F459148

General Info

Members Datasets Scaffolds Average Seq Length
524 437 255 176

Family's Representative Sequence

Representative Sequence 3300027111|Ga0209281_1001243|Ga0209281_100124313
Length 187
Sequence MTEAEQKMTTRPKIVFVVAVAANGIIGREGDLPWRLSTDLKRFKALTIGKPVVMGRKTWASLGRPLPGRPNIVISRNPDFEAPGAEVAPSLETALTIARERAAAVGADEICIIGGGEIYRQSIGMADVLHVTEVQAEVDGDTRFPSIDPATFEKVMEEDLPRSEKDSHAMHFVTWRRRTPPPEGAGA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
16 2516143018 Ensifer sp. BR816 Isolate Nodule
17 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
18 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
19 2519899620 Rhizobium sp. Pop5 Isolate Nodule
20 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
21 2534681786 Brucella suis 92/29 Isolate Unclassified
22 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
23 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
24 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
25 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
26 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
27 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
28 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
29 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
30 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
31 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
32 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
33 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
34 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
35 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
36 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
37 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
38 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
39 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
40 2643221557 Ensifer sp. Root558 Isolate Unclassified
41 2643221599 Rhizobium sp. Root708 Isolate Unclassified
42 2643221610 Ensifer sp. Root74 Isolate Unclassified
43 2643221618 Ensifer sp. Root231 Isolate Unclassified
44 2643221626 Ensifer sp. Root31 Isolate Unclassified
45 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
46 2643221655 Ensifer sp. Root1252 Isolate Unclassified
47 2643221659 Ensifer sp. Root127 Isolate Unclassified
48 2643221668 Ensifer sp. Root423 Isolate Unclassified
49 2643221675 Ensifer sp. Root1298 Isolate Unclassified
50 2643221680 Ensifer sp. Root1312 Isolate Unclassified
51 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
52 2643221688 Rhizobium sp. Root482 Isolate Unclassified
53 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
54 2643221698 Ensifer sp. Root142 Isolate Unclassified
55 2643221712 Ensifer sp. Root258 Isolate Unclassified
56 2643221723 Ensifer sp. Root278 Isolate Unclassified
57 2643221726 Ensifer sp. Root954 Isolate Unclassified
58 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
59 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
60 2738541293 Rhizobium sp. GV031 Isolate Unclassified
61 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
62 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
63 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
64 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
65 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
66 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
67 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
68 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
69 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
70 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
71 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
72 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
73 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
74 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
75 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
76 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
77 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
78 2844163670 Ensifer sp. 1H6 Isolate Unclassified
79 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
80 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
81 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
82 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
83 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
84 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
85 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
86 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
87 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
88 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
89 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
90 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
91 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
92 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
93 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
94 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
95 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
96 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
97 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
98 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
99 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
100 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
101 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
102 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
103 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
104 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
105 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
106 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
107 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
108 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
109 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
110 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
111 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
112 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
113 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
114 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
115 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
116 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
117 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
118 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
119 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
120 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
121 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
122 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
123 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
124 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
125 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
126 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
127 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
128 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
129 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
130 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
131 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
132 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
133 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
134 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
135 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
136 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
137 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
138 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
139 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
140 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
141 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
142 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
143 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
144 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
145 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
146 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
147 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
148 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
149 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
150 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
151 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
152 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
153 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
154 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
155 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
156 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
157 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
158 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
159 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
160 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
161 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
162 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
163 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
164 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
165 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
166 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
167 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
168 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
169 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
170 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
171 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
172 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
173 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
174 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
175 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
176 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
177 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
178 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
179 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
180 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
181 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
182 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
183 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
184 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
185 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
186 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
187 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
188 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
189 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
190 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
191 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
192 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
193 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
194 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
195 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
196 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
197 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
198 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
199 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
200 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
201 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
202 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
203 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
204 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
205 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
206 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
207 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
208 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
209 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
210 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
211 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
212 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
213 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
214 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
215 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
216 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
217 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
218 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
219 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
220 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
221 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
222 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
223 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
224 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
225 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
226 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
227 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
228 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
229 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
230 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
231 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
232 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
233 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
234 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
235 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
236 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
237 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
238 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
239 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
240 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
241 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
242 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
243 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
244 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
245 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
246 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
247 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
248 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
249 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
250 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
251 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
252 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
253 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
254 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
255 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
256 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
257 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
258 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
259 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
260 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
261 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
262 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
263 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
264 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
265 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
266 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
267 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
268 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
269 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
270 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
271 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
272 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
273 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
274 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
275 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
276 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
277 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
278 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
279 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
280 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
281 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
282 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
283 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
284 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
285 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
286 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
287 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
288 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
289 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
290 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
291 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
292 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
293 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
294 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
295 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
296 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
297 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
298 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
299 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
300 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
301 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
302 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
303 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
304 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
307 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
308 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
309 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
310 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
311 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
312 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
313 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
314 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
315 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
316 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
317 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
318 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
319 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
320 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
321 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
322 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
324 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
325 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
327 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
329 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
332 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
346 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
348 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
350 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
351 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
352 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
353 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
354 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
355 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
356 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
357 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
358 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
359 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
360 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
361 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
362 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
363 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
364 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
365 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
366 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
367 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
368 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
369 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
370 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
371 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
372 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
373 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
374 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
375 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
376 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
377 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
378 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
379 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
380 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
385 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
386 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
389 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
390 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
391 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
415 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
418 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
421 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
422 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
423 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
424 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
425 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
428 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
429 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
430 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
431 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
432 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
433 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
434 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
435 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
436 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
437 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.47
Metatranscriptomes 0.19
Isolates 51.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.6
Nodule 43.32
Rhizoplane 4.39
Rhizosphere 24.24
Stem 0
Stem Tuber 0
Unclassified 15.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001554 3300002773 Bacteria 9740
2 JGI25150J39212_1000307 3300002774 Bacteria 24463
3 JGI25159J45721_1000040 3300002987 Bacteria 68143
4 JGI25151J46595_10000329 3300003187 Bacteria 51364
5 JGI25151J46595_10005257 3300003187 Bacteria 6713
6 JGI25406J46586_10083299 3300003203 Bacteria 977
7 JGI25153J46596_10026399 3300003215 Bacteria 2056
8 rootL2_10020315 3300003322 Unclassified 11080
9 JGI25160J50197_1000128 3300003354 Bacteria 68143
10 JGI25160J50197_1004590 3300003354 Bacteria 5944
11 JGI25161J50226_1000504 3300003374 Bacteria 17099
12 Ga0006562J51391_1023002 3300003578 Bacteria 2884
13 Ga0055526_1000675 3300003771 Bacteria 26151
14 Ga0055524_1013330 3300003775 Bacteria 3102
15 Ga0055524_1014716 3300003775 Unclassified 2885
16 Ga0055524_1036732 3300003775 Bacteria 1312
17 Ga0055536_1000853 3300003781 Bacteria 20033
18 Ga0055528_1008457 3300003790 Unclassified 4408
19 Ga0055530_10009853 3300003791 Bacteria 3608
20 Ga0055540_1011119 3300003792 Bacteria 2935
21 Ga0055531_10004447 3300003794 Bacteria 8527
22 Ga0055543_1000130 3300004625 Bacteria 62045
23 Ga0065165_1000013 3300005262 Bacteria 301887
24 Ga0070670_100002228 3300005331 Bacteria 15933
25 Ga0070680_100327069 3300005336 Bacteria 1302
26 Ga0070661_100949338 3300005344 Unclassified 712
27 Ga0070668_100150674 3300005347 Bacteria 1880
28 Ga0070671_100253231 3300005355 Bacteria 1496
29 Ga0070714_100028981 3300005435 Bacteria 4599
30 Ga0070663_100533833 3300005455 Bacteria 978
31 Ga0070663_100728416 3300005455 Bacteria 845
32 Ga0070681_10001659 3300005458 Bacteria 19883
33 Ga0070679_100374404 3300005530 Bacteria 1371
34 Ga0070665_100051595 3300005548 Bacteria 4125
35 Ga0068855_100032602 3300005563 Bacteria 6218
36 Ga0068855_100101357 3300005563 Bacteria 3315
37 Ga0070664_101399458 3300005564 Bacteria 661
38 Ga0068856_100020634 3300005614 Bacteria 6402
39 Ga0068852_101043268 3300005616 Bacteria 837
40 Ga0068863_100854587 3300005841 Bacteria 909
41 Ga0081455_10036332 3300005937 Bacteria 4388
42 Ga0081540_1168017 3300005983 Bacteria 840
43 Ga0081539_10001499 3300005985 Bacteria 39468
44 Ga0075369_10006052 3300006186 Bacteria 4560
45 Ga0075366_10522723 3300006195 Bacteria 734
46 Ga0075370_10116024 3300006353 Bacteria 1557
47 Ga0079104_1022348 3300006946 Bacteria 1703
48 Ga0105251_10013331 3300009011 Bacteria 4603
49 Ga0105243_11105881 3300009148 Bacteria 801
50 Ga0105248_10742386 3300009177 Bacteria 1107
51 Ga0105249_10127950 3300009553 Bacteria 2421
52 Ga0105249_10902529 3300009553 Bacteria 951
53 Ga0157373_10458322 3300013100 Bacteria 918
54 Ga0157370_10005492 3300013104 Bacteria 14218
55 Ga0171463_1003 3300013249 Bacteria 695693
56 Ga0157372_10132103 3300013307 Bacteria 2873
57 Ga0163163_10702449 3300014325 Bacteria 1075
58 Ga0157376_10717261 3300014969 Bacteria 1006
59 Ga0183363_1093 3300015690 Bacteria 25804
60 Ga0214544_1000161 3300021320 Bacteria 101808
61 Ga0214542_1000012 3300021321 Bacteria 235800
62 Ga0214542_1023729 3300021321 Bacteria 3593
63 Ga0214543_1000024 3300021327 Bacteria 235745
64 Ga0214543_1000038 3300021327 Bacteria 182106
65 Ga0228711_1000008 3300022739 Bacteria 169893
66 Ga0228710_1000009 3300022740 Bacteria 169770
67 Ga0209436_100194 3300025208 Bacteria 28386
68 Ga0207425_1000024 3300025245 Bacteria 328978
69 Ga0207425_1031597 3300025245 Bacteria 1053
70 Ga0209129_1000146 3300025258 Bacteria 115180
71 Ga0209129_1002468 3300025258 Bacteria 9046
72 Ga0209565_1051123 3300025263 Bacteria 741
73 Ga0209673_1011034 3300025273 Bacteria 3757
74 Ga0209673_1016936 3300025273 Bacteria 2704
75 Ga0209673_1047776 3300025273 Bacteria 1158
76 Ga0209130_1000034 3300025284 Bacteria 302439
77 Ga0209130_1026677 3300025284 Bacteria 1236
78 Ga0209130_1033723 3300025284 Bacteria 1035
79 Ga0209676_1001758 3300025292 Bacteria 18389
80 Ga0209025_1000050 3300025294 Bacteria 331531
81 Ga0209025_1000314 3300025294 Bacteria 107720
82 Ga0209025_1011126 3300025294 Bacteria 5987
83 Ga0209025_1049408 3300025294 Bacteria 1693
84 Ga0209564_1000013 3300025295 Bacteria 775755
85 Ga0209564_1006200 3300025295 Bacteria 6537
86 Ga0209564_1034303 3300025295 Bacteria 1490
87 Ga0209758_1000083 3300025297 Bacteria 257283
88 Ga0209050_1003728 3300025298 Bacteria 10962
89 Ga0209256_1001430 3300025299 Bacteria 24732
90 Ga0209256_1001510 3300025299 Bacteria 23567
91 Ga0209256_1002653 3300025299 Bacteria 14067
92 Ga0209256_1007982 3300025299 Bacteria 5037
93 Ga0209256_1043912 3300025299 Bacteria 1119
94 Ga0207426_1000006 3300025302 Bacteria 1025969
95 Ga0207426_1002432 3300025302 Bacteria 11903
96 Ga0209051_1002141 3300025303 Bacteria 14692
97 Ga0209257_1003795 3300025304 Bacteria 12447
98 Ga0207713_1088953 3300025735 Bacteria 1090
99 Ga0207660_10074024 3300025917 Bacteria 2485
100 Ga0207650_10005240 3300025925 Bacteria 8839
101 Ga0207664_10029022 3300025929 Bacteria 4211
102 Ga0207644_10251768 3300025931 Bacteria 1409
103 Ga0207679_10543339 3300025945 Bacteria 1042
104 Ga0207667_10067857 3300025949 Bacteria 3715
105 Ga0207667_10083219 3300025949 Bacteria 3313
106 Ga0207712_10400171 3300025961 Bacteria 1154
107 Ga0207668_10227293 3300025972 Bacteria 1502
108 Ga0207678_10041534 3300026067 Bacteria 3988
109 Ga0207698_10902559 3300026142 Bacteria 891
110 Ga0209281_1000106 3300027111 Bacteria 219666
111 Ga0209281_1001243 3300027111 Bacteria 16710
112 Ga0209371_1058231 3300027312 Bacteria 717
113 Ga0209282_1000024 3300027666 Bacteria 170348
114 Ga0268266_10102385 3300028379 Bacteria 2526
115 Ga0307515_10000788 3300028794 Bacteria 72975
116 Ga0268256_1065375 3300030500 Bacteria 717
117 Ga0307513_10003732 3300031456 Bacteria 20589
118 Ga0307408_100218617 3300031548 Bacteria 1553
119 Ga0307514_10122407 3300031649 Bacteria 1811
120 Ga0307405_10072875 3300031731 Bacteria 2215
121 Ga0307412_10210912 3300031911 Bacteria 1482
122 Ga0315914_1000012 3300031967 Bacteria 169896
123 Ga0307409_100071262 3300031995 Bacteria 2763
124 Ga0307409_101465081 3300031995 Bacteria 710
125 Ga0315913_1000006 3300033430 Bacteria 169893
126 Ga0315915_1000010 3300033464 Bacteria 240214
127 Ga0373927_0003658 3300035695 Bacteria 10956
128 Ga0373925_0004759 3300037068 Bacteria 10224
129 Ga0395900_0230646 3300037418 Bacteria 1862
130 Ga0395898_0140310 3300037466 Bacteria 2313
131 Ga0395901_0199698 3300038443 Bacteria 2096
132 Ga0439436_0030747 3300041404 Bacteria 1560
133 Ga0439436_0071789 3300041404 Bacteria 965
134 Ga0439436_0076414 3300041404 Bacteria 933
135 Ga0439438_045929 3300041405 Bacteria 1123
136 Ga0439439_0136813 3300041406 Bacteria 690
137 Ga0439465_0089228 3300041413 Bacteria 1053
138 Ga0439465_0258021 3300041413 Bacteria 646
139 Ga0451791_1375656 3300041451 Bacteria 822
140 Ga0451798_1063747 3300041458 Bacteria 628
141 Ga0451833_1187501 3300041491 Bacteria 645
142 Ga0439449_0002827 3300042007 Bacteria 6751
143 Ga0466967_0603711 3300045976 Bacteria 1083
144 Ga0495638_0014151 3300046460 Bacteria 5401
145 Ga0495650_0019347 3300046471 Bacteria 3355
146 Ga0495606_0116647 3300046507 Bacteria 1603
147 Ga0495588_0186486 3300046674 Bacteria 1096
148 Ga0496100_0306853 3300048903 Bacteria 1189
149 Ga0496100_0425828 3300048903 Bacteria 1014
150 Ga0496100_0428414 3300048903 Bacteria 1011
151 Ga0496101_0069406 3300048904 Bacteria 2578
152 Ga0496101_0260915 3300048904 Bacteria 1351
153 Ga0496102_0135610 3300048905 Bacteria 2306
154 Ga0496104_0237214 3300048907 Bacteria 1735
155 Ga0496105_0086223 3300048908 Bacteria 2594
156 Ga0496106_0525636 3300048909 Bacteria 950
157 Ga0496107_0192796 3300048910 Bacteria 1514
158 Ga0496108_0313298 3300048911 Bacteria 1367
159 Ga0496109_0557931 3300048912 Bacteria 1080
160 Ga0496110_0559078 3300048913 Bacteria 1039
161 Ga0496111_0234004 3300048914 Bacteria 1364
162 Ga0496112_0105085 3300048915 Bacteria 2794
163 Ga0496113_0237601 3300048916 Bacteria 1453
164 Ga0496114_0013533 3300048917 Bacteria 6544
165 Ga0496114_0068048 3300048917 Bacteria 2989
166 Ga0496116_0001751 3300048919 Bacteria 23646
167 Ga0496116_0085683 3300048919 Bacteria 1935
168 Ga0496116_0110163 3300048919 Bacteria 1620
169 Ga0496116_0152093 3300048919 Bacteria 1283
170 Ga0496117_0002529 3300048920 Bacteria 22887
171 Ga0496117_0016915 3300048920 Bacteria 6116
172 Ga0496117_0376839 3300048920 Bacteria 724
173 Ga0496119_0145468 3300048922 Bacteria 1275
174 Ga0496121_0020270 3300048924 Bacteria 6592
175 Ga0496121_0170367 3300048924 Bacteria 1582
176 Ga0496121_0408189 3300048924 Bacteria 887
177 Ga0496122_0000190 3300048925 Bacteria 140376
178 Ga0496122_0008170 3300048925 Bacteria 11380
179 Ga0496122_0062866 3300048925 Bacteria 2714
180 Ga0496122_0189597 3300048925 Bacteria 1215
181 Ga0496123_0001016 3300048926 Bacteria 42813
182 Ga0496123_0024026 3300048926 Bacteria 4647
183 Ga0496123_0109510 3300048926 Bacteria 1582
184 Ga0496123_0113420 3300048926 Bacteria 1543
185 Ga0496124_0010846 3300048927 Bacteria 9175
186 Ga0496124_0148412 3300048927 Bacteria 1842
187 Ga0496124_0188166 3300048927 Bacteria 1582
188 Ga0496124_0208851 3300048927 Bacteria 1479
189 Ga0496124_0348818 3300048927 Bacteria 1048
190 Ga0496124_0449981 3300048927 Bacteria 878
191 Ga0496125_0000273 3300048928 Bacteria 104663
192 Ga0496125_0048718 3300048928 Bacteria 3530
193 Ga0496125_0128706 3300048928 Bacteria 1787
194 Ga0496126_0000589 3300048929 Bacteria 68753
195 Ga0496126_0009857 3300048929 Bacteria 10109
196 Ga0496126_0160823 3300048929 Bacteria 1919
197 Ga0496126_0324182 3300048929 Bacteria 1265
198 Ga0501031_0000018 3300049568 Bacteria 106734
199 Ga0501031_0013742 3300049568 Bacteria 5277
200 Ga0501031_0016685 3300049568 Bacteria 4770
201 Ga0501032_0000003 3300049569 Bacteria 317700
202 Ga0501032_0000219 3300049569 Bacteria 47451
203 Ga0501032_0158306 3300049569 Bacteria 1487
204 Ga0501033_0000126 3300049570 Bacteria 74250
205 Ga0501033_0000132 3300049570 Bacteria 72558
206 Ga0501033_0093149 3300049570 Bacteria 2203
207 Ga0501034_0000005 3300049571 Bacteria 367512
208 Ga0501034_0006083 3300049571 Bacteria 13028
209 Ga0501034_0007278 3300049571 Bacteria 11800
210 Ga0501034_0084248 3300049571 Bacteria 3181
211 Ga0501034_0617224 3300049571 Bacteria 988
212 Ga0501036_0000005 3300049572 Bacteria 246420
213 Ga0501036_0022711 3300049572 Bacteria 5280
214 Ga0501036_0472867 3300049572 Bacteria 1044
215 Ga0501037_0000021 3300049573 Bacteria 150037
216 Ga0501037_0000045 3300049573 Bacteria 117148
217 Ga0501037_0010771 3300049573 Bacteria 6719
218 Ga0501038_0000001 3300049574 Bacteria 375481
219 Ga0501038_0000032 3300049574 Bacteria 131432
220 Ga0501038_0096080 3300049574 Bacteria 2474
221 Ga0501039_0000007 3300049575 Bacteria 277831
222 Ga0501039_0000025 3300049575 Bacteria 152236
223 Ga0501040_0078896 3300049576 Bacteria 2278
224 Ga0501042_0109031 3300049578 Bacteria 1993
225 Ga0501043_0000333 3300049579 Bacteria 42740
226 Ga0501043_0000575 3300049579 Bacteria 32805
227 Ga0501043_0048378 3300049579 Bacteria 3343
228 Ga0501046_0295741 3300049580 Bacteria 1183
229 Ga0501047_0000708 3300049581 Bacteria 34744
230 Ga0501047_1108233 3300049581 Bacteria 605
231 Ga0501070_0012303 3300049586 Bacteria 7222
232 Ga0501070_0277680 3300049586 Bacteria 1367
233 Ga0501035_0000008 3300049822 Bacteria 313425
234 Ga0501035_0000085 3300049822 Bacteria 116189
235 Ga0501035_0024843 3300049822 Bacteria 5494
236 Ga0501044_0000001 3300049823 Bacteria 418087
237 Ga0501044_0018565 3300049823 Bacteria 7452
238 Ga0501044_0032398 3300049823 Bacteria 5495
239 Ga0501045_0222550 3300049824 Bacteria 1405
240 nmdc:mga0yw44_145217_c1 3300050492 Bacteria 1544
241 nmdc:mga0yw44_431362_c1 3300050492 Bacteria 893
242 nmdc:mga06r32_1565608_c1 3300050510 Bacteria 598
243 nmdc:mga08y16_455344_c1 3300050511 Bacteria 1304
244 nmdc:mga0sz30_123471_c1 3300050516 Bacteria 1139
245 Ga0500644_0107050 3300053088 Bacteria 1071
246 Ga0500556_0085790 3300053104 Bacteria 1196
247 Ga0500560_158379 3300053107 Bacteria 750
248 Ga0500608_102676 3300053122 Bacteria 1322
249 Ga0500608_147902 3300053122 Bacteria 1033
250 Ga0500559_0347923 3300053136 Bacteria 693
251 Ga0500568_0000017 3300053139 Bacteria 197578
252 Ga0500616_0082511 3300053153 Bacteria 1612
253 Ga0500622_0001250 3300053156 Bacteria 20781
254 Ga0501084_1249495 3300054114 Bacteria 623
255 Ga0501082_0042344 3300060353 Bacteria 3926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041458 Ga0451798_1063747 Ga0451798_1063747_153_584 139
2 3300050511 nmdc:mga08y16_455344_c1 nmdc:mga08y16_455344_c1_813_1259 139
3 iso_pu_bacteria 2964670856 2964672365 142
4 3300006946 Ga0079104_1022348 Ga0079104_10223482 145
5 3300022739 Ga0228711_1000008 Ga0228711_1000008107 145
6 3300022740 Ga0228710_1000009 Ga0228710_1000009106 145
7 3300027111 Ga0209281_1000106 Ga0209281_1000106124 145
8 3300027666 Ga0209282_1000024 Ga0209282_100002455 145
9 3300031967 Ga0315914_1000012 Ga0315914_1000012107 145
10 3300033430 Ga0315913_1000006 Ga0315913_1000006106 145
11 3300033464 Ga0315915_1000010 Ga0315915_1000010157 145
12 3300041491 Ga0451833_1187501 Ga0451833_1187501_16_501 147
13 3300021320 Ga0214544_1000161 Ga0214544_100016136 158
14 3300021321 Ga0214542_1000012 Ga0214542_1000012146 158
15 3300021327 Ga0214543_1000024 Ga0214543_1000024147 158
16 3300037418 Ga0395900_0230646 Ga0395900_0230646_1345_1836 161
17 3300038443 Ga0395901_0199698 Ga0395901_0199698_490_981 161
18 iso_pu_bacteria 2511231027 2511389791 162
19 iso_pu_bacteria 2842871566 2842871889 162
20 iso_pu_bacteria 2894652903 2894656050 162
21 iso_pu_bacteria 2928521798 2928523820 162
22 3300005344 Ga0070661_100949338 Ga0070661_1009493382 163
23 3300005435 Ga0070714_100028981 Ga0070714_1000289814 163
24 3300005458 Ga0070681_10001659 Ga0070681_1000165918 163
25 3300005563 Ga0068855_100032602 Ga0068855_1000326026 163
26 3300005614 Ga0068856_100020634 Ga0068856_10002063410 163
27 3300025929 Ga0207664_10029022 Ga0207664_100290224 163
28 3300025949 Ga0207667_10067857 Ga0207667_100678572 163
29 iso_pu_bacteria 2996310559 2996313976 163
30 3300005336 Ga0070680_100327069 Ga0070680_1003270692 164
31 3300005530 Ga0070679_100374404 Ga0070679_1003744041 164
32 3300005563 Ga0068855_100101357 Ga0068855_1001013572 164
33 3300005616 Ga0068852_101043268 Ga0068852_1010432682 164
34 3300013100 Ga0157373_10458322 Ga0157373_104583222 164
35 3300013104 Ga0157370_10005492 Ga0157370_100054927 164
36 3300013307 Ga0157372_10132103 Ga0157372_101321035 164
37 3300025917 Ga0207660_10074024 Ga0207660_100740243 164
38 3300025949 Ga0207667_10083219 Ga0207667_100832194 164
39 3300026142 Ga0207698_10902559 Ga0207698_109025592 164
40 3300045976 Ga0466967_0603711 Ga0466967_0603711_124_627 164
41 iso_pu_bacteria 2558860983 2561468999 164
42 3300009148 Ga0105243_11105881 Ga0105243_111058812 165
43 3300050510 nmdc:mga06r32_1565608_c1 nmdc:mga06r32_1565608_c1_63_572 165
44 3300005937 Ga0081455_10036332 Ga0081455_100363329 166
45 3300009553 Ga0105249_10902529 Ga0105249_109025291 166
46 3300014969 Ga0157376_10717261 Ga0157376_107172612 166
47 3300025294 Ga0209025_1049408 Ga0209025_10494082 166
48 iso_pu_bacteria 2519899620 2520378011 166
49 iso_pu_bacteria 2534681786 2535485100 166
50 iso_pu_bacteria 2582581283 2585166291 166
51 iso_pu_bacteria 2582581306 2585267496 166
52 iso_pu_bacteria 2582581865 2585386561 166
53 iso_pu_bacteria 2585427594 2585843109 166
54 iso_pu_bacteria 2599185156 2599331706 166
55 iso_pu_bacteria 2643221599 2644003216 166
56 iso_pu_bacteria 2643221636 2644205051 166
57 iso_pu_bacteria 2643221686 2644483495 166
58 iso_pu_bacteria 2643221688 2644491980 166
59 iso_pu_bacteria 2643221689 2644499701 166
60 iso_pu_bacteria 2738541293 2738800022 166
61 iso_pu_bacteria 2842922631 2842924111 166
62 iso_pu_bacteria 2891373044 2891373279 166
63 iso_pu_bacteria 2989349275 2989349579 166
64 iso_pu_bacteria 3003930520 3003933960 166
65 iso_pu_bacteria 3005452660 3005454573 166
66 iso_pu_bacteria 8046767195 8046771609 166
67 3300003203 JGI25406J46586_10083299 JGI25406J46586_100832992 167
68 3300005455 Ga0070663_100728416 Ga0070663_1007284162 167
69 3300005548 Ga0070665_100051595 Ga0070665_1000515954 167
70 3300005983 Ga0081540_1168017 Ga0081540_11680172 167
71 3300005985 Ga0081539_10001499 Ga0081539_1000149911 167
72 3300006195 Ga0075366_10522723 Ga0075366_105227231 167
73 3300028379 Ga0268266_10102385 Ga0268266_101023853 167
74 3300031649 Ga0307514_10122407 Ga0307514_101224074 167
75 3300031995 Ga0307409_101465081 Ga0307409_1014650811 167
76 3300041413 Ga0439465_0089228 Ga0439465_0089228_474_995 167
77 3300041451 Ga0451791_1375656 Ga0451791_1375656_242_763 167
78 3300046460 Ga0495638_0014151 Ga0495638_0014151_2548_3078 167
79 3300049568 Ga0501031_0000018 Ga0501031_0000018_39918_40439 167
80 3300049569 Ga0501032_0000003 Ga0501032_0000003_300578_301099 167
81 3300049570 Ga0501033_0000132 Ga0501033_0000132_50924_51445 167
82 3300049570 Ga0501033_0093149 Ga0501033_0093149_38_562 167
83 3300049571 Ga0501034_0000005 Ga0501034_0000005_300578_301099 167
84 3300049571 Ga0501034_0007278 Ga0501034_0007278_10389_10919 167
85 3300049572 Ga0501036_0000005 Ga0501036_0000005_179446_179967 167
86 3300049573 Ga0501037_0000045 Ga0501037_0000045_50325_50846 167
87 3300049574 Ga0501038_0000001 Ga0501038_0000001_300578_301099 167
88 3300049575 Ga0501039_0000007 Ga0501039_0000007_196076_196597 167
89 3300049576 Ga0501040_0078896 Ga0501040_0078896_987_1508 167
90 3300049579 Ga0501043_0000333 Ga0501043_0000333_19160_19681 167
91 3300049581 Ga0501047_0000708 Ga0501047_0000708_13886_14407 167
92 3300049586 Ga0501070_0012303 Ga0501070_0012303_1241_1762 167
93 3300049586 Ga0501070_0277680 Ga0501070_0277680_518_1039 167
94 3300049822 Ga0501035_0000008 Ga0501035_0000008_246457_246978 167
95 3300049823 Ga0501044_0000001 Ga0501044_0000001_116989_117510 167
96 3300050492 nmdc:mga0yw44_145217_c1 nmdc:mga0yw44_145217_c1_566_1096 167
97 3300053088 Ga0500644_0107050 Ga0500644_0107050_151_669 167
98 3300053104 Ga0500556_0085790 Ga0500556_0085790_306_818 167
99 3300053122 Ga0500608_147902 Ga0500608_147902_118_642 167
100 3300053136 Ga0500559_0347923 Ga0500559_0347923_72_584 167
101 3300053139 Ga0500568_0000017 Ga0500568_0000017_35190_35720 167
102 3300053153 Ga0500616_0082511 Ga0500616_0082511_777_1289 167
103 3300053156 Ga0500622_0001250 Ga0500622_0001250_6212_6736 167
104 iso_pu_bacteria 2582581294 2585200548 167
105 iso_pu_bacteria 2855825444 2855826285 167
106 iso_pu_bacteria 2855839649 2855841630 167
107 iso_pu_bacteria 2858800743 2858801746 167
108 iso_pu_bacteria 2915986958 2915989436 167
109 iso_pu_bacteria 2915993759 2915998100 167
110 iso_pu_bacteria 2916000859 2916006875 167
111 iso_pu_bacteria 2916007675 2916013833 167
112 iso_pu_bacteria 2916014648 2916017565 167
113 iso_pu_bacteria 2916021584 2916025064 167
114 iso_pu_bacteria 2916028427 2916029200 167
115 iso_pu_bacteria 2916035215 2916041642 167
116 iso_pu_bacteria 2916041962 2916044028 167
117 iso_pu_bacteria 2916048683 2916054209 167
118 iso_pu_bacteria 2916055098 2916061723 167
119 iso_pu_bacteria 2916068649 2916070348 167
120 iso_pu_bacteria 2916076590 2916077778 167
121 iso_pu_bacteria 2921201388 2921205145 167
122 iso_pu_bacteria 2921208531 2921214531 167
123 iso_pu_bacteria 2921237296 2921239578 167
124 iso_pu_bacteria 2921244191 2921245417 167
125 iso_pu_bacteria 2921257292 2921261242 167
126 iso_pu_bacteria 2921263974 2921264447 167
127 iso_pu_bacteria 2921282425 2921285880 167
128 iso_pu_bacteria 2921289301 2921289433 167
129 iso_pu_bacteria 2921296804 2921302071 167
130 iso_pu_bacteria 2924144063 2924148418 167
131 iso_pu_bacteria 2924150972 2924158046 167
132 iso_pu_bacteria 2924158325 2924159220 167
133 iso_pu_bacteria 2924165586 2924166743 167
134 iso_pu_bacteria 2924172951 2924174335 167
135 iso_pu_bacteria 2924179722 2924183733 167
136 iso_pu_bacteria 2924193448 2924197971 167
137 iso_pu_bacteria 2924200457 2924204733 167
138 iso_pu_bacteria 2924207177 2924211479 167
139 iso_pu_bacteria 2924214083 2924215742 167
140 iso_pu_bacteria 2924221636 2924225761 167
141 iso_pu_bacteria 2924228884 2924233042 167
142 iso_pu_bacteria 2757320392 2757569682 168
143 3300002774 JGI25150J39212_1000307 JGI25150J39212_10003072 170
144 3300002987 JGI25159J45721_1000040 JGI25159J45721_100004069 170
145 3300003187 JGI25151J46595_10000329 JGI25151J46595_100003292 170
146 3300003187 JGI25151J46595_10005257 JGI25151J46595_100052577 170
147 3300003215 JGI25153J46596_10026399 JGI25153J46596_100263992 170
148 3300003354 JGI25160J50197_1000128 JGI25160J50197_100012812 170
149 3300003374 JGI25161J50226_1000504 JGI25161J50226_100050413 170
150 3300003578 Ga0006562J51391_1023002 Ga0006562J51391_10230021 170
151 3300003771 Ga0055526_1000675 Ga0055526_10006752 170
152 3300003775 Ga0055524_1013330 Ga0055524_10133304 170
153 3300003775 Ga0055524_1036732 Ga0055524_10367322 170
154 3300003781 Ga0055536_1000853 Ga0055536_100085311 170
155 3300003791 Ga0055530_10009853 Ga0055530_100098535 170
156 3300003792 Ga0055540_1011119 Ga0055540_10111193 170
157 3300003794 Ga0055531_10004447 Ga0055531_100044472 170
158 3300004625 Ga0055543_1000130 Ga0055543_100013066 170
159 3300005262 Ga0065165_1000013 Ga0065165_1000013230 170
160 3300005331 Ga0070670_100002228 Ga0070670_10000222812 170
161 3300005564 Ga0070664_101399458 Ga0070664_1013994581 170
162 3300013249 Ga0171463_1003 Ga0171463_1003227 170
163 3300015690 Ga0183363_1093 Ga0183363_10939 170
164 3300021321 Ga0214542_1023729 Ga0214542_10237293 170
165 3300021327 Ga0214543_1000038 Ga0214543_1000038125 170
166 3300025208 Ga0209436_100194 Ga0209436_10019413 170
167 3300025245 Ga0207425_1000024 Ga0207425_1000024303 170
168 3300025258 Ga0209129_1000146 Ga0209129_100014699 170
169 3300025263 Ga0209565_1051123 Ga0209565_10511232 170
170 3300025273 Ga0209673_1011034 Ga0209673_10110343 170
171 3300025273 Ga0209673_1047776 Ga0209673_10477761 170
172 3300025284 Ga0209130_1000034 Ga0209130_1000034225 170
173 3300025284 Ga0209130_1026677 Ga0209130_10266771 170
174 3300025292 Ga0209676_1001758 Ga0209676_100175811 170
175 3300025294 Ga0209025_1000050 Ga0209025_100005024 170
176 3300025294 Ga0209025_1000314 Ga0209025_100031486 170
177 3300025295 Ga0209564_1000013 Ga0209564_1000013223 170
178 3300025297 Ga0209758_1000083 Ga0209758_1000083233 170
179 3300025298 Ga0209050_1003728 Ga0209050_10037283 170
180 3300025299 Ga0209256_1001430 Ga0209256_10014304 170
181 3300025299 Ga0209256_1002653 Ga0209256_10026534 170
182 3300025299 Ga0209256_1043912 Ga0209256_10439121 170
183 3300025302 Ga0207426_1000006 Ga0207426_1000006598 170
184 3300025303 Ga0209051_1002141 Ga0209051_100214112 170
185 3300025304 Ga0209257_1003795 Ga0209257_100379515 170
186 3300025925 Ga0207650_10005240 Ga0207650_100052407 170
187 3300025945 Ga0207679_10543339 Ga0207679_105433392 170
188 3300027111 Ga0209281_1001243 Ga0209281_100124313 170
189 3300027312 Ga0209371_1058231 Ga0209371_10582311 170
190 3300028794 Ga0307515_10000788 Ga0307515_1000078849 170
191 3300030500 Ga0268256_1065375 Ga0268256_10653751 170
192 3300031456 Ga0307513_10003732 Ga0307513_1000373213 170
193 3300031548 Ga0307408_100218617 Ga0307408_1002186171 170
194 3300031731 Ga0307405_10072875 Ga0307405_100728752 170
195 3300031911 Ga0307412_10210912 Ga0307412_102109122 170
196 3300031995 Ga0307409_100071262 Ga0307409_1000712622 170
197 3300035695 Ga0373927_0003658 Ga0373927_0003658_880_1407 170
198 3300037068 Ga0373925_0004759 Ga0373925_0004759_3679_4206 170
199 3300037466 Ga0395898_0140310 Ga0395898_0140310_942_1475 170
200 3300041404 Ga0439436_0030747 Ga0439436_0030747_210_749 170
201 3300041404 Ga0439436_0071789 Ga0439436_0071789_190_726 170
202 3300041404 Ga0439436_0076414 Ga0439436_0076414_263_799 170
203 3300041405 Ga0439438_045929 Ga0439438_045929_343_882 170
204 3300041406 Ga0439439_0136813 Ga0439439_0136813_34_573 170
205 3300041413 Ga0439465_0258021 Ga0439465_0258021_56_619 170
206 3300042007 Ga0439449_0002827 Ga0439449_0002827_1625_2188 170
207 3300046471 Ga0495650_0019347 Ga0495650_0019347_1997_2512 170
208 3300046507 Ga0495606_0116647 Ga0495606_0116647_939_1451 170
209 3300046674 Ga0495588_0186486 Ga0495588_0186486_225_749 170
210 3300048903 Ga0496100_0306853 Ga0496100_0306853_328_840 170
211 3300048903 Ga0496100_0428414 Ga0496100_0428414_178_690 170
212 3300048904 Ga0496101_0260915 Ga0496101_0260915_694_1206 170
213 3300048917 Ga0496114_0068048 Ga0496114_0068048_1043_1555 170
214 3300048919 Ga0496116_0001751 Ga0496116_0001751_8963_9475 170
215 3300048919 Ga0496116_0110163 Ga0496116_0110163_219_731 170
216 3300048919 Ga0496116_0152093 Ga0496116_0152093_665_1177 170
217 3300048920 Ga0496117_0002529 Ga0496117_0002529_5801_6322 170
218 3300048920 Ga0496117_0016915 Ga0496117_0016915_802_1314 170
219 3300048924 Ga0496121_0020270 Ga0496121_0020270_5229_5741 170
220 3300048924 Ga0496121_0170367 Ga0496121_0170367_852_1364 170
221 3300048925 Ga0496122_0000190 Ga0496122_0000190_53039_53560 170
222 3300048925 Ga0496122_0008170 Ga0496122_0008170_1097_1609 170
223 3300048925 Ga0496122_0189597 Ga0496122_0189597_485_997 170
224 3300048926 Ga0496123_0001016 Ga0496123_0001016_37905_38426 170
225 3300048926 Ga0496123_0109510 Ga0496123_0109510_219_731 170
226 3300048926 Ga0496123_0113420 Ga0496123_0113420_219_731 170
227 3300048927 Ga0496124_0010846 Ga0496124_0010846_5097_5618 170
228 3300048927 Ga0496124_0188166 Ga0496124_0188166_219_731 170
229 3300048927 Ga0496124_0208851 Ga0496124_0208851_536_1057 170
230 3300048927 Ga0496124_0348818 Ga0496124_0348818_380_904 170
231 3300048927 Ga0496124_0449981 Ga0496124_0449981_219_731 170
232 3300048928 Ga0496125_0000273 Ga0496125_0000273_62146_62667 170
233 3300048928 Ga0496125_0128706 Ga0496125_0128706_219_731 170
234 3300048929 Ga0496126_0000589 Ga0496126_0000589_49261_49782 170
235 3300048929 Ga0496126_0009857 Ga0496126_0009857_8344_8865 170
236 3300048929 Ga0496126_0160823 Ga0496126_0160823_579_1091 170
237 3300049568 Ga0501031_0013742 Ga0501031_0013742_3043_3564 170
238 3300049568 Ga0501031_0016685 Ga0501031_0016685_3838_4374 170
239 3300049569 Ga0501032_0000219 Ga0501032_0000219_22923_23459 170
240 3300049569 Ga0501032_0158306 Ga0501032_0158306_123_644 170
241 3300049570 Ga0501033_0000126 Ga0501033_0000126_50808_51344 170
242 3300049571 Ga0501034_0006083 Ga0501034_0006083_4182_4718 170
243 3300049571 Ga0501034_0084248 Ga0501034_0084248_356_877 170
244 3300049571 Ga0501034_0617224 Ga0501034_0617224_299_820 170
245 3300049572 Ga0501036_0022711 Ga0501036_0022711_4164_4700 170
246 3300049572 Ga0501036_0472867 Ga0501036_0472867_130_651 170
247 3300049573 Ga0501037_0000021 Ga0501037_0000021_42144_42680 170
248 3300049573 Ga0501037_0010771 Ga0501037_0010771_2229_2750 170
249 3300049574 Ga0501038_0000032 Ga0501038_0000032_23865_24401 170
250 3300049574 Ga0501038_0096080 Ga0501038_0096080_341_862 170
251 3300049575 Ga0501039_0000025 Ga0501039_0000025_38134_38670 170
252 3300049578 Ga0501042_0109031 Ga0501042_0109031_1033_1572 170
253 3300049579 Ga0501043_0000575 Ga0501043_0000575_4177_4713 170
254 3300049579 Ga0501043_0048378 Ga0501043_0048378_31_552 170
255 3300049580 Ga0501046_0295741 Ga0501046_0295741_132_668 170
256 3300049581 Ga0501047_1108233 Ga0501047_1108233_67_588 170
257 3300049822 Ga0501035_0000085 Ga0501035_0000085_4176_4712 170
258 3300049822 Ga0501035_0024843 Ga0501035_0024843_3074_3595 170
259 3300049823 Ga0501044_0018565 Ga0501044_0018565_2441_2962 170
260 3300049823 Ga0501044_0032398 Ga0501044_0032398_791_1327 170
261 3300049824 Ga0501045_0222550 Ga0501045_0222550_724_1245 170
262 3300053107 Ga0500560_158379 Ga0500560_158379_161_685 170
263 3300053122 Ga0500608_102676 Ga0500608_102676_697_1209 170
264 3300054114 Ga0501084_1249495 Ga0501084_1249495_77_598 170
265 3300060353 Ga0501082_0042344 Ga0501082_0042344_1671_2219 170
266 iso_pu_bacteria 2508501122 2509111307 170
267 iso_pu_bacteria 2509276019 2509376413 170
268 iso_pu_bacteria 2510065057 2510304410 170
269 iso_pu_bacteria 2511231052 2511502184 170
270 iso_pu_bacteria 2512047086 2512533562 170
271 iso_pu_bacteria 2512875026 2512970764 170
272 iso_pu_bacteria 2513237086 2513588092 170
273 iso_pu_bacteria 2513237089 2513604193 170
274 iso_pu_bacteria 2513237091 2513617963 170
275 iso_pu_bacteria 2513237140 2513885525 170
276 iso_pu_bacteria 2513237143 2513903301 170
277 iso_pu_bacteria 2513237156 2513985336 170
278 iso_pu_bacteria 2513237160 2514006458 170
279 iso_pu_bacteria 2515154107 2515608963 170
280 iso_pu_bacteria 2516143018 2516204093 170
281 iso_pu_bacteria 2516653046 2516893563 170
282 iso_pu_bacteria 2517487022 2517570265 170
283 iso_pu_bacteria 2524023207 2524448613 170
284 iso_pu_bacteria 2551306084 2551674602 170
285 iso_pu_bacteria 2551306084 2551675816 170
286 iso_pu_bacteria 2551306085 2551684196 170
287 iso_pu_bacteria 2551306086 2551694572 170
288 iso_pu_bacteria 2551306087 2551703349 170
289 iso_pu_bacteria 2551306089 2551708434 170
290 iso_pu_bacteria 2551306090 2551723921 170
291 iso_pu_bacteria 2551306091 2551724816 170
292 iso_pu_bacteria 2551306092 2551737541 170
293 iso_pu_bacteria 2551306093 2551746457 170
294 iso_pu_bacteria 2558860100 2558867761 170
295 iso_pu_bacteria 2558860100 2558868424 170
296 iso_pu_bacteria 2599185352 2600194327 170
297 iso_pu_bacteria 2643221557 2643803153 170
298 iso_pu_bacteria 2643221610 2644063514 170
299 iso_pu_bacteria 2643221618 2644107347 170
300 iso_pu_bacteria 2643221626 2644150914 170
301 iso_pu_bacteria 2643221655 2644308742 170
302 iso_pu_bacteria 2643221659 2644335559 170
303 iso_pu_bacteria 2643221668 2644374798 170
304 iso_pu_bacteria 2643221675 2644414277 170
305 iso_pu_bacteria 2643221680 2644447805 170
306 iso_pu_bacteria 2643221698 2644539965 170
307 iso_pu_bacteria 2643221712 2644614683 170
308 iso_pu_bacteria 2643221723 2644676145 170
309 iso_pu_bacteria 2643221726 2644690278 170
310 iso_pu_bacteria 2657244999 2657681507 170
311 iso_pu_bacteria 2690316117 2692315595 170
312 iso_pu_bacteria 2738541317 2738948848 170
313 iso_pu_bacteria 2751185821 2753461974 170
314 iso_pu_bacteria 2791355082 2792585183 170
315 iso_pu_bacteria 2791355091 2792620832 170
316 iso_pu_bacteria 2791355092 2792626192 170
317 iso_pu_bacteria 2791355094 2792639129 170
318 iso_pu_bacteria 2802428858 2802719960 170
319 iso_pu_bacteria 2802428859 2802727107 170
320 iso_pu_bacteria 2802428860 2802731890 170
321 iso_pu_bacteria 2802428861 2802739221 170
322 iso_pu_bacteria 2802428862 2802745798 170
323 iso_pu_bacteria 2802428863 2802752400 170
324 iso_pu_bacteria 2802429268 2804752699 170
325 iso_pu_bacteria 2838074704 2838076920 170
326 iso_pu_bacteria 2844163670 2844166626 170
327 iso_pu_bacteria 2847417321 2847419347 170
328 iso_pu_bacteria 2848992105 2848994369 170
329 iso_pu_bacteria 2850079185 2850081384 170
330 iso_pu_bacteria 2855872281 2855876116 170
331 iso_pu_bacteria 2896384573 2896388117 170
332 iso_pu_bacteria 2913295892 2913299373 170
333 iso_pu_bacteria 2913308742 2913313740 170
334 iso_pu_bacteria 2915980308 2915981372 170
335 iso_pu_bacteria 2916061851 2916064234 170
336 iso_pu_bacteria 2920760137 2920761594 170
337 iso_pu_bacteria 2920822456 2920825152 170
338 iso_pu_bacteria 2921250672 2921252019 170
339 iso_pu_bacteria 2936996657 2936999667 170
340 iso_pu_bacteria 2937002841 2937007372 170
341 iso_pu_bacteria 2937009748 2937012898 170
342 iso_pu_bacteria 2937016420 2937022570 170
343 iso_pu_bacteria 2937023124 2937026905 170
344 iso_pu_bacteria 2937029754 2937030218 170
345 iso_pu_bacteria 2937036028 2937042598 170
346 iso_pu_bacteria 2937042894 2937045607 170
347 iso_pu_bacteria 2937049772 2937053657 170
348 iso_pu_bacteria 2937056579 2937063380 170
349 iso_pu_bacteria 2937063883 2937070707 170
350 iso_pu_bacteria 2937071275 2937071695 170
351 iso_pu_bacteria 2937078374 2937080344 170
352 iso_pu_bacteria 2937084907 2937086645 170
353 iso_pu_bacteria 2937091812 2937098177 170
354 iso_pu_bacteria 2937098957 2937102546 170
355 iso_pu_bacteria 2937106411 2937109214 170
356 iso_pu_bacteria 2937113482 2937117885 170
357 iso_pu_bacteria 2937119839 2937124064 170
358 iso_pu_bacteria 2937126314 2937130608 170
359 iso_pu_bacteria 2941499720 2941502196 170
360 iso_pu_bacteria 2957375807 2957376453 170
361 iso_pu_bacteria 2957382221 2957383407 170
362 iso_pu_bacteria 2957388812 2957392931 170
363 iso_pu_bacteria 2957395598 2957395953 170
364 iso_pu_bacteria 2957402308 2957406686 170
365 iso_pu_bacteria 2957408893 2957410747 170
366 iso_pu_bacteria 2957415311 2957417576 170
367 iso_pu_bacteria 2957422303 2957423696 170
368 iso_pu_bacteria 2957430029 2957434324 170
369 iso_pu_bacteria 2957437181 2957440198 170
370 iso_pu_bacteria 2957443900 2957446319 170
371 iso_pu_bacteria 2957450854 2957454747 170
372 iso_pu_bacteria 2957457609 2957461959 170
373 iso_pu_bacteria 2957464669 2957468665 170
374 iso_pu_bacteria 2957471148 2957476445 170
375 iso_pu_bacteria 2957478035 2957484700 170
376 iso_pu_bacteria 2957484790 2957488679 170
377 iso_pu_bacteria 2957491536 2957496948 170
378 iso_pu_bacteria 2957498199 2957503253 170
379 iso_pu_bacteria 2957505466 2957510558 170
380 iso_pu_bacteria 2960591022 2960592017 170
381 iso_pu_bacteria 2960597568 2960602471 170
382 iso_pu_bacteria 2960603979 2960606428 170
383 iso_pu_bacteria 2960610863 2960612374 170
384 iso_pu_bacteria 2960617483 2960621465 170
385 iso_pu_bacteria 2960624210 2960630810 170
386 iso_pu_bacteria 2960631154 2960631978 170
387 iso_pu_bacteria 2960637947 2960638619 170
388 iso_pu_bacteria 2960645483 2960649988 170
389 iso_pu_bacteria 2960652885 2960654501 170
390 iso_pu_bacteria 2960660292 2960661437 170
391 iso_pu_bacteria 2960667422 2960671753 170
392 iso_pu_bacteria 2960674078 2960678326 170
393 iso_pu_bacteria 2960680706 2960681553 170
394 iso_pu_bacteria 2960687367 2960692167 170
395 iso_pu_bacteria 2960693952 2960698136 170
396 iso_pu_bacteria 2964607997 2964614483 170
397 iso_pu_bacteria 2964615318 2964621084 170
398 iso_pu_bacteria 2964621998 2964625705 170
399 iso_pu_bacteria 2964628898 2964632966 170
400 iso_pu_bacteria 2964636051 2964640168 170
401 iso_pu_bacteria 2964643177 2964646858 170
402 iso_pu_bacteria 2964649959 2964655362 170
403 iso_pu_bacteria 2964656573 2964663199 170
404 iso_pu_bacteria 2964663802 2964668276 170
405 iso_pu_bacteria 2964678106 2964681572 170
406 iso_pu_bacteria 2964685014 2964691364 170
407 iso_pu_bacteria 2964691889 2964698298 170
408 iso_pu_bacteria 2964698721 2964705076 170
409 iso_pu_bacteria 2964705432 2964709850 170
410 iso_pu_bacteria 2964712639 2964716504 170
411 iso_pu_bacteria 2964719344 2964721562 170
412 iso_pu_bacteria 2967664464 2967666442 170
413 iso_pu_bacteria 2967671571 2967675888 170
414 iso_pu_bacteria 2967678726 2967684482 170
415 iso_pu_bacteria 2967686174 2967688900 170
416 iso_pu_bacteria 2967693043 2967699798 170
417 iso_pu_bacteria 2967699805 2967704915 170
418 iso_pu_bacteria 2967706974 2967711524 170
419 iso_pu_bacteria 2967714385 2967714817 170
420 iso_pu_bacteria 2967721400 2967725789 170
421 iso_pu_bacteria 2967728569 2967729065 170
422 iso_pu_bacteria 2967735183 2967738837 170
423 iso_pu_bacteria 2967742019 2967745239 170
424 iso_pu_bacteria 2967748971 2967753545 170
425 iso_pu_bacteria 2967755722 2967758977 170
426 iso_pu_bacteria 2967762386 2967768502 170
427 iso_pu_bacteria 2967769361 2967773870 170
428 iso_pu_bacteria 2967775926 2967777942 170
429 iso_pu_bacteria 2970019648 2970023471 170
430 iso_pu_bacteria 2970026789 2970030373 170
431 iso_pu_bacteria 2970033650 2970040233 170
432 iso_pu_bacteria 2970040964 2970042109 170
433 iso_pu_bacteria 2970047711 2970053988 170
434 iso_pu_bacteria 2970054988 2970059307 170
435 iso_pu_bacteria 2970061556 2970065636 170
436 iso_pu_bacteria 2970068827 2970075469 170
437 iso_pu_bacteria 2970076120 2970080215 170
438 iso_pu_bacteria 2970082768 2970087759 170
439 iso_pu_bacteria 2970088815 2970093242 170
440 iso_pu_bacteria 2970095765 2970100093 170
441 iso_pu_bacteria 2970102677 2970108056 170
442 iso_pu_bacteria 2970109326 2970113907 170
443 iso_pu_bacteria 2970116247 2970117298 170
444 iso_pu_bacteria 2970122695 2970127380 170
445 iso_pu_bacteria 2970129317 2970133224 170
446 iso_pu_bacteria 2970136068 2970140481 170
447 iso_pu_bacteria 2970143518 2970146171 170
448 iso_pu_bacteria 2970149975 2970155990 170
449 iso_pu_bacteria 2970156795 2970161070 170
450 iso_pu_bacteria 2970164137 2970168455 170
451 iso_pu_bacteria 2970170962 2970171879 170
452 iso_pu_bacteria 2970177841 2970182873 170
453 iso_pu_bacteria 2970184632 2970188720 170
454 iso_pu_bacteria 2970191845 2970196343 170
455 iso_pu_bacteria 2977516862 2977518452 170
456 iso_pu_bacteria 2977523885 2977526271 170
457 iso_pu_bacteria 2977530762 2977534365 170
458 iso_pu_bacteria 2977537788 2977541998 170
459 iso_pu_bacteria 2977544691 2977547732 170
460 iso_pu_bacteria 2977551784 2977558375 170
461 iso_pu_bacteria 2977558990 2977562702 170
462 iso_pu_bacteria 2977565890 2977570249 170
463 iso_pu_bacteria 2977572785 2977577050 170
464 iso_pu_bacteria 2977579622 2977583599 170
465 iso_pu_bacteria 643692032 643826228 170
466 iso_pu_bacteria 648276728 648740514 170
467 iso_pu_bacteria 8003992118 8003994106 170
468 iso_pu_bacteria 8003999396 8004001728 170
469 iso_pu_bacteria 8049293176 8049295265 170
470 3300002773 JGI25152J39213_1001554 JGI25152J39213_10015545 171
471 3300003322 rootL2_10020315 rootL2_100203152 171
472 3300003354 JGI25160J50197_1004590 JGI25160J50197_10045904 171
473 3300003775 Ga0055524_1014716 Ga0055524_10147162 171
474 3300003790 Ga0055528_1008457 Ga0055528_10084575 171
475 3300005347 Ga0070668_100150674 Ga0070668_1001506741 171
476 3300005355 Ga0070671_100253231 Ga0070671_1002532312 171
477 3300005455 Ga0070663_100533833 Ga0070663_1005338331 171
478 3300005841 Ga0068863_100854587 Ga0068863_1008545872 171
479 3300006186 Ga0075369_10006052 Ga0075369_100060523 171
480 3300006353 Ga0075370_10116024 Ga0075370_101160242 171
481 3300009011 Ga0105251_10013331 Ga0105251_100133312 171
482 3300009177 Ga0105248_10742386 Ga0105248_107423862 171
483 3300009553 Ga0105249_10127950 Ga0105249_101279502 171
484 3300014325 Ga0163163_10702449 Ga0163163_107024491 171
485 3300025245 Ga0207425_1031597 Ga0207425_10315971 171
486 3300025258 Ga0209129_1002468 Ga0209129_10024682 171
487 3300025273 Ga0209673_1016936 Ga0209673_10169362 171
488 3300025284 Ga0209130_1033723 Ga0209130_10337232 171
489 3300025294 Ga0209025_1011126 Ga0209025_10111265 171
490 3300025295 Ga0209564_1006200 Ga0209564_10062001 171
491 3300025295 Ga0209564_1034303 Ga0209564_10343033 171
492 3300025299 Ga0209256_1001510 Ga0209256_10015106 171
493 3300025299 Ga0209256_1007982 Ga0209256_10079824 171
494 3300025302 Ga0207426_1002432 Ga0207426_10024322 171
495 3300025735 Ga0207713_1088953 Ga0207713_10889531 171
496 3300025931 Ga0207644_10251768 Ga0207644_102517682 171
497 3300025961 Ga0207712_10400171 Ga0207712_104001712 171
498 3300025972 Ga0207668_10227293 Ga0207668_102272931 171
499 3300026067 Ga0207678_10041534 Ga0207678_100415343 171
500 3300048903 Ga0496100_0425828 Ga0496100_0425828_283_798 171
501 3300048904 Ga0496101_0069406 Ga0496101_0069406_164_679 171
502 3300048905 Ga0496102_0135610 Ga0496102_0135610_1396_1911 171
503 3300048907 Ga0496104_0237214 Ga0496104_0237214_268_783 171
504 3300048908 Ga0496105_0086223 Ga0496105_0086223_1854_2369 171
505 3300048909 Ga0496106_0525636 Ga0496106_0525636_168_683 171
506 3300048910 Ga0496107_0192796 Ga0496107_0192796_609_1124 171
507 3300048911 Ga0496108_0313298 Ga0496108_0313298_172_687 171
508 3300048912 Ga0496109_0557931 Ga0496109_0557931_365_880 171
509 3300048913 Ga0496110_0559078 Ga0496110_0559078_257_772 171
510 3300048914 Ga0496111_0234004 Ga0496111_0234004_370_885 171
511 3300048915 Ga0496112_0105085 Ga0496112_0105085_2181_2696 171
512 3300048916 Ga0496113_0237601 Ga0496113_0237601_421_936 171
513 3300048917 Ga0496114_0013533 Ga0496114_0013533_261_776 171
514 3300048919 Ga0496116_0085683 Ga0496116_0085683_398_913 171
515 3300048920 Ga0496117_0376839 Ga0496117_0376839_91_606 171
516 3300048922 Ga0496119_0145468 Ga0496119_0145468_397_912 171
517 3300048924 Ga0496121_0408189 Ga0496121_0408189_20_535 171
518 3300048925 Ga0496122_0062866 Ga0496122_0062866_1801_2316 171
519 3300048926 Ga0496123_0024026 Ga0496123_0024026_3962_4477 171
520 3300048927 Ga0496124_0148412 Ga0496124_0148412_275_790 171
521 3300048928 Ga0496125_0048718 Ga0496125_0048718_2620_3135 171
522 3300048929 Ga0496126_0324182 Ga0496126_0324182_365_880 171
523 3300050492 nmdc:mga0yw44_431362_c1 nmdc:mga0yw44_431362_c1_356_871 171
524 3300050516 nmdc:mga0sz30_123471_c1 nmdc:mga0sz30_123471_c1_210_725 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

13

177

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg4-assembly1.cif.gz_A x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim 0.9557 6 170
7mym-assembly1.cif.gz_A crystal structure of escherichia coli dihydrofolate reductase in complex with trimethoprim and nadph 0.9553 6 169
4p66-assembly1.cif.gz_A electrostatics of active site microenvironments of e. coli dhfr 0.9543 6 170
4p68-assembly1.cif.gz_A electrostatics of active site microenvironments for e. coli dhfr 0.954 6 170
5w3q-assembly1.cif.gz_A l28f e.coli dhfr in complex with nadph 0.9528 6 170
ID Description Score Start End Superfamily
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9565 6 170 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9369 5 170 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9369 5 170 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9255 5 170 3.40.430.10
4fghA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.922 5 170 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A1H8RC03-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9915 1 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7X8Y905-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9877 1 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A1H8RC03-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9857 1 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7X8Y905-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9819 1 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A4R5PHC5-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9752 2 170 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Feature Viewer

pLDDT pTM Quality
94.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map