Ga0207651_10000440 | Ga0207651_1000044015 | 157 |
| 353 | 3300025960 | Ga0207651_10199460 | Ga0207651_101994602 | 157 |
| 354 | 3300025960 | Ga0207651_10544690 | Ga0207651_105446902 | 157 |
| 355 | 3300025961 | Ga0207712_10000491 | Ga0207712_100004913 | 157 |
| 356 | 3300025972 | Ga0207668_10050499 | Ga0207668_100504992 | 157 |
| 357 | 3300025972 | Ga0207668_10094425 | Ga0207668_100944252 | 157 |
| 358 | 3300025972 | Ga0207668_10098447 | Ga0207668_100984472 | 157 |
| 359 | 3300025972 | Ga0207668_10132596 | Ga0207668_101325962 | 157 |
| 360 | 3300025981 | Ga0207640_10009513 | Ga0207640_100095132 | 157 |
| 361 | 3300025981 | Ga0207640_10021292 | Ga0207640_100212921 | 157 |
| 362 | 3300025981 | Ga0207640_10106567 | Ga0207640_101065673 | 157 |
| 363 | 3300025986 | Ga0207658_10017187 | Ga0207658_100171874 | 157 |
| 364 | 3300025986 | Ga0207658_10018485 | Ga0207658_100184853 | 157 |
| 365 | 3300025986 | Ga0207658_10066051 | Ga0207658_100660513 | 157 |
| 366 | 3300025986 | Ga0207658_10373405 | Ga0207658_103734052 | 157 |
| 367 | 3300026023 | Ga0207677_10023455 | Ga0207677_100234555 | 157 |
| 368 | 3300026023 | Ga0207677_10061824 | Ga0207677_100618243 | 157 |
| 369 | 3300026023 | Ga0207677_10391352 | Ga0207677_103913522 | 157 |
| 370 | 3300026035 | Ga0207703_10002126 | Ga0207703_1000212617 | 157 |
| 371 | 3300026035 | Ga0207703_10003193 | Ga0207703_1000319311 | 157 |
| 372 | 3300026035 | Ga0207703_10132812 | Ga0207703_101328123 | 157 |
| 373 | 3300026035 | Ga0207703_10642265 | Ga0207703_106422652 | 157 |
| 374 | 3300026041 | Ga0207639_10005382 | Ga0207639_100053822 | 157 |
| 375 | 3300026041 | Ga0207639_10037273 | Ga0207639_100372733 | 157 |
| 376 | 3300026041 | Ga0207639_10640146 | Ga0207639_106401462 | 157 |
| 377 | 3300026067 | Ga0207678_10000308 | Ga0207678_100003089 | 157 |
| 378 | 3300026067 | Ga0207678_10008496 | Ga0207678_100084966 | 157 |
| 379 | 3300026067 | Ga0207678_10043334 | Ga0207678_100433343 | 157 |
| 380 | 3300026067 | Ga0207678_10283700 | Ga0207678_102837002 | 157 |
| 381 | 3300026088 | Ga0207641_10010491 | Ga0207641_100104916 | 157 |
| 382 | 3300026088 | Ga0207641_10016527 | Ga0207641_100165273 | 157 |
| 383 | 3300026088 | Ga0207641_10098576 | Ga0207641_100985764 | 157 |
| 384 | 3300026088 | Ga0207641_10120193 | Ga0207641_101201932 | 157 |
| 385 | 3300026089 | Ga0207648_10031677 | Ga0207648_100316772 | 157 |
| 386 | 3300026089 | Ga0207648_10169583 | Ga0207648_101695832 | 157 |
| 387 | 3300026095 | Ga0207676_10003004 | Ga0207676_100030042 | 157 |
| 388 | 3300026095 | Ga0207676_10003557 | Ga0207676_100035579 | 157 |
| 389 | 3300026095 | Ga0207676_10210521 | Ga0207676_102105212 | 157 |
| 390 | 3300026116 | Ga0207674_10000345 | Ga0207674_1000034562 | 157 |
| 391 | 3300026116 | Ga0207674_10009232 | Ga0207674_100092328 | 157 |
| 392 | 3300026116 | Ga0207674_10017364 | Ga0207674_100173646 | 157 |
| 393 | 3300026116 | Ga0207674_10119519 | Ga0207674_101195192 | 157 |
| 394 | 3300026116 | Ga0207674_10477782 | Ga0207674_104777822 | 157 |
| 395 | 3300026118 | Ga0207675_100008821 | Ga0207675_1000088215 | 157 |
| 396 | 3300026118 | Ga0207675_100139258 | Ga0207675_1001392582 | 157 |
| 397 | 3300026118 | Ga0207675_100214827 | Ga0207675_1002148271 | 157 |
| 398 | 3300026121 | Ga0207683_11350793 | Ga0207683_113507931 | 157 |
| 399 | 3300026142 | Ga0207698_10006585 | Ga0207698_100065857 | 157 |
| 400 | 3300026142 | Ga0207698_10326102 | Ga0207698_103261022 | 157 |
| 401 | 3300028379 | Ga0268266_10002013 | Ga0268266_1000201311 | 157 |
| 402 | 3300028379 | Ga0268266_10316007 | Ga0268266_103160072 | 157 |
| 403 | 3300028379 | Ga0268266_10783773 | Ga0268266_107837732 | 157 |
| 404 | 3300028379 | Ga0268266_10915950 | Ga0268266_109159501 | 157 |
| 405 | 3300028380 | Ga0268265_10013286 | Ga0268265_100132861 | 157 |
| 406 | 3300028380 | Ga0268265_10028689 | Ga0268265_100286892 | 157 |
| 407 | 3300028380 | Ga0268265_10277797 | Ga0268265_102777972 | 157 |
| 408 | 3300028381 | Ga0268264_10002725 | Ga0268264_1000272510 | 157 |
| 409 | 3300028381 | Ga0268264_10008787 | Ga0268264_100087873 | 157 |
| 410 | 3300028381 | Ga0268264_10112053 | Ga0268264_101120532 | 157 |
| 411 | 3300031456 | Ga0307513_10133096 | Ga0307513_101330962 | 157 |
| 412 | 3300031824 | Ga0307413_10003489 | Ga0307413_100034898 | 157 |
| 413 | 3300031824 | Ga0307413_10007812 | Ga0307413_100078122 | 157 |
| 414 | 3300031852 | Ga0307410_10001011 | Ga0307410_100010117 | 157 |
| 415 | 3300031852 | Ga0307410_10091226 | Ga0307410_100912263 | 157 |
| 416 | 3300031852 | Ga0307410_10093383 | Ga0307410_100933831 | 157 |
| 417 | 3300031852 | Ga0307410_10150995 | Ga0307410_101509952 | 157 |
| 418 | 3300031852 | Ga0307410_10174796 | Ga0307410_101747962 | 157 |
| 419 | 3300031852 | Ga0307410_10620926 | Ga0307410_106209261 | 157 |
| 420 | 3300031901 | Ga0307406_10098817 | Ga0307406_100988173 | 157 |
| 421 | 3300031901 | Ga0307406_10205252 | Ga0307406_102052521 | 157 |
| 422 | 3300031901 | Ga0307406_10657665 | Ga0307406_106576652 | 157 |
| 423 | 3300031901 | Ga0307406_10742729 | Ga0307406_107427291 | 157 |
| 424 | 3300031903 | Ga0307407_10026709 | Ga0307407_100267093 | 157 |
| 425 | 3300031903 | Ga0307407_10145405 | Ga0307407_101454052 | 157 |
| 426 | 3300031911 | Ga0307412_10027266 | Ga0307412_100272662 | 157 |
| 427 | 3300031911 | Ga0307412_10605268 | Ga0307412_106052682 | 157 |
| 428 | 3300031995 | Ga0307409_100022308 | Ga0307409_1000223084 | 157 |
| 429 | 3300031995 | Ga0307409_100105244 | Ga0307409_1001052442 | 157 |
| 430 | 3300031995 | Ga0307409_100349112 | Ga0307409_1003491122 | 157 |
| 431 | 3300031995 | Ga0307409_100980770 | Ga0307409_1009807702 | 157 |
| 432 | 3300032002 | Ga0307416_100009904 | Ga0307416_1000099046 | 157 |
| 433 | 3300032002 | Ga0307416_100135503 | Ga0307416_1001355033 | 157 |
| 434 | 3300032002 | Ga0307416_100345203 | Ga0307416_1003452032 | 157 |
| 435 | 3300032002 | Ga0307416_100480813 | Ga0307416_1004808132 | 157 |
| 436 | 3300032004 | Ga0307414_10027349 | Ga0307414_100273492 | 157 |
| 437 | 3300032004 | Ga0307414_10054645 | Ga0307414_100546453 | 157 |
| 438 | 3300032004 | Ga0307414_10064693 | Ga0307414_100646932 | 157 |
| 439 | 3300032004 | Ga0307414_10073425 | Ga0307414_100734253 | 157 |
| 440 | 3300032004 | Ga0307414_10134435 | Ga0307414_101344352 | 157 |
| 441 | 3300032004 | Ga0307414_11440922 | Ga0307414_114409221 | 157 |
| 442 | 3300032005 | Ga0307411_10060043 | Ga0307411_100600432 | 157 |
| 443 | 3300032005 | Ga0307411_10096919 | Ga0307411_100969192 | 157 |
| 444 | 3300032005 | Ga0307411_10153806 | Ga0307411_101538062 | 157 |
| 445 | 3300032005 | Ga0307411_10186773 | Ga0307411_101867732 | 157 |
| 446 | 3300032126 | Ga0307415_100005560 | Ga0307415_1000055603 | 157 |
| 447 | 3300032126 | Ga0307415_100431191 | Ga0307415_1004311911 | 157 |
| 448 | 3300032126 | Ga0307415_100514489 | Ga0307415_1005144892 | 157 |
| 449 | 3300035084 | Ga0373928_0133261 | Ga0373928_0133261_16_492 | 157 |
| 450 | 3300035115 | Ga0373941_0045677 | Ga0373941_0045677_157_630 | 157 |
| 451 | 3300035115 | Ga0373941_0270645 | Ga0373941_0270645_91_564 | 157 |
| 452 | 3300037312 | Ga0395899_0150035 | Ga0395899_0150035_521_994 | 157 |
| 453 | 3300037312 | Ga0395899_0193494 | Ga0395899_0193494_62_535 | 157 |
| 454 | 3300037312 | Ga0395899_0289336 | Ga0395899_0289336_91_564 | 157 |
| 455 | 3300037418 | Ga0395900_0141297 | Ga0395900_0141297_1475_1948 | 157 |
| 456 | 3300037418 | Ga0395900_0171575 | Ga0395900_0171575_14_487 | 157 |
| 457 | 3300037418 | Ga0395900_0218774 | Ga0395900_0218774_686_1159 | 157 |
| 458 | 3300037418 | Ga0395900_0252395 | Ga0395900_0252395_10_483 | 157 |
| 459 | 3300037418 | Ga0395900_0432079 | Ga0395900_0432079_378_851 | 157 |
| 460 | 3300037418 | Ga0395900_0699822 | Ga0395900_0699822_52_525 | 157 |
| 461 | 3300037418 | Ga0395900_1734712 | Ga0395900_1734712_37_510 | 157 |
| 462 | 3300037466 | Ga0395898_0188293 | Ga0395898_0188293_1047_1520 | 157 |
| 463 | 3300037466 | Ga0395898_0833153 | Ga0395898_0833153_266_739 | 157 |
| 464 | 3300037471 | Ga0395905_0002924 | Ga0395905_0002924_8966_9439 | 157 |
| 465 | 3300037471 | Ga0395905_0048360 | Ga0395905_0048360_1447_1920 | 157 |
| 466 | 3300037471 | Ga0395905_0110907 | Ga0395905_0110907_562_1035 | 157 |
| 467 | 3300037471 | Ga0395905_0112853 | Ga0395905_0112853_1382_1855 | 157 |
| 468 | 3300037471 | Ga0395905_0132064 | Ga0395905_0132064_16_489 | 157 |
| 469 | 3300037471 | Ga0395905_0138687 | Ga0395905_0138687_1540_2016 | 157 |
| 470 | 3300037471 | Ga0395905_0544999 | Ga0395905_0544999_498_971 | 157 |
| 471 | 3300037471 | Ga0395905_0818883 | Ga0395905_0818883_232_705 | 157 |
| 472 | 3300037471 | Ga0395905_1059563 | Ga0395905_1059563_130_603 | 157 |
| 473 | 3300037471 | Ga0395905_1438422 | Ga0395905_1438422_105_578 | 157 |
| 474 | 3300037853 | Ga0436364_1447256 | Ga0436364_1447256_11052_11525 | 157 |
| 475 | 3300038443 | Ga0395901_0276078 | Ga0395901_0276078_355_828 | 157 |
| 476 | 3300038443 | Ga0395901_0420955 | Ga0395901_0420955_489_962 | 157 |
| 477 | 3300041404 | Ga0439436_0029541 | Ga0439436_0029541_774_1247 | 157 |
| 478 | 3300041999 | Ga0439433_0012801 | Ga0439433_0012801_1097_1582 | 157 |
| 479 | 3300042007 | Ga0439449_0160448 | Ga0439449_0160448_120_593 | 157 |
| 480 | 3300042014 | Ga0439457_168524 | Ga0439457_168524_44_517 | 157 |
| 481 | 3300042015 | Ga0439462_0039918 | Ga0439462_0039918_97_570 | 157 |
| 482 | 3300042015 | Ga0439462_0082122 | Ga0439462_0082122_156_713 | 157 |
| 483 | 3300042156 | Ga0439446_0068062 | Ga0439446_0068062_67_552 | 157 |
| 484 | 3300042439 | Ga0439464_0003467 | Ga0439464_0003467_558_1031 | 157 |
| 485 | 3300044693 | Ga0466961_0127961 | Ga0466961_0127961_362_835 | 157 |
| 486 | 3300044694 | Ga0466963_0098585 | Ga0466963_0098585_1224_1697 | 157 |
| 487 | 3300044694 | Ga0466963_0139434 | Ga0466963_0139434_440_913 | 157 |
| 488 | 3300044719 | Ga0466971_0195043 | Ga0466971_0195043_322_795 | 157 |
| 489 | 3300044765 | Ga0466970_0038874 | Ga0466970_0038874_1664_2137 | 157 |
| 490 | 3300044842 | Ga0466957_0108511 | Ga0466957_0108511_227_700 | 157 |
| 491 | 3300044842 | Ga0466957_0135248 | Ga0466957_0135248_749_1222 | 157 |
| 492 | 3300044901 | Ga0466960_0014000 | Ga0466960_0014000_135_608 | 157 |
| 493 | 3300044901 | Ga0466960_0968839 | Ga0466960_0968839_27_500 | 157 |
| 494 | 3300045976 | Ga0466967_0064086 | Ga0466967_0064086_1134_1607 | 157 |
| 495 | 3300045976 | Ga0466967_0066837 | Ga0466967_0066837_2667_3140 | 157 |
| 496 | 3300045976 | Ga0466967_0423788 | Ga0466967_0423788_274_747 | 157 |
| 497 | 3300046528 | Ga0495642_0170210 | Ga0495642_0170210_314_787 | 157 |
| 498 | 3300046616 | Ga0495668_0004223 | Ga0495668_0004223_588_1061 | 157 |
| 499 | 3300046616 | Ga0495668_0222530 | Ga0495668_0222530_151_624 | 157 |
| 500 | 3300046684 | Ga0495669_0081947 | Ga0495669_0081947_805_1281 | 157 |
| 501 | 3300046684 | Ga0495669_0096691 | Ga0495669_0096691_488_961 | 157 |
| 502 | 3300048903 | Ga0496100_0093742 | Ga0496100_0093742_1050_1523 | 157 |
| 503 | 3300048904 | Ga0496101_0021277 | Ga0496101_0021277_1505_1978 | 157 |
| 504 | 3300048906 | Ga0496103_0347571 | Ga0496103_0347571_369_845 | 157 |
| 505 | 3300048909 | Ga0496106_0122019 | Ga0496106_0122019_62_535 | 157 |
| 506 | 3300048909 | Ga0496106_0545332 | Ga0496106_0545332_168_644 | 157 |
| 507 | 3300048910 | Ga0496107_0050668 | Ga0496107_0050668_2278_2751 | 157 |
| 508 | 3300048910 | Ga0496107_0056415 | Ga0496107_0056415_1392_1865 | 157 |
| 509 | 3300048912 | Ga0496109_0067684 | Ga0496109_0067684_671_1144 | 157 |
| 510 | 3300048913 | Ga0496110_0160557 | Ga0496110_0160557_1088_1561 | 157 |
| 511 | 3300048913 | Ga0496110_0919709 | Ga0496110_0919709_283_759 | 157 |
| 512 | 3300048914 | Ga0496111_0007174 | Ga0496111_0007174_6364_6837 | 157 |
| 513 | 3300048914 | Ga0496111_0494240 | Ga0496111_0494240_255_728 | 157 |
| 514 | 3300048915 | Ga0496112_0072247 | Ga0496112_0072247_1489_1962 | 157 |
| 515 | 3300048916 | Ga0496113_0075377 | Ga0496113_0075377_1567_2040 | 157 |
| 516 | 3300049590 | Ga0501074_0392681 | Ga0501074_0392681_38_511 | 157 |
| 517 | 3300049656 | Ga0501209_037464 | Ga0501209_037464_717_1190 | 157 |
| 518 | 3300049661 | Ga0501217_205911 | Ga0501217_205911_55_528 | 157 |
| 519 | 3300049741 | Ga0501079_0258631 | Ga0501079_0258631_729_1202 | 157 |
| 520 | 3300049742 | Ga0501080_0100448 | Ga0501080_0100448_1468_1941 | 157 |
| 521 | 3300049763 | Ga0501266_010734 | Ga0501266_010734_429_902 | 157 |
| 522 | 3300049765 | Ga0501268_005161 | Ga0501268_005161_695_1168 | 157 |
| 523 | 3300050515 | nmdc:mga0a205_3422_c1 | nmdc:mga0a205_3422_c1_10245_10721 | 157 |
| 524 | 3300053134 | Ga0500658_0000044 | Ga0500658_0000044_12238_12711 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s0x-assembly2.cif.gz_B-2 | the crystal structure of gxgd membrane protease flak | 0.6654 | 8 | 157 |
| 3s0x-assembly2.cif.gz_B-2 | the crystal structure of gxgd membrane protease flak | 0.6372 | 8 | 157 |
| 7no6-assembly1.cif.gz_B | structure of the mature rsv ca lattice: group i, pentamer-hexamer interface, class 1 | 0.5636 | 85 | 150 |
| 3s0x-assembly1.cif.gz_A | the crystal structure of gxgd membrane protease flak | 0.5603 | 9 | 157 |
| 7no6-assembly1.cif.gz_C | structure of the mature rsv ca lattice: group i, pentamer-hexamer interface, class 1 | 0.5513 | 85 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25960_74_220_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7951 | 7 | 150 | 1.20.120.1220 |
| af_P25960_74_220_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7758 | 7 | 150 | 1.20.120.1220 |
| af_Q46836_122_264_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7278 | 1 | 148 | 1.20.120.1220 |
| af_Q46836_122_264_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7191 | 1 | 148 | 1.20.120.1220 |
| af_I6Y9M6_1_137_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.7096 | 12 | 150 | 1.20.120.1220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4SYE4-F1-model_v4 | Type IV prepilin peptidase TadV/CpaA | 0.9773 | 2 | 157 |
GO:0004190
GO:0016020 |
| AF-A0A838VJT4-F1-model_v4 | Prepilin peptidase | 0.977 | 6 | 152 |
GO:0004190
GO:0005886 |
| AF-A0A2P7QJ51-F1-model_v4 | Peptidase | 0.9714 | 7 | 157 |
GO:0004190
GO:0016020 |
| AF-A0A6J4TXI1-F1-model_v4 | Type IV prepilin peptidase TadV/CpaA | 0.968 | 2 | 157 |
GO:0004190
GO:0005886 GO:0006465 |
| AF-A0A6J4SYE4-F1-model_v4 | Type IV prepilin peptidase TadV/CpaA | 0.9651 | 2 | 157 |
GO:0004190
GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar